SEISCO PRODUCT GUIDE - SEISCO...Tankless Water Heater by yaofenjin

VIEWS: 152 PAGES: 141

									6(,6&2352'8&7*8,'(
                                                Seisco Product Guide – Table Of Contents (Version 11.03)




                             SEISCO®
          Product Guide for Water Heating & Space Heating
                      TABLE OF CONTENTS

1 1.   INTRODUCTION (2 pages – 561 KB)
          a. What is a Seisco?
          b. Why is Seisco Superior?
          c. What are the Design Considerations? (Water Heating / Space Heating)

2 2.   GENERAL DESCRIPTION OF USES (10 pages – 57 KB)
          a. Typical Uses for The Seisco
          b. Solar Systems
          c. Ultra-High Efficiency Saves Money
          d. No Hidden Costs
          e. How to Select The Proper Size Seisco
          f. Rules of Thumb
          g. Most Important Design & Use Considerations

3 3.   PRODUCT DESCRIPTION AND SPECIFICATIONS (18 pages – 1.3 MB)
          a. General Product Description
          b. Model Descriptions
                •   Water Heaters (RA Models)
                •   Space Heaters / Micro-Boilers (SH Models)
          c. Product Specifications & Ratings
          d. Internal Workings & Parts Identification
4 4.   APPLICATIONS AND DIAGRAMS (21 pages – 312 KB)
          a. Seisco Model Selection Criteria
          b. Residential Floor Plan Diagrams
          c. Application Diagrams
                 i. Water Heating Applications
                ii. Water Heating High Flow Applications
                iii. Space Heating Applications



                                                                                            (Over) 1
                                               Seisco Product Guide – Table Of Contents (Version 11.03)



                iv. Dual Space Heating & Water Heating Systems
                 v. Active Renewable Energy System Applications
                          •   Solar Heating Back-up
                          •   Geothermal Heating Back-up



5 5.   ELECTRICAL WIRING REQUIREMENTS AND SAMPLE CALCULATIONS (28 pgs – 477 KB)
          a. Introduction to Seisco Electrical Requirements
          b. NEC Rules for Load Calculations
          c. Sample Residential Load Calculations
          d. NEC Rules for Branch Circuit Protection
          e. Seisco Electrical Wiring Guide Diagrams
                 •   Water Heaters (RA Models)
                 •   Space Heaters (SH Models)
          f. Single & Three Phase Wiring Diagrams

6 6.   INSTALLATION AND WARRANTY (13 pages – 339 KB)
          a. Mounting & Clearance Requirements
          b. Plumbing Installation
          c. Electrical Installation
          d. Warranty
                 •   Water Heaters
                 •   Space Heaters (Micro-Boilers)
    7. COST COMPARISONS (10 pages – 77 KB)
7
          a. Introduction to Cost Comparisons
          b. Notes & Assumptions
          c. Cost Comparison Tables

8 8.   SEISCO LISTINGS AND TEST REPORTS (14 pages – 135 KB)
          a. Patents & Compliance Listings
          b. Evaluation Projects
          c. References
          d. Testing & Reports


                                                                                           (Over) 2
                                            Seisco Product Guide – Table Of Contents (Version 11.03)




9   9. APPENDIX
         a. Spec Sheets for Water Heaters
            •   (Models RA-28 thru RA-05)
         b. Spec Sheets for Space Heaters (Micro-Boilers)
            •   (Models SH-28 thru SH-05)
         c. Residential Water Heater Quick Guide
         d. Radiant Floor / Space Heating Quick Guide




                                                                                        (Over) 3
                                                      Seisco Product Guide – Introduction (Version 11.03)




1    INTRODUCTION
                 TO
        THE SEISCO®

WHAT IS IT AND HOW DO I USE IT?

The Seisco is a very small but very
powerful, extremely efficient and versatile
electric water-heating system. The Seisco,
whose technology has earned five U.S. Patents
and many more foreign patents, is much more
than just a water heater.

The Seisco was measured to be over
99% efficient by an agency of the Federal
Government.

The Seisco water heating system’s design,
not only considers electrical and plumbing
requirements of the application, but also;
space utilization, environment, and any
preheating systems such as heat recovery, solar and geothermal. Space heating,
particularly radiant floor heating provides additional applications for the Seisco water-
heating system.

WHY IS THE SEISCO SUPERIOR TO ALL OTHER ELECTRIC TANKLESS
WATER HEATERS?

Power Sharing: First, the Seisco is the only electric tankless water-heater, which enjoys
a patented power-sharing distribution method for activating the heating elements. This
method allows each one of the multiple heating elements to simultaneously provide the
appropriate amount of heat to the fluid as it flows through the heat exchanger. Other
instantaneous electric heaters utilize systems that activate the elements individually to
full power one after another. This is known as a sequential activation power scheme and
it creates hot spots in the heating chamber particularly at shut down. The hot spots
literally boil the minerals out of the water creating excessive mineral buildup and
discharge. The inferior sequential activation power scheme used by other heaters also
activates certain heating elements more than others, resulting in early failures of the
elements.

Eliminates Flicker: Second, the Seisco is the only electric tankless water heater that
controls power to the elements in a very unique and patented power-modulating


                                                                                                       1
                                                         Seisco Product Guide – Introduction (Version 11.03)



pattern. This feature insures that the use of the Seisco does not create disturbance
(flicker) in the lighting circuits. This is very important since the proper temperature
control for electric tankless water-heaters depends on modulating or instantaneously
varying the power to high-wattage heating elements. Without the Seisco’s patented
control, one can experience lights that flicker in the same modulating manner as if you
were at your thermostat turning the air conditioner or electric heating off and on rapidly.

Safety: Third, Seisco is the only electric tankless water-heater that has a complete array
of dependable safety features to prevent harm to the user and the heater. They include,
redundant high-temperature limit switches on independent circuitry in addition to the
control’s internal high-temperature shut down. Dual low-water level detectors are used to
prevent dry firing of the heating elements. A leak detector is mounted on the casing that
sounds an alarm to the user and automatically shuts off the power to the heating elements
in case a leak occurs. The control board is protected against electrical surges, and
additional heater protection is achieved when the relays are opened during periods of
standby, providing no path for the surge to reach the heating elements. Also, the chamber
is designed with a patented venting system that continuously vents harmful gasses and air
during operation.

Ease of Service and Self-diagnostics: Fourth, Seisco is the only electric tankless water-
heater with a microprocessor control that is programmed to provide self-diagnostics. In
the event of a problem with the heater, the control emits a visual or optional built-in
audible code. The user can interpret these codes or a remote service technician can over
the phone to help pinpoint the problem and significantly reduce trouble-shooting time and
expense. In addition, there are convenient clean-out plates below the heating chambers
that allow the user if necessary, to remove any build-up, sand or grit. Modular
construction and standard off-the-shelf heating elements help make this heater easy and
inexpensive to service.

WHAT ARE THE DESIGN CONSIDERATIONS?

       The plumbing requirements are very simple. An inlet cold-water line and an outlet
hot-water line are all that are required for a basic home installation. Other applications
may require specialized plumbing design to obtain maximum benefit from the Seisco.
Design options and suggestions are discussed in the Plumbing subpart of the “General
Description an Uses of The Seisco” section of this Product Guide.

         The Seisco’s electrical requirements are quite different from those of a tank type
heater. It should be remembered that in any application, the electrical service to the
building should be properly sized to accommodate the addition of all major electrical
appliances including the Seisco electric tankless water-heater. For example, some rural
residences, even those that do not have electric water heaters, may experience light
flicker, even from hair dryers, as a result of inadequate or improperly designed
electrical service to the house. A complete explanation of the electrical requirements for
the Seisco is presented in the Electrical subpart of the “General Description and Uses of
The Seisco” section of this Product Guide.



                                                                                                          2
2      GENERAL DESCRIPTION AND USES OF THE SEISCO®

                                                  Table of Contents


    TYPICAL USES FOR THE SEISCO:............................................................................... 2

      RESIDENTIAL INCLUDING MULTIFAMILY:........................................................ 2

      COMMERCIAL AND INDUSTRIAL APPLICATIONS: ........................................ 2

      THE SEISCO WITH SOLAR AND OTHER SYSTEMS:........................................ 3

         SOLAR SYSTEMS:..................................................................................................... 3

      SEISCO’S ULTRA HIGH EFFICIENCY SAVES YOU MONEY. ......................... 4

      THE SEISCO HAS NO HIDDEN COSTS. ................................................................. 5

      HOW DO I SELECT THE PROPER SIZE FOR MY HOME? ............................... 6

      RULES OF THUMB FOR SIZING. ............................................................................ 7

         IN AREAS WITHOUT VERY COLD GROUND WATER:...................................... 7

         IN AREAS WITH VERY COLD GROUND WATER SUCH AS THE ROCKY

         MOUNTAINS:............................................................................................................. 7

         SPACE HEATING:...................................................................................................... 8

      MOST IMPORANT CONSIDERATIONS FOR PROPER DESIGN AND USE: .. 8

         LOCATION: ................................................................................................................ 8

         PLUMBING:................................................................................................................ 9

         ELECTRICAL SERVICE:........................................................................................... 9

         VOLTAGE AND SERVICE REQUIREMENTS:..................................................... 10
                                  Seisco Product Guide – General Description (Version 1.1)



                     TYPICAL USES FOR THE SEISCO



RESIDENTIAL INCLUDING MULTIFAMILY:

There are many ways to use the Seisco in your home, apartment, condominium, or
manufactured house. The major applications are highlighted below.

       a. Design the Seisco as your SOLE and TANKLESS water heating system to
          provide your family with abundant and endless hot water for domestic use.

       b. Why wait for hot water? Use the Seisco as a downstream extender and
          booster and to your existing water heater and provide rapid hot water delivery
          to your master bath or remote room. You will be able to significantly increase
          the hot water capacity at this location, even your entire home, including the
          ability to fill your spa tub, and still have hot water left over.

       c. Heat your home using a Seisco, instead of a boiler, to provide hot water for
          your radiant floor, baseboard, or other hydronic space-heating system.

       d. Design a Seisco combination system to heat your house and enjoy endless
          hot water for domestic use, using the very same Seisco(s). This system’s
          design separates, when necessary, the space heating fluid from your domestic
          water, safely and efficiently heating both.

       e. Add a Solar water-heating system and have the perfect system.

       Refer to the “Applications” Section of this Manual for helpful design
       suggestions.


COMMERCIAL AND INDUSTRIAL APPLICATIONS:

Simultaneously provide the domestic hot water and/or space-heating requirements with a
Seisco designed system. Replace expensive boilers when steam isn’t required.

       Refer to the “Applications” Section of this Manual for helpful design
       suggestions.




                                                                                         2
                                  Seisco Product Guide – General Description (Version 1.1)




THE SEISCO WITH SOLAR AND OTHER SYSTEMS

OPTIMIZE EFFICIENCY WITH SOLAR, OR OTHER PASSIVE WATER
HEATING OR PRE-HEATING SYSTEMS.


SOLAR SYSTEMS:

 Any of the aforementioned applications can be designed to include a solar water-heating
system in conjunction with a Seisco. The efficiency of any solar water heating system is
substantially increased through the use of the Seisco. The reasons are simple as shown
by comparing a conventional system with a Seisco enhanced system.

A conventional system: The storage tanks of a typical passive system are equipped with
either electric resistance heating elements or gas burners that are activated in response to
thermostatic controlled switches. The thermostats are typically set in a standard stand-
alone tank water heater at 135° F. For safety reasons, the solar collector’s fluid thermostat
is most generally set at a maximum of 160º F. This temperature set point controls the
maximum temperature of the solar heated fluid that can be used to provide hot water to
the storage tank, a difference of only 25ºF. This is important to remember. When the
incoming water temperature is 45º F, the temperature rise required to reach the tank's set
point of 135ºF is 90º. The auxiliary heating source, heating/recovering much faster than
solar, will always outpace the solar heating to provide this temperature rise. The solar
collector, whose maximum fluid temperature is 160º F, will then increase the fluid
temperature, by only the difference, in this case, of an additional 25º or a maximum of
22% of the total temperature rise.

        As hot water is used, fluid is drawn out of the tank and cold incoming water is
introduced. The tank’s fluid temperature quickly drops below the set point particularly in
colder times of the year. The tank’s thermostat activates the auxiliary heating source,
which again heats the water during and after use much quicker than the solar system,
overriding the solar contribution and thus limiting the system’s overall efficiency.

The Solar system with a Seisco: Using        the Seisco as an auxiliary water heater with a
solar water-heating system, includes the     use of a storage tank without an internal
auxiliary heating source or thermostat.       The solar collector is thus able to contribute
100% of its potential heat to the stored     water, limited only by the pre-set maximum,
typically 160º.

       As water is being used, it is drawn out of the tank, then through a tempering
valve. The tempering valve regulates the water temperature by adding cold water when
necessary to insure that the outflowing water temperature does not exceed a safe set point
temperature (i.e. nominally 125ºF). The tempered water then flows through the Seisco,
which is externally mounted down stream of the storage tank. If the water passing


                                                                                           3
                                 Seisco Product Guide – General Description (Version 1.1)


through the Seisco is already hot enough, the Seisco does not turn on and no energy is
used. As the water temperature drops, the Seisco’s precise heating control adds only
enough heat to the water to incrementally bring the temperature up to the desired set
point.

        When hot water use is terminated, the Seisco turns off and goes into the standby
mode. The solar system continues to heat the stored water providing 100% of the heat to
that water between periods of hot water use. In such a properly designed system, the
Seisco is capable of providing 100% of the hot water for the application when solar
heating is not available. The Seisco, however does not heat water except when needed
and never heats more water than is actually used. The Seisco precisely adds only the heat
required to raise the water temperature of pre-heated water to the desired minimum set
point temperature.

The Seisco and other systems: The Seisco improves the utility and efficiency of any
                                                                      eothermal, de-
water heating system coupled with any source of pre-heated water from g
superheaters, waste heat or typical heat recovery systems.

        The “Applications Section” of this Manual will provide you with helpful design
suggestions for each such application.


SEISCO’S ULTRA HIGH EFFICIENCY SAVES YOU MONEY.

       Understanding the difference between demand and energy consumption.

         Years ago when the double oven was first marketed; there was a grave and now
almost comical misconception of the results of its expected use. The electrical services to
homes in those days were rated for very small electrical demand compared to those of
today. Most people’s homes had electrical circuits protected by fuses instead of circuit
breakers as we use today. The electric utilities believed that with the advent of the
double oven, their worse nightmare was about to occur. They envisioned most families
wanting this new appliance, which would allow the housewife to cook full meals at one
time. The prospect that homeowners at Thanksgiving or Christmas would be cooking a
turkey for hours in one oven and other foods simultaneously in the other gave rise to
concerns that the electric transformers serving these homes would burn up with all this
added electrical demand (load). Soon studies were made measuring the actual effects of
such use in normal conditions. It was quickly discovered that the true diversity of such
systems had not been properly considered and that the perceived problem was no
problem at all. Ovens heat up and then only periodically cycle to maintain the heat over
the long cooking periods. People don’t all cook at the same time and a great many people
during these occasions meet in family situations that reduce the number of households
actually using the ovens.

       The same diversity principle applies today with the Seisco on demand water
heater. First, water-heating use is typically off peak, occurring mostly in the early



                                                                                         4
                                  Seisco Product Guide – General Description (Version 1.1)


morning or evening. These are times of the day when the Power Company generally has
more available generating capacity. Secondly a gallon of water is a gallon of water no
matter how fast you can pour it. If over any specific period of time you use a specific
volume of anything, water or kilowatts. the total consumption is the same spread out
(diversified) over that same period of time. Given that fact, it should be obvious that
whether you are measuring per second, per hour, etc., the diversified usage (total usage
spread over the period) between the tank type heater and the Seisco will be substantially
equal.

         Although, given any neighborhood of homes with an equal number of Seisco
heaters and tank heaters, there will be many more tank heaters actually heating water
simultaneously than the Seisco heaters. This will be the observation during any 15-
minute sampling period of the day. The reason for this is that a tank heater will continue
to heat for recovery, for as long as 45 minutes after the water usage stops. The Seisco
heater, however, stops heating after usage or after the demand for hot water is shut off. In
standby, the Seisco heater does not have to continue heating to recover a lost reserve of
hot water like the tank heater. Even though the Seisco heater can require more power
(kW) or can pull more current (amps) during use than a tank heater, there will be a
significantly lesser number of Seisco heaters actually heating the water at the same time.
The resulting electrical load (kW or amps) for the Seisco heaters that are on
simultaneously will also be diversified and not the same in each home. For instance, one
person may be showering while another neighbor is shaving. Because of the various
stages of usage and the various use of flow rates within the neighborhood, the relative
heating and electrical demand requirement for these activities will not be the same.

        It must be noted that tank heaters will continue to heat the water in the tank
beyond the actual temperature selected. The reason is that there exists hysterisis or
delay in the response from the thermostat that causes the heater to overheat the full tank
of stored water by 6º or more. Doesn’t sound like much? Consider how many times a
day the tank actually heats the total volume stored by this amount. The Seisco contains
less than one gallon of water, and except for the control logic, turns off and stays off
during periods of non-use using almost no energy.

         Given these facts, it should be obvious why the Seisco type heater is much more
efficient than a tank heater. The Seisco does not keep reheating the same water all day
and night. Furthermore you can place the Seisco closer to the major points of use,
reducing the amount of hot water, that you paid to heat, left in the supply lines to cool.
That water is wasted since it is discharged as cold water down the drain. With the Seisco
system you can not only save energy but also water.


THE SEISCO HAS NO HIDDEN COSTS.

       Gas storage tank heaters have a great deal more standby heat losses as air is
drawn through the middle of the heater and out through the flue during periods of non-
use. The water is cooled down and reheated often. Today in most areas, the cost of gas



                                                                                          5
                                  Seisco Product Guide – General Description (Version 1.1)


is rising proportionally much faster than the cost of electricity and expected to
continue disproportional to your electrical costs.

       Plan to Save Energy and Money.


HOW DO I SELECT THE PROPER SIZE FOR MY HOME?

       Seisco offers a myriad of options for your hot water system.

        The selection of the proper model of the Seisco for your home will in initially
depend upon your electrical service. If you do not have sufficient electrical service to
replace your tank heater, then the Seisco “Extender” model RA-18 is your perfect choice
for extending your hot water capacity.

          There are some people who wish to keep a small gas tank water heater, albeit
                                                                             h
turned down low. They use it as a pre-heater and an emergency back up in t e event
there is a temporary electrical outage.

           Most people, however, recognize that power outages are generally very rare and
short lived in their locale. The opportunity to get rid of the tank holds many benefits not
the least of which is recovering large areas that can be converted to closets or other
storage areas. The Seisco also provides a safe system for an endless supply of hot water
that all of us want.

        The final selection of your SEISCO model will, not only depend on hot water
usage requirements, but also your personal lifestyle preferences. For example, in
typical installations the single Seisco will provide all the hot water normally required for
household use without running out. A trade off can be the fill rate for a bathtub. Tubs
were designed to be filled very fast, not as a convenience, but to insure the delivery of
the maximum amount of hot water before it mixed with the cold incoming water. Most
of us recall the habit of filling the tub with the hot water on full. We couldn’t even put
our hand in the tub until finally the hot water ran out and we began cooling the tub water.
Only after the tub was full could we attempt to get into it. Then within just a few
minutes the water temperature at the bottom of the tub began getting cold.

        The Seisco is designed to provide hot water endlessly at normal flow rates.
Typically, with a properly designed Seisco system as discussed above, you can take two
showers at the same time. In certain areas of the country, taking two showers at the same
time may not be possible during the colder periods of the year. The water temperature
during these times can change significantly particularly in the mountainous areas. You
will, however, always enjoy endless hot water for shower after shower—endlessly. Tub
flow rates are not standard and you may need to reduce the flow or fill rate to maintain
the water at the desired fill temperature. You do not want to fill the tub with water hotter
than that in which you expect to bathe. This means that you can get in the tub sooner and
start enjoying your whirlpool. Even though it may take longer to fill, you can keep the



                                                                                          6
                                  Seisco Product Guide – General Description (Version 1.1)


water hot by continuing to add hot water. Best of all, after your tub bath you will have all
the hot water you need to shower and rinse off and continue with any other hot water
requirements such as dishwashing etc. We call this the short wait (fill time) that
avoids the long (out of hot water) wait.

        Some people will elect to install a second Seisco to insure a faster fill rate or
overall higher flow capacity. Although these people represent a small percentage of our
customers, it becomes a personal choice as Seisco provides you with full design options.


RULES OF THUMB FOR SIZING.


IN AREAS WITHOUT VERY COLD GROUND WATER:

Families of 4 or less: Minimum RA-22
(Spa tub or higher flow options: RA-28, two RA-18 in parallel or one RA-18 in
master bath plumbed in series* with primary Seisco or tank heater.)

Families of 5 and larger: Minimum RA-28
(Spa tub higher flow options: two RA-18 in parallel or one RA-18 in master bath
plumbed in series* with primary Seisco or tank heater.)


IN AREAS WITH VERY COLD GROUND WATER SUCH AS THE ROCKY
MOUNTAINS:

Families of 4 or less: Minimum RA-28
(Spa tub or higher flow options: two RA-18 in parallel or one RA-18 in master bath
plumbed in series* with primary Seisco or tank heater.)

Families of 5 and larger: Minimum Two RA-18 in parallel.
(Spa tub higher flow options: two RA-22 in parallel or one RA-22 in master bath
plumbed in series* with primary Seisco or tank heater.)

* The Seisco RA-18 will provide sufficient hot water for the single shower and sinks
in the master bath but must be plumbed in series with the primary water heater as
it requires the additional pre-heated water for the tub or simultaneous use.

(Refer to “Product Description and Specifications” Section.




                                                                                          7
                                   Seisco Product Guide – General Description (Version 1.1)


SPACE HEATING:

A qualified HVAC contractor should size the Seisco according to the calculated
heating requirements. The HVAC contractor will calculate the Btu per hour
requirements and can select the proper Seisco model from the following.

Output Btu ratings for the Seisco models can be determined by multiplying the
Seisco model number x 3,413. For example model RA-28. 28 X 3,413 = 95,564
Btu/hr, Model RA-9 is 9 X 3,413 = 30,717 Btu/hr.

SPACE HEATING, INCLUDING SPACE HEATING COMBO APPLICATION
DESIGNS REQUIRE USING TWO SEISCO’S PLUMBED IN PARALLEL. THE
SUM OF THEIR COMBINED POWER RATINGS MUST EQUAL A MINIMUM
OF 125% OF THE BTUs PER HOUR CALCULATED AS REQUIRED.

WHEN USING THE SEISCO AS A COMBO FOR COMBINED DOMESTIC AND
SPACE HEATING, ALWAYS DESIGN FOR THE LARGEST HOT WATER
DEMAND REQUIRED AS DETERMINED BY EITHER THE DOMESTIC OR
SPACE HEATING REQUIREMENT.

When ordering the Seisco for space heating alone, it is imperative that an “SH” is
added after the model number to indicate a special control program for space
heating applications. i.e. Seisco RA-28 SH.

When ordering the Seisco for a combo application indicate by adding the letters
“SHC” after the model number. i.e. Seisco RA-28 SHC.



MOST IMPORANT CONSIDERATIONS FOR PROPER DESIGN AND USE.

      Today more than ever, one of the smartest and best investments you will ever
make in your home is upgrading an old electric service or providing more than the
minimum electrical service required for your new home or building.


LOCATION:

You should never plan to zone your house in such a manner that requires multiple
Seisco’s of nearly the same power rating for the purpose of providing hot water to
separate areas of use (i.e. bathrooms). This is common for tank design, but wrong for
your Seisco system. Place your Seisco or Seiscos at the “Heart of Your Home”
centrally located between the master bath and kitchen areas. Multiple units used this way
should be installed in parallel, equalizing the demand from each and maximizing the
system’s heating capacity. If your house is particularly long, you may want to place
your primary Seisco slightly closer to remote bathrooms and kitchen areas and install an


                                                                                            8
                                   Seisco Product Guide – General Description (Version 1.1)


extender/booster unit in the master bath. This booster/extender unit should, in most
cases, never be smaller than the Seisco RA-18 and it must be plumbed in series with the
primary Seisco.

       Refer to the “Suggestions for Locating Your Seisco” Section of this Manual for
       helpful design suggestions.


PLUMBING:

 For years in many areas of the country, the hot-water distribution lines from the water
heater have been uninsulated. Regardless of whether you are going to use a tank heater
or a Seisco, the best investment for saving energy and optimizing your hot water system
is to insist that your hot-water distribution lines be properly insulated. In many areas of
the country, highly heat conductive copper hot-water lines are actually run un-insulated
beneath the slab. W    hen this is done the heat loss from the hot water during transportation
from the heater to the fixture can be 10 to 15º F. This loss does not help anyone and can
cost you as much as 25% of the water heating costs. A few hundred dollars spent up
front can not only save much more than it costs but will improve the hot water delivery
system substantially. Remember, where ever possible insulate your hot water lines.

           Explore other new technologies such as a hot-water manifold distribution
           system. The use of PEX tubing and standard manifolds (a large copper
           pipe with multiple individual outlets) offers an affordable and unique
           means for directing your hot water directly to the fixture in use. When
           properly designed this type of system will greatly enhance your hot water
           distribution, providing delivery of hot water directly and quickly to your
           fixture without first going through a long loop. In two story homes, the
           GFX waste heat recovery system provides substantial benefit at a very
           reasonable cost. The Seisco web site will provide you with helpful links.


ELECTRICAL SERVICE:

Whether you are considering retrofitting or new construction, the initial primary
consideration for use of a Seisco is the electrical design. The Seisco represents only a
part of your overall electrical requirements so when a reference is made to “electric
service” it means the rating of the building’s primary electric service. Typically, in an
existing building you will be able to determine the rating of your service by looking at the
number written on your main breaker (i.e. 125, 150, 200 amperes or more). Many
buildings will actually have two electrical panels that are connected to provide the total
service. This type of service is generally designed for applications requiring over 200
amps. In any case, we are not referring to sub-panels that are located within the
structure, typically downstream of the main panel.




                                                                                            9
                                 Seisco Product Guide – General Description (Version 1.1)


VOLTAGE AND SERVICE REQUIREMENTS:

The Seisco is available for single phase 50/60 Hz services operating at 220/240 volts.
Single-phase 208 volt models are available with the largest kW rating presently being
24kW at 208 volts. Three phase models will be available in 2001.

      THERE ARE CERTAIN RULES OF THUMB RELATED TO THE
ELECTRICAL REQUIREMENTS FOR THE SEISCO THAT APPLY FOR
INITIAL DISCUSSIONS ONLY. THESE ARE NEVER A SUBSTITUTE FOR
THE PROPER CALCULATION OF SERVICE LOAD REQUIREMENTS.

        For example, if you are going to replace your tank with a Seisco in an existing
dwelling and it has been determined that your home requires the Seisco model RA-28,
then your existing electrical service should be rated at a minimum of 200 amperes. For
an RA-22, your existing service should be rated at a minimum of 150 amperes.

         If you are building a new home, your builder will be able to accommodate the
electrical design requirements with no difficulty. The maximum rating on commercially
available single panels for residential use is typically 225 amps. If you have a large
house and your service requirements exceeds this rating, the electrician should use the A
and B panel approach which connects two residential panels to give you the total service
you need. If you are ever told you need an industrial panel in a residential
application, you should seek other professional advice.



       DON’T FALL VICTIM TO SOMEONE ELSE’S LACK OF EXPERIENCE.

         The Seisco is EXCITING new technology. All too often we hear accounts
from people who were told that they would need huge increases to their electric
service just to accommodate their new Seisco. The fact is that in almost every case this
was an error on the part of the electrician, who either did not understand how the Seisco
differed from older technology, how it is rated, and/or how to properly calculate the
diversity of its electrical requirements in accordance with the National Electric Code.

        SERVICE LOAD REQUIREMENTS FOR NEW HOMES AND OTHER
NEW RESIDENTIAL SHOULD BE CALCULATED UNDER PART “C” OF NEC
ARTICLE 220-30 AND FOR RETROFIT RESIDENTIAL UNDER NEC
ARTICLE 220-31 IN LIEU OF OTHER METHODS. THE ELECTRICIAN
SHOULD NOT MIX THE METHODS FOR CALCULATIONS UNDER THESE
SUB SECTIONS WITH PARTS “A” OR “B” OF ARTICLE 220.
(Refer to “Electrical Load Calculation Examples” in the Electrical Requirements
Sectio)




                                                                                      10
                             SEISCO Product Guide – Description & Specifications (Version 11.03)




                    SEISCO®
3     PRODUCT DESCRIPTION & SPECIFICATIONS
                         (18 pages – 183 KB)


A. General Product Description

B. Model Descriptions

    1. Four Chamber Models

    2. Two Chamber Models

C. Product Specification Tables, Ratings and Flow Curves

    1. Table 1: Electric, Power and Heat Output Ratings

    2. Table 2: Maximum Power Circuit Ratings

    3. Table 3: Flow Rate & Temperature Rise Ratings

    4. Table 4: Mechanical

    5. Table 5: 240 VAC Rating - Operating at 208 VAC

    6. Power-Flow Curve A: 240 VAC Rating / 240 VAC Supply

    7. Power-Flow Curve B: 240 VAC Rating / 208 VAC Supply

    8. Power-Flow Curve C: 208 VAC Rating / 208 VAC Supply

D. Internal Workings and Parts Identification

    1. Four Chamber

    2. Two Chamber




                                                                                              1
                                  SEISCO Product Guide – Description & Specifications (Version 11.03)

                   General Product Description
SIZE: Seisco Water Heaters and Space Heaters are manufactured in two basic
sizes, a four-chamber unit (15 ¾” x 15 ¾” x 6 ¼”) and a smaller two-chamber
unit (15 ¾” x 10 ¼” x 6 ¼”). The same advanced microprocessor technology
and Polymer Nylon construction are used in both sizes. Therefore, many of the
parts are interchangeable.

MODELS: RA-18, RA-22, & RA-28 are the four-chamber water heater models
designed for domestic water heating for the whole house and backup to tank-
type heaters, including solar and geothermal water heating systems. RA-09,
RA-11, & RA-14 are the two-chamber models designed for booster and point-
of-use applications. SH-18, SH-22 & SH-28 are four-chamber hydronic space
heater models designed for heating larger homes, 1500 square feet and above.
SH-09, SH-11 & SH-14 are two-chamber models designed for heating smaller
spaces such as, room additions, cabins, shops and garages. The available
models and their descriptions are listed in this section. Refer to the
Applications & Diagrams section for more design and application details.

FEATURES: There are no moving parts or flow restricting devices used in
Seisco heaters. Seisco uses it’s temperature sensors for activation and flow
detection. In standby, the heater maintains a very subtle temperature gradient.
Flow is detected when there is a change in the gradient. The advanced
microprocessor control turns power on through a set of relays and turns the
power off when flow stops. One of Seisco’s most important patented feature is
the “Power Sharing” technology which provides for evenly distributed power to
the heating elements. This, in turn, helps eliminate the potential for scalding,
scaling and sediment build-up. Also, the control logic allows the power level to
vary thus minimizing the use of power for periods of less demanding usage.

CONSTRUCTION: Seisco heating chambers are modular and molded of light
weight thermoplastic materials. The chamber is specifically engineered for
durability in harsh water heating environments and capable of withstanding
extreme temperature swings and pressure changes. Heating elements, sensors
and detection devices, that come in contact with the water, are machined in
brass or made of copper to help resist corrosion. Standard 1 ½inch, flanged
screw-type heating elements are utilized which are interchangeable with
heating elements available at local hardware stores.

SAFETY: Seisco was designed with a complete array of dependable safety
features to prevent harm to the user and the heater. There are several
redundant safety features as well. They include, dual high-temperature
switches on independent circuitry in addition to the control’s internal high-
temperature shut down. Dual low-water level detectors are used to prevent dry
firing of the heating elements. A leak detector is mounted on the casing that



                                                                                                   2
                                  SEISCO Product Guide – Description & Specifications (Version 11.03)

sounds an alarm to the user in case a leak occurs. Although the control board is
protected against electrical surges, additional heater protection is achieved
when the relays are opened during periods of standby, providing no path for
the surge to reach the heating elements. Also, the chamber is designed with a
patented venting system that continuously vents harmful gasses and air during
operation.

MAINTENANCE: The microprocessor control is programmed to provide self
diagnostics that significantly reduce trouble shooting and service time. In the
event of a problem with the heater, the control emits a visual or optional built-
in audible code. In addition, there is no maintenance required of the Seisco.
However, there are clean-out plates below the heater chamber to allow removal
of sand and grit that may build-up from a well-water system.

POWER RATING: The four-chamber models contain four electric heating
elements whose combined wattage is the total power rating of the heater. For
instance, the standard RA-28 (or SH-28) model contains four 7000 watt
elements for a total of 28,000 watts, or 28 kilowatts (kW) of power. The two-
chamber model, RA-14 (or SH-14), contains only two 7000 watt elements for a
total power rating of 14,000 watts, or 14 kilowatts (kW). However, because of
Seisco’s “Power Sharing” technology, the heater may not always use the
maximum available power. The power output can vary with flow rate and
temperature rise. Refer to the Product Specifications Table for the
maximum power ratings of each model.

HEATING OUTPUT: The heating output of the Seisco is simply the total
kilowatt power rating of the combined heating elements converted to BTU’s
using 3,413 BTU/kW. For instance, the RA-28 (& SH-28) has a total power
rating of 28 kW or a 95,564 BTU heat output rating. The four-chamber models
have the higher output ratings; 61,434 BTU’s for the RA-18 (& SH-18) model,
and 75,086 BTU’s for the RA-22 (& SH-22) model. The lower output two-
chamber models, are; 47,782 BTU’s for the RA-14 (& SH-14), 37,543 BTU’s for
the RA-11 (& SH-11), and 30,717 BTU’s for the RA-09 (& SH-09). However,
these heat output ratings vary with the operating voltage and/or service voltage
to the heater. Refer to the Product Specifications Table for the BTU ratings
of each model.

VOLTAGE RATING: Seisco heaters are manufactured with common 240 volt
(AC) heating elements designed for optimum operation on a standard
residential 240 volt (AC) electric service. Also, the Seisco will operate at 208
VAC, a typical commercial voltage, with standard 240 VAC heating elements.
However, when operating the heater at 208 VAC, the power rating and the heat
output rating is significantly reduced. Seisco models can be special ordered with
208 VAC heating elements to help maximize the power and heating output.
Refer to the Product Specifications Table for details on the various voltage
ratings.


                                                                                                   3
                                      SEISCO Product Guide – Description & Specifications (Version 11.03)

MAXIMUM CURRENT RATING: Each Seisco Model has a maximum electrical
current rating (or amp rating) equivalent to the sum of the heating element
ratings. For example, a four-chamber model, RA-28 (& SH-28), operating at
240 VAC has four heating elements, each with a maximum rating of 29 amps.
The maximum current rating or total current rating of the RA-28 (& SH-28) is
therefore 116 amps or the sum of the maximum current rating of the four
heating elements. However, because of Seisco’s “Power Modulating
Technology”, the actual current measured during relatively low flow rates
and/or low temperature rises can be much less than the maximum rating of the
heater during operation. Refer to the A (max) or maximum amp rating under
“Electrical” in the Product Specifications Table for each model.

TEMPERATURE RISE: The temperature rise must be determined in order to
help choose the appropriate Seisco heater. The rise can be determined by
knowing the inlet water temperature and the desired output temperature of the
water from the heater. The Seisco’s output temperature is typically set for
about 120 degrees F at the factory. Therefore, if the input or cold water inlet
temperature is 50 degrees F, then the temperature rise is the difference or 70
degrees F. If the desired output temperature is 125 degrees F, then the
temperature rise would be 75 degrees F. With the temperature rise determined,
the Product Specification Table provides the associated flow rate capacity
of the various Seisco models.

FLOW RATE: The flow rate for each model is given in the “Temperature Rise”
table of the Product Specification Table. Along with the temperature rise,
the flow rate must also be determined in order to choose the appropriate Seisco
heater. The flow rate is determined by the type of faucet and also, life style.
However, if the desired life style in the home requires running multiple faucets
at the same time, then the flow rates must be added together to determine the
peak flow demand. Depending on the plumbing arrangement, it may be
necessary to select more than one Seisco heater to match the peak flow rate.

There may be exceptionally high flow rates from new designer type fixtures and
faucets. For instance, large custom body spa showers, whirl pool and Jacuzzi
tubs may have faucets with flow rates ranging from 6 gpm to 14 gpm.
However, a combination of multiple Seisco heaters (plumbed in a parallel
configuration) can be installed to match these higher flow rates. The same peak
design approach would be necessary for the anticipated life style of multiple
flow rates occurring at the same time. Use the table below to help with
selecting the Seisco model for the peak flow application.

           Typical Flow USE Rates in Gallons per Minute (gpm)
 Fixture   Lavatory    Bathtub     Shower         Kitchen        Pantry        Laundry         Dish-
  Type                                              Sink          Sink           Sink         Washer
  Flow
  Rates    0.8 – 1.5   2.0 – 4.0   1.5 – 3.0     1.0 – 1.5      1.5 – 2.5      2.5 – 3.0     2.0 – 3.0



                                                                                                       4
                                      SEISCO Product Guide – Description & Specifications (Version 11.03)


WATER HEATERS
“RA” FOUR-CHAMBER MODELS
                                                              The images to the left are the
                                                              exterior and interior of the Four-
                                                              Chamber Model, which includes:
                                                              RA-28, RA-22 & RA-18.
                                                              Their dimensions are the same:
                                                              15 ¾ X 15 ¾ X 6 ¼ inches.
                                                              Or 40 X 40 X 16 cm
SEISCO RA-28
The RA-28 is the most popular residential model for providing a continuous supply of hot
water for as long as you need it. Ideal for the whole house and for commercial applications
such as, specialty restaurants, convenience stores, salons, and pet-grooming shops. This
on-demand tankless water heater is a powerful replacement for traditional tank-type
heaters and is the enabling technology for use as back-up to active renewable energy
systems such as solar and geothermal water heating systems. The temperature activated
control works effectively in re -circulating systems and in combination with tank-type
heaters. A minimum of 200 AMP, whole -house electrical service is recommended.



SEISCO RA-22
The RA-22 is a residential model for providing a continuous supply of hot water for as
long as you need it. Ideal for the whole house, apartment or condominium dwelling, where
incoming water temperature rarely drops below 55 degrees F. Excellent for split systems
serving individual entities such as lavatories, shower/bath rooms and kitchens. This on-
demand tankless water heater is a powerful replacement for traditional tank-type heaters
and is the enabling technology for use as back-up to active renewable energy systems such
as solar and geothermal water heating systems. The temperature activated control works
effectively in re -circulating systems and in combination with tank-type heaters. A
minimum of 150 AMP, whole -house electrical service is recommended.

SEISCO RA-18
The RA-18 is the perfect supplement to an existing tank-type water heater that is unable
to satisfy the user requirements. Ideal for the whole house, apartment or condominium
dwelling, where incoming water temperature rarely drops below 65 degrees F. Excellent
for split systems serving individual entities such as lavatories, shower/bath rooms and
kitchens. This on-demand tankless water heater is a powerful replacement for traditional
tank-type heaters and is the enabling technology for use as back-up to active renewable
energy systems such as solar and geothermal water heating systems. The temperature
activated control works effectively in re -circulating systems and in combination with tank-
type heaters. A minimum of 125 AMP, whole -house electrical service is recommended.




                                                                                                       5
                                    SEISCO Product Guide – Description & Specifications (Version 11.03)


WATER HEATERS
“RA” TWO CHAMBER MODELS
                                                  The images to the left are the
                                                  exterior and interior of the Two-
                                                  Chamber Model, which includes:
                                                  RA-14, RA-11 & RA-9.
                                                  Their dimensions are the same:
                                                  15 ¾ X 10 ¼ X 6 ¼ inches.
                                                  Or 40 X 26 X 16 cm


SEISCO RA-14
The RA-14 is excellent for point-of-use applications at single showers and sinks.
Ideal for supplementing existing tank-type heaters that are unable to satisfy user
requirements in beach houses, hair salons, horse stables, hunting and fishing
cabins. Great for small apartment or condominium dwelling, where incoming
water temperature rarely drops below 75 degrees F. This on-demand tankless
water heater is the enabling technology for use as back-up to active renewable
energy systems such as solar and geothermal water heating systems. The
temperature activated control works effectively in re -circulating systems and in
combination with tank-type heaters.


SEISCO RA-11
The RA-11 is excellent for point-of-use applications at coffee bars, office &
industrial warehouse wash sinks, single lavatory and emergency showers; to
comply with code. Perfect for RV’s and small motor homes and supplements
existing tank-type heaters. This on-demand tankless water heater is the enabling
technology for use as back-up to active renewable energy systems such as solar and
geothermal water heating systems. The temperature activated control works
effectively in re -circulating systems and in combination with tank-type heaters.
Requires only one 50 Amp, 240 VAC electric circuit.


SEISCO RA-9
The RA-09 is excellent for point-of-use applications at coffee bars, office &
industrial warehouse wash sinks, single lavatory and emergency showers; to
comply with code. Perfect for RV’s and small motor homes and supplements
existing tank-type heaters. This on-demand tankless water heater is the enabling
technology for use as back-up to active renewable energy systems such as solar and
geothermal water heating systems. The temperature activated control works
effectively in re -circulating systems and in combination with tank-type heaters.
Requires only one 40 Amp, 240 VAC electric circuit.



                                                                                                     6
                                      SEISCO Product Guide – Description & Specifications (Version 11.03)


SPACE HEATERS
“SH” FOUR-CHAMBER MODELS
                                                              The images to the left are the
                                                              exterior and interior of the Four-
                                                              Chamber Model, which includes:
                                                              SH-28, SH-22 & SH-18.
                                                              Their dimensions are the same:
                                                              15 ¾ X 15 ¾ X 6 ¼ inches.
                                                              Or 40 X 40 X 16 cm

SEISCO SH-28
The Model SH-28 four-chamber tankless electric space heater is designed for use
in residential and commercial hydronic space heating applications such as, but not limited
to, radiant floor heating, baseboard, hydro-heat pump and snow melting systems. This
new micro-boiler is the ideal replacement for traditional boilers and tank-type heaters and
is the enabling technology for use with active renewable energy systems such as solar and
geothermal systems. The temperature activated control works effectively in low pressure
and re-circulating systems. With optional equipment, the SH-22 can be used as the single
heat source in combination systems for potable hot water and space heating. A minimum
of 200 AMP whole house electrical service is recommended.

SEISCO SH-22
The Model SH-22 four-chamber tankless electric space heater is designed for use
in residential and commercial hydronic space heating applications such as, but not limited
to, radiant floor heating, baseboard, hydro-heat pump and snow melting systems. This
new micro-boiler is the ideal replacement for traditional boilers and tank-type heaters and
is the enabling technology for use with active renewable energy systems such as solar and
geothermal systems. The temperature activated control works effectively in low pressure
and re-circulating systems. With optional equipment, the SH-22 can be used as the single
heat source in combination systems for potable hot water and space heating. A minimum
of 150 AMP whole house electrical service is recommended.

SEISCO SH-18
The Model SH-18 four-chamber tankless electric space heater is designed for use
in residential and commercial hydronic space heating applications such as, but not limited
to, radiant floor heating, baseboard, hydro-heat pump and snow melting systems. This
new micro-boiler is the ideal replacement for traditional boilers and tank-type heaters and
is the enabling technology for use with active renewable energy systems such as solar and
geothermal systems. The temperature activated control works effectively in low pressure
and re-circulating systems. With optional equipment, the SH-18 can be used as the single
heat source in combination systems for potable hot water and space heating. A minimum
of 125 AMP whole house electrical service is recommended.




                                                                                                       7
                                    SEISCO Product Guide – Description & Specifications (Version 11.03)


SPACE HEATERS
“SH” TWO CHAMBER MODELS
                                                  The images to the left are the
                                                  exterior and interior of the Two-
                                                  Chamber Model, which includes:
                                                  RA-14, RA-11 & RA-9.
                                                  Their dimensions are the same:
                                                  15 ¾ X 10 ¼ X 6 ¼ inches
                                                  Or 40 X 26 X 16 cm


SEISCO RA-14
The Model SH-14 two-chamber tankless electric space heater is designed for use
in residential and commercial hydronic space heating applications such as, but not
limited to, radiant floor heating, baseboard, hydro-heat pump and snow melting
systems. This new micro-boiler is the ideal replacement for traditional boilers and
tank-type heaters and is the enabling technology for use with active renewable
energy systems such as solar and geothermal systems. The temperature activated
control works effectively in low pressure and re-circulating systems. Perfect for
cabins, room additions, small condos, shops, garages, etc.


SEISCO SH-11
The Model SH-11 two-chamber tankless electric space heater is designed for use
in residential and commercial hydronic space he ating applications such as, but not
limited to, radiant floor heating, baseboard, hydro-heat pump and snow melting
systems. This new micro-boiler is the ideal replacement for traditional boilers and
tank-type heaters and is the enabling technology for use with active renewable
energy systems such as solar and geothermal systems. The temperature activated
control works effectively in low pressure and re -circulating systems. Perfect for
cabins, room additions, small condos, shops, garages, etc.


SEISCO SH-09
The Model SH-09 two-chamber tankless electric space heater is designed for use
in residential and commercial hydronic space heating applications such as, but not
limited to, radiant floor heating, baseboard, hydro-heat pump and snow melting
systems. This new micro-boiler is the ideal replacement for traditional boilers and
tank-type heaters and is the enabling technology for use with active renewable
energy systems such as solar and geothermal systems. The temperature activated
control works effectively in low pressure and re-circulating systems. Perfect for
driveway snow melting, room additions, small shops, garages, etc.




                                                                                                     8
                                                   SEISCO Product Guide – Description & Specifications (Version 11.03)




                              Product Specification Table 1
       Model Numbers                                 Electrical, Power & Heat Ratings

Residential    Space Heating        Commercial          Volts       Current       Power                    BTU/Hr         KG-
   (RA)            (SH)               (CA)              VAC         AMPS           KW           HZ         Output         Cal./
                                                                     Max.                                   Max.           Hr
  RA-28             SH-28               CA-28            240         116*            28        50/60       95,560        24,094

  RA-24             SH-24               CA-24            208          115*           24        50/60        81,910       20,652

  RA-22             SH-22               CA-22            240          91*            22        50/60        75,080       18,931

  RA-20             SH-20               CA-20            208          96*            20        50/60        68,260       17,210

  RA-18             SH-18               CA-18            240          75*            18        50/60        61,430       15,489

 RA-18-3           SH-18-3            CA-18-3            380           28            18        50/60        61,430       15,489

  RA-16             SH-16               CA-16            208          77*            16        50/60        54,600       13,768

 RA-14-4           SH-14-4            CA-14-4            240          58*            14        50/60        47,780       12,047

  RA-14             SH-14               CA-14            240          58*            14        50/60        47,780       12,047

  RA-12             SH-12               CA-12            208          58*            12        50/60        40,950       10,326

  RA-11             SH-11               CA-11            240           46            11        50/60        37,540       9,465

RA-10.5-3         SH-10.5-3          CA-10.5-3           380           16           10.5       50/60        35,830       9,035

  RA-10             SH-10               CA-10            208           48            10        50/60        34,130       8,605

  RA-09             SH-09               CA-09            240           38             9        50/60        30,710       7,744

  RA-08             SH-08               CA-08            208           39             8        50/60        27,300       6,884

  RA-07             SH-07               CA-07            240           29             7        50/60        23,890       6,023

  RA-05             SH-05               CA-05            240           21             5        50/60        17,060       4,302

     * Requires more than one power supply circuit (see next table for detailed on circuit ratings).




                                                                                                                    9
                              SEISCO Product Guide – Description & Specifications (Version 11.03)



                    Product Specification Table 2

              Maximum Power Circuit Ratings
 Model Numbers      Volts     AMPS              WATTS              No. of Heating Elements –
                    VAC     Per Circuit        Per Circuit          Watts x No. per Circuit
 RA /SH /CA-28       240       29.0               7000                     7000 x 1
                     240       29.0               7000                     7000 x 1
                     240       29.0               7000                     7000 x 1
                     240       29.0               7000                     7000 x 1
 RA /SH /CA-24       208       29.0               6000                     6000 x 1
                     208       29.0               6000                     6000 x 1
                     208       29.0               6000                     6000 x 1
                     208       29.0               6000                     6000 x 1
 RA /SH /CA-22       240       45.5              11000                     5500 x 2
                     240       45.5              11000                     5500 x 2
 RA /SH /CA-20       208       48.0              10000                     5000 x 2
                     208       48.0              10000                     5000 x 2
RA /SH /CA-18-3      380       28.0              18000                     6000 x 3

 RA /SH /CA-18       240       37.5                9000                       4500     x   2
                     240       37.5                9000                       4500     x   2
 RA /SH /CA-16       208       38.5                8000                       4000     x   2
                     208       38.5                8000                       4000     x   2
RA /SH /CA-14-4      240       29.0                7000                       3500     x   2
                     240       29.0                7000                       3500     x   2
 RA /SH /CA-14       240       29.0                7000                       7000     x   1
                     240       29.0                7000                       7000     x   1
 RA /SH /CA-12       208       29.0                6000                       6000     x   1
                     208       29.0                6000                       6000     x   1
 RA / SH /CA-11      240       46.0               11000                       5500     x   2

RA /SH /CA-10.5-3    380       16.0               10500                       3500 x 3

 RA /SH /CA-10       208       48.0               10000                       5000 x 2

 RA /SH /CA-09       240       38.0                9000                       4500 x 2

 RA /SH /CA-08       208       39.0                8000                       4000 x 2

 RA /SH /CA-07       240       29.0                7000                       3500 x 2

 RA /SH /CA-05       240       21.0                5000                       2500 x 2




                                                                                               10
                              SEISCO Product Guide – Description & Specifications (Version 11.03)



                     Product Specification Table 3

Flow Rate & Temperature Rise Ratings
   Model Numbers              Rise (Deg F)                          Rise (Deg C)
                              @ Flow (GPM)                         @ Flow (L/Min.)
   RA /SH /CA-28              95 °F @ 2.0 GPM                       50 °C @ 8 L/min
                              76 °F @ 2.5 GPM                       40 °C @ 10 L/min
                              64 °F @ 3.0 GPM                       33 °C @ 12 L/min
                              48 °F @ 4.0 GPM                       25 °C @ 16 L/min

   RA /SH /CA-24              81 °F @ 2.0 GPM                       42 °C @ 8 L/min
                              65 °F @ 2.5 GPM                       34 °C @ 10 L/min
                              54 °F @ 3.0 GPM                       27 °C @ 12 L/min
                              30 °F @ 4.0 GPM                       21 °C @ 16 L/min

   RA /SH /CA-22              75 °F @ 2.0 GPM                       39 °C @ 8 L/min
                              60 °F @ 2.5 GPM                       31 °C @ 10 L/min
                              50 °F @ 3.0 GPM                       26 °C @ 12 L/min
                              37 °F @ 4.0 GPM                       20 °C @ 16 L/min

   RA /SH /CA-20              64 °F @ 2.0 GPM                       33 °C @ 8 L/min
                              51 °F @ 2.5 GPM                       26 °C @ 10 L/min
                              42 °F @ 3.0 GPM                       22 °C @ 12 L/min
                              31 °F @ 4.0 GPM                       17 °C @ 16 L/min

   RA /SH /CA-18              61 °F @ 2.0 GPM                       32 °C @ 8 L/min
                              49 °F @ 2.5 GPM                       26 °C @ 10 L/min
                              40 °F @ 3.0 GPM                       21 °C @ 12 L/min
                              30 °F @ 4.0 GPM                       16 °C @ 16 L/min

   RA /SH /CA-18-3            61 °F @ 2.0 GPM                       32 °C @ 8 L/min
                              49 °F @ 2.5 GPM                       26 °C @ 10 L/min
                              40 °F @ 3.0 GPM                       21 °C @ 12 L/min
                              30 °F @ 4.0 GPM                       16 °C @ 16 L/min

   RA /SH /CA-16              52 °F @ 2.0 GPM                       27 °C @ 8 L/min
                              42 °F @ 2.5 GPM                       22 °C @ 10 L/min
                              34 °F @ 3.0 GPM                       18 °C @ 12 L/min
                              25 °F @ 4.0 GPM                       13 °C @ 16 L/min

   RA /SH /CA-14-4            95 °F @ 1.0 GPM                        50 °C @ 4 L/min
                              64 °F @ 1.5 GPM                        33 °C @ 6 L/min
                              48 °F @ 2.0 GPM                        25 °C @ 8 L/min
                              38 °F @ 2.5 GPM                        20 °C @ 10 L/min

   RA /SH /CA-14              95 °F @ 1.0 GPM                        50 °C @ 4 L/min
                              64 °F @ 1.5 GPM                        33 °C @ 6 L/min
                              48 °F @ 2.0 GPM                        25 °C @ 8 L/min
                              38 °F @ 2.5 GPM                        20 °C @ 10 L/min

   RA /SH /CA-12              81 °F @ 1.0 GPM                        42 °C @ 4 L/min
                              54 °F @ 1.5 GPM                        28 °C @ 6 L/min
                              41 °F @ 2.0 GPM                        21 °C @ 8 L/min
                              32 °F @ 2.5 GPM                        17 °C @ 10 L/min



                                                                                             11
                                        SEISCO Product Guide – Description & Specifications (Version 11.03)



              Product Specification Table 3…Continued

Flow Rate & Temperature Rise Ratings
     Model Numbers                     Rise (Deg F)                           Rise (Deg C)
                                       @ Flow (GPM)                          @ Flow (L/Min.)
     RA /SH /CA-11                      75 °F @ 1.0 GPM                        39 °C @ 4 L/min
                                        50 °F @ 1.5 GPM                        26 °C @ 6 L/min
                                        37 °F @ 2.0 GPM                        20 °C @ 8 L/min
                                        30 °F @ 2.5 GPM                        16 °C @ 10 L/min

   RA /SH /CA-10.5-3                    70 °F @ 1.0 GPM                        36 °C @ 4 L/min
                                        46 °F @ 1.5 GPM                        24 °C @ 6 L/min
                                        34 °F @ 2.0 GPM                        19 °C @ 8 L/min
                                        28 °F @ 2.5 GPM                        15 °C @ 10 L/min

     RA /SH /CA-10                      64 °F @ 1.0 GPM                        33 °C @ 4 L/min
                                        42 °F @ 1.5 GPM                        22 °C @ 6 L/min
                                        31 °F @ 2.0 GPM                        17 °C @ 8 L/min
                                        25 °F @ 2.5 GPM                        13 °C @ 10 L/min

     RA /SH /CA-09                      61 °F @ 1.0 GPM                        32 °C @ 4 L/min
                                        40 °F @ 1.5 GPM                        21 °C @ 6 L/min
                                        30 °F @ 2.0 GPM                        16 °C @ 8 L/min
                                        24 °F @ 2.5 GPM                        13 °C @ 10 L/min

     RA /SH /CA-08                      52 °F @ 1.0 GPM                        27 °C @ 4 L/min
                                        34 °F @ 1.5 GPM                        18 °C @ 6 L/min
                                        25 °F @ 2.0 GPM                        13 °C @ 8 L/min
                                        20 °F @ 2.5 GPM                        11 °C @ 10 L/min

     RA /SH /CA-07                     64 °F @ 0.75 GPM                        34 °C @ 3   L/min
                                       48 °F @ 1.0 GPM                         25 °C @ 4   L/min
                                       32 °F @ 1.5 GPM                         17 °C @ 6   L/min
                                       24 °F @ 2.0 GPM                         12 °C @ 8   L/min

     RA /SH /CA-05                     46 °F @ 0.75 GPM                        24 °C @ 3   L/min
                                       34 °F @ 1.0 GPM                         18 °C @ 4   L/min
                                       23 °F @ 1.5 GPM                         12 °C @ 6   L/min
                                       17 °F @ 2.0 GPM                         9 °C @ 8    L/min



                      Product Specification Table 4

                                       Mechanical
     Models             Size (HxWxD)                Plumbing Fittings             Shipping Weight
     Four-Chamber      15 ¾ x 15 ¾ x 6 ¼ in.        ¾ - in. NPT nipple x 2           23 lbs. / 10.5 kg
 (16 KW thru 28 KW)       40 x 40 x 16 cm
     Two-Chamber       15 ¾ x 10 ¼ x 6 ¼ in.        ¾ - in. NPT nipple x 2            15 lbs. / 7 kg
  (5 KW thru 14 KW)       40 x 26 x 16 cm




                                                                                                         12
                                                  SEISCO Product Guide – Description & Specifications (Version 11.03)

                                  Product Specification Table 5

      Commercial 208 Volt (AC) Operation, 240 VAC Rating
      Commercial and industrial locations are often served by 208 V three-phase electrical services. Where
      240-V rated SEISCO heaters are used at 208 V, their available wattage, and therefore their temperature
      rise, are de-rated by 25%. The table below shows which ratings are affected. Other specifications are the
      same as for 240 V operation.


SEISCO® Electric Fluid Heating System
[ FOUR CHAMBER MODELS ]
 MODEL                RA-28                                 RA-22                                 RA-18
    kW                  21                                   16.5                                  13.5
 Elements        7000 watts × 4                          5500 watts × 4                        4500 watts × 4
  Btu/hr              71,670                                56,310                                46,070
 kg-cal/hr            18,070                                14,198                                11,616
TEMPERATURE RISE
               71 °F @ 2.0 GPM                         56 °F @ 2.0 GPM                       45 °F @ 2.0 GPM
               57 °F @ 2.5 GPM                         45 °F @ 2.5 GPM                       36 °F @ 2.5 GPM
               48 °F @ 3.0 GPM                         37 °F @ 3.0 GPM                       30 °F @ 3.0 GPM
               36 °F @ 4.0 GPM                         28 °F @ 4.0 GPM                       22 °F @ 4.0 GPM
               37 °C @ 8 L/min                         30 °C @ 8 L/min                       24 °C @ 8 L/min
               30 °C @ 10 L/min                        24 °C @ 10 L/min                      19 °C @ 10 L/min
               25 °C @ 12 L/min                        20 °C @ 12 L/min                      15 °C @ 12 L/min
               19 °C @ 16 L/min                        15 °C @ 16 L/min                      12 °C @ 16 L/min
ELECTRICAL
    V                 208                                    208                                    208
 A (max)              101                                     79                                     65
   Hz                50 / 60                                50 / 60                                50 / 60
 Circuits           60A × 2                                50A × 2                                40A × 2

[ TWO CHAMBER MODELS ]
 MODEL                RA-14                                 RA-11                                 RA-09
    kW                 10.5                                  8.25                                  6.75
 Elements        7000 watts × 2                          5500 watts × 2                        4500 watts × 2
  Btu/hr              35,830                                28,150                                23,030
 kg-cal/hr            9,035                                  7,099                                 5,808
TEMPERATURE RISE
               71 °F @ 1.0 GPM                        56 °F @ 1.0 GPM                        45 °F @ 1.0 GPM
               48 °F @ 1.5 GPM                        37 °F @ 1.5 GPM                        30 °F @ 1.5 GPM
               36 °F @ 2.0 GPM                        27 °F @ 2.0 GPM                        22 °F @ 2.0 GPM
               28 °F @ 2.5 GPM                        22 °F @ 2.5 GPM                        18 °F @ 2.5 GPM
               37 °C @ 4 L/min                        29 °C @ 4 L/min                        24 °C @ 4 L/min
               25 °C @ 6 L/min                        19 °C @ 6 L/min                        15 °C @ 6 L/min
               19 °C @ 8 L/min                        15 °C @ 8 L/min                        12 °C @ 8 L/min
               15 °C @ 10 L/min                       12 °C @ 10 L/min                        9 °C @ 10 L/min
ELECTRICAL
    V                 208                                    208                                    208
 A (max)              50.5                                   39.5                                   32.5
   Hz                50 / 60                                50 / 60                                50 / 60
 Circuits           60A × 1                                50A × 1                                40A × 1



                                                                                                                 13
                                                SEISCO Product Guide – Description & Specifications (Version 11.03)




                            SEISCO 240 VAC RATED, 240 VAC SERVICE
                        KW vs GPM Curves For Various Inlet Temperatures To
                                      Deliver 120 Degree F

                  4.5

                   4

                  3.5
Flow Rate (GPM)




                   3

                  2.5

                   2

                  1.5

                   1

                  0.5

                   0
                           9         11                14                  18                    22                   28

                                                        Power (KW)

                                          44 F INLET         56 F INLET              72 F INLET


                                    POWER & FLOW CURVE (A)




                                                                                                               14
                                             SEISCO Product Guide – Description & Specifications (Version 11.03)




                            SEISCO 240 VAC RATED, 208 VAC SERVICE
                        KW vs GPM For Various Inlet Temperatures To Deliver
                                          120 Degree F

                  3.5


                   3


                  2.5
Flow Rate (GPM)




                   2


                  1.5


                   1


                  0.5


                   0
                           6.75     8.25          10.5                 13.5                  16.5                  21
                                                     Power (KW)

                                       44 F INLET         56 F INLET               72 F INLET

                                    POWER & FLOW CURVE (B)




                                                                                                            15
                                               SEISCO Product Guide – Description & Specifications (Version 11.03)




                            SEISCO 208 VAC RATED, 208 VAC SERVICE
                        KW vs GPM For Various Inlet Temperatures To Deliver
                                          120 Degree F

                   4


                  3.5


                   3
Flow Rate (GPM)




                  2.5


                   2


                  1.5


                   1


                  0.5


                   0
                            5        7                10                 14                    18                    24
                                                       Power (KW)

                                         44 F INLET        56 F INLET               72 F INLET


                                    POWER & FLOW CURVE (C)




                                                                                                              16
                                          SEISCO Product Guide – Description & Specifications (Version 11.03)



  SEISCO® - Four Chamber Models (18, 22 & 28 KW)
  Internal Workings and Parts Identification

       Outlet                                                                              Inlet
                     Level Detect                       Heating Elements
   8                                                                                                 5
                      4              3                       2                 1
                              7                                      6


                      TH-3        Limit                      TH-1        Limit
                                  Sw                                     Sw



                                             9               Control               L1
                                                   //                                                    18
                                                             Board
                 (Disable)                        10             11                L2
                   Utility                                                         L1
                  Demand                    12
                  Control                   13                                                           19
                Connection
                                            14                                     L2
                                                        15                         L1
                                                                                                         20
                                             16                                    L2
                                                                                   L1

                                            17                                     L2
                   TH-4
                                                                                           TH-
                                                                         TH-2              IN



Outlet Assembly           Heating Chambers                       Clean-Out Plates

                  LEGEND                                           LEGEND
   1 – Heating Element #1                     15 – Microprocessor Control Chip
   2 – Heating Element #2                     16 - Blue Button; Manual Audible Activation
   3 – Heating Element #3                     17 – Terminal Spades for Leak Detect Wires
   4 – Heating Element #4                     18 – Triacs (4 each)
   5 – Inlet Water Tube, ¾”                   19 – Triac Mounting Blocks to Heat Sink (4 ea.)
   6 – Water-Level Detect Screw               20 – Copper Heat Sink Tube
   7 – Water-Level Detect Screw               L1 – Power Connection Lugs (208 – 240 VAC)
   8 – Outlet Water Tube, ¾ ”                 L2 – Power Connection Lugs (208 – 240 VAC)
   9 – Disable, Demand Control Switch         Limit Sw : Over Temperature Limit Switches (2)
   10 – Transformer                           TH-IN : Inlet Temperature Sensor
   11 – Heating Element Relays (8 ea.)        TH-1 : Chamber Temperature Sensor #1
   12 – LED Light Indicator                   TH-2 : Chamber Temperature Sensor #2
   13 – Audible Speaker                       TH-3 : Chamber Temperature Sensor #3
   14 – Output Temperature Control            TH-4 : Chamber Temperature Sensor #4


                                                                                                          17
                                          SEISCO Product Guide – Description & Specifications (Version 11.03)



 SEISCO® - Two Chamber Models (7, 9, 11 & 14 KW)
 Internal Workings and Parts Identification

                                     Outlet                                                Inlet
                                                      Heating Elements
                                 5                                                                   3
                                                              2                1
                                                                     4


                                                     TH-1                Limit
                                                                         Sw
          Outlet Assembly

                                                                  Control           L1
                                                         / / Board                                       15
              (Disable)
                Utility                                  6                    7
               Demand                                                              L2
               Control                                   8                         L1                    16
             Connection

                                                      9                            L2
      Heating Chambers                                10                                                 17

                                                         11                    12

                                                               13            14
                                                                                           TH-
                                                                                           IN



                                                                  Clean-Out Plate

                   LEGEND                                                   LEGEND

1 – Heating Element #1                              14   –   Terminal Spades for Leak Detect Wires
2 – Heating Element #2                              15   –   Triacs (2)
3 – Inlet Water Tube, ¾”                            16   –   Triac Mounting Blocks to Heat Sink (2)
4 – Water-Level Detect Screw                        17   –   Copper Heat Sink Tube
5 – Outlet Water Tube, ¾ ”
6 – Disable, Demand Control Switch                  L1 – Power Connection Lugs (208 – 240 VAC)
7 – Heating Element Relays (4)                      L2 – Power Connection Lugs (208 – 240 VAC)
8 – Transformer
9 – LED Light Indicator                             Limit Sw : Over Temperature Limit Switch
10 – Audible Speaker                                TH-IN : Inlet Temperature Sensor
11 – Output Temperature Control                     TH-1 : Chamber Temperature Sensor #1
12 – Microprocessor Control Chip                    TH-2 : Chamber Temperature Sensor #2
13 – Blue Button; Manual Audible Activation


                                                                                                          18
                                     SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




                          SEISCO®
             4    APPLICATIONS & DIAGRAMS
                               (21 pages – 325 KB)


A. Seisco Selection Criteria

B. Residential Floor Plan Diagrams

  1. Standard One-Story Home Options

  2. Standard Two-Story Home Options

  3. One-Story: Booster for Quicker Response

C. Application Diagrams

  1. Water Heating - General Residential Whole House

  2. Water Heating - Booster Retro-fit for Existing Storage Tank

  3. Water Heating - High Flow or Large Demand Configuration

  4. Water Heating - Circulating System Arrangement

  5. Space Heating – Radiant Floor or Hydronic Heating System

  6. Dual System – Radiant Floor & Domestic Hot Water System

  7. Space Heating – Indoor Hydro Heating or Heat Pump System

  8. Water Heating – Back-up to Solar Heated Storage Tank

  9. Water Heating – Back-up to Geothermal with De-super Heater




                                                                                                        1
                                                      SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




A. SEISCO MODEL SELECTION CRITERIA

“RA” Models - Below is a list of the basic information that is needed for selecting the
proper Seisco model for Water Heating applications:

           1. Peak flow rate in gallons per minute (GPM).
           2. Inlet water temperature or cold water temperature.
           3. Electrical capacity (amps) and the service voltage (VAC).
           4. Desired output temperature or hot water temperature.


“SH” Models - Additional information may be necessary for Space Heating applications,
such as the following:

           1. Heat loss rate (BTU/hr) of the home or building.
           2. Flow rate of the circulating pump in gallons per minute (GPM).


Peak Flow Rate:

Below are typical flow rates for new residential construction. There may be exceptions,
such as with new designer type fixtures and faucets. For instance, large custom body spa
showers, whirl pool and Jacuzzi tubs may have faucets with flow rates ranging from 7 gpm
to 14 gpm. However, a combination of multiple Seisco heaters (plumbed in a parallel
configuration) can be installed to match these higher flow rates. In larger homes with
multiple baths or with large families, the likely-hood of simultaneous multiple faucet usage
should be considered. The combined peak flow for multiple faucet usage may also require
multiple Seisco heaters. Otherwise, use the table below and match the Seisco according to
the peak flow and associated temperature rise of a single tub or shower. Also, refer to the
Product Specification Tables in the “Description & Specifications” section of the Seisco
Product Manual for the flow ratings of each Seisco Model.

                         Typical Flow-Use Rates in Gallons per Minute (gpm)
 Fixture
  Type        Lavatory   Bathtub     Shower      Kitchen      Pantry       Laundry        Dish-        Washer
                                                  Sink         Sink          Sink        Washer
 Flow
 Rates       0.8 – 1.5   2.0 – 4.0   1.5 – 3.0   1.0 – 1.5   1.5 – 2.5    2.5 – 3.0     1.5 – 2.0     2.0 – 3.0



   Measuring flow rates at a faucet can be done by simply using a common one-gallon
bucket or a similar container of known liquid capacity. The approximate flow rate can be
determined by simply turning on the faucet in question to full flow, and timing how long it
takes to fill the one gallon bucket. If it takes 20 seconds to fill the one gallon bucket, then
the flow rate is 3 gallons per minute or 3 gpm. If it takes 15 seconds to fill the bucket,

                                                                                                                         2
                                            SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




then the flow rate is 4 gpm. Simply divide 60 seconds (which is one minute) by the
recorded time to fill the bucket to arrive at the flow rate.

Inlet Temperatures:

     Measuring the inlet temperature can be determined with a common cooking or
baking thermometer. Simply turn on the cold water (not the hot) and place the
thermometer into the flow. For best results, let the water run for approximately one to two
minutes before taking the reading. This allows purging of any ambient temperature water
sitting in the lines. It is important to know the inlet water temperature so that the
temperature rise can be determined. The temperature rise and associated flow rating of
the faucets are necessary for the proper model selection.

    Inlet water temperatures can vary depending on geographical location, season of the
year and the type of water system. For instance, Southern Georgia and Florida have inlet
water temperatures typically between 60 and 70°F. Mountainous areas, such as the
Rockies may have water temperatures as low as 40°F. In the middle and northern sections
of the U.S., depending upon the season, water temperatures generally range from 45 to
70°F. Water temperatures from most well-water systems (except in mountainous areas)
generally remain constant at 50 to 55°F year round.

Electrical Capacity:

Most all-electric homes today have 200 amp electric services. This has become the
standard over the past 10 years or so in new home construction. However, homes that
utilize gas for space heating, water heating and cooking may have 100 or 150 amp electric
service. It is important to determine whether the electrical capacity of the home or
building is sufficient for the selected Seisco heater. In most cases, an all-electric home of
3000 square feet or less with a 200 amp whole-house electric service will have the
electrical capacity for one Seisco RA-28. The RA-28 is sufficient to provide all the normal
hot water requirements for a home of this size containing 2 ½ or 3 baths with standard
flow rate faucets. It will be necessary however, to have a qualified electrician calculate the
electrical loads in the home or building with the load of the selected Seisco model(s). The
load calculations should be done according to the National Electric Code (NEC), 220-30
and 220-31, Optional Calculation. Refer to the “Electrical Service Requirements & Sample
Calculations” section of this Seisco Product Guide for how the NEC rules apply to the
Seisco.

B. RESIDENTIAL FLOOR PLANS

    Location of the Seisco heater in the home or building requires some planning so
that the heater is in a position to respond quickly and to handle peak flow demands.
Because of Seisco’s compact size, it is possible to locate the heater in closets and under
staircases so that it is central the areas of major hot water usage. A suitable drain is
required in such locations. If necessary, a multiple heater system can even fit where

                                                                                                               3
                                              SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




most storage tank heaters cannot. These benefits are important to the user, as they help
conserve water, reduce the wait for hot water and reduce energy costs.

   Typical one story and two story floor plans are provided to help illustrate the
possibilities for locating Seisco heaters in the home to achieve maximum benefits. The
optional multiple heater configuration, as well as the single heater configuration, are
shown. For instance, a single Seisco RA-28 can effectively provide hot water for the whole
house. However, if peak flow demands of the master bath exceed the flow rate capacity of
the RA-28, i.e. multiple shower heads, then a booster unit, an RA-18 or RA-22, can be
located downstream and closer to the master bath. This arrangement helps reduce the
wait for hot water in the master bath as well.

    In homes with a basement: There may be additional flexibility to locate the Seisco
heater in the basement so that it is still central and directly below the faucets on the first
and second floors. Instead of locating the booster in the master bath closet, it could be
located in the basement, directly below the master bath floor. Also, there may be a need
for hot water to serve faucets in the basement, such as the washing machine and future
baths that may be installed when the basement is finished for living space.

    In homes with an attached garage: The garage may be one of the most
convenient locations for the Seisco heater, but not necessarily the most central location to
the faucets in the home. Typically, if the garage is on one end of the house, then the
master bath is usually on the opposite end and probably a long distance from the water
heater. This may result in relatively long delays (2 minutes or more) for the hot water to
reach the master bath faucets. This arrangement is generally not acceptable by most
homeowners unless a Seisco booster heater is installed within the vicinity of the master
bath in combination with the heater in the garage. It may be necessary to avoid installing
the Seisco heater in the garage altogether due to possible exposure to high humidity and
freezing conditions. If possible, locate the Seisco heater in the adjacent utility room or
entrance room in conditioned air space.

    If it is necessary to install the Seisco heater on the second floor or in the attic, or any
other area that is not in the open and can be not be routinely observed must have a
suitable drain with drip pan installed below the heater to avoid damage to ceilings, walls
and floors in the event of a leak. (Refer to the Plumbing Installation Guide for
information and exceptions).




                                                                                                                 4
                                                                     SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




 Single Story Floor Plan
 (2 baths)                                                                                           Master Bath



 Suggested Locations For
 SEISCO®
                                                                                                 MASTER SUITE
 Water Heaters
                                                                                                 Seisco RA28 in
                                                                                                 Laundry Room

            BRM 2
                                            FAMILY ROOM                                                  S
                                                                               KITCHEN
                                                                                         LAUNDRY
                                                                                                         W
                  Hall
                  Bath                                                                                    D
                                                                     D
                                                                     W

                      S

   (Optional) Booster
                                                                                                       GARAGE
                                         LIVING                       DINNING
           BRM 3                                                       ROOM
                                         ROOM




                                                            Master
                                                            Shower
                                                                         PLUMBING DETAIL
        Master
       Bath Tub
                                                                                                         HOT                    COLD

                                                                                                                     RA28
                                                                                                                                Shut-Off
                                                                                                                                Valve
                                                                               Master
                                                                                Bath
                                                                                Sink




Hall
Bath
Tub                                  RA18

                                                                                                              RA22          RA22
                   Hall Sink


                               (Optional) Booster
                                - Quick Response    Dish Washer      Kitchen            Washer          (Optional) High Flow Application
                                                                                                             Two Seisco’s in Parallel




                                                                                                                                           5
                                                               SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)


                                       BRM 3                         BRM 4                              Master
 Two Story                                                                                              Bath
                                                                                                                    S
 Floor Plan
                                                                                                                  (Optional)
 (2 ½ baths)                                Hall Bath                                                              Booster

                                                                             Closet
                                                                                                        MASTER
 Suggested                                                                                              SUITE
 Locations For                             BRM 1

 SEISCO®
 Water Heaters                                                 UPPER FLOOR

                                                                   DW



              GREAT ROOM                   DINETTE                          KITCHEN                          DINNING
                                                                                                           ROOM



                                       UTILITY ROOM                                             S   Seisco RA28 Under
                                                              Powder                                   Stair Landing
                                                W        D     Bath


              GARAGE                                                                                       LIVING
                                              STUDY                                                         ROOM



                                          MAIN FLOOR


                                                      PLUMBING DETAIL
        Master
       Bath Tub
                                                                                                       HOT                     COLD

                                                                               RA18                                RA28
                                                                                                                               Shut-Off
                                                                                                                               Valve
                                               Master Bath
                                                Shower &
                                                  Sink
                                                                           (Optional) Booster
                                                                            - Quick Response



Hall
Bath                            Hall
                                Bath
Tub
                                Sink
                                                                                                           RA22           RA22




                                                                                                       (Optional) High Flow Application
                  Hall Shower             Kitchen            Powder Room          Washer
                      Stall                                                                                 Two Seisco’s in Parallel


                                                                                                                                          6
                                          SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




  Florida Style Home – Single Story Floor Plan*
  (SEISCO Full House Model With Booster in the Master Bath for Quicker
  Response)



  SEISCO®
  RA-18 and RA-28
  Full House Configuration




                                                                                   BRM 3
                                  Kitchen
 Exercise




                             Great Room
           SEISCO
            RA-18

                 S

                                                                                   BRM 2
                                            Dinning
                         Den



 Master                                                                        S
  Bath


                                                                    SEISCO
                                                                     RA-28

                                                                        Garage

* Not to Scale
                     75 FT


                                                                                                             7
                                             SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




C. APPLICATION DIAGRAMS

   Diagrams are provided in this section to show how the Seisco works in several different
applications, ranging from a single whole-house heater to space-heating applications. The
Seisco models chosen for these illustrations are examples for use in these types of
applications. They are not, however, necessarily the correct model for an actual
application. The Seisco system should be designed for each application according to the
recommended criteria found at the beginning of this section and using the ratings in the
Product Specification Tables.

Water Heating - Whole House Application

The most common application for a home is using a single Seisco RA-28. The RA-28 was
specifically designed with the power necessary to provide hot water for a moderately sized
home with standard faucets. Most homes qualify for this application. Exceptions are when
there is not enough electrical capacity in the home (below 200 amps), the cold water inlet
temperatures are below 50°F or there are higher than standard flow rate faucets in the
home. If any of these conditions exist, it may be necessary to look at other feasible
options, such as the booster or backup application or the multiple Seisco arrangement.
Also, in warmer climates, where the inlet water temperatures are above 65°F, it is very
possible to use a Seisco RA-22 with a 150 amp whole-house electric service.

Water Heating - Booster Or Backup To Existing Storage Tank Application

When a home or building does not have the electrical capacity (200 amps) for a Seisco
whole-house model, the booster or backup application is a very effective option for
providing endless hot water in combination with a storage tank heater. This is generally
the case in homes that primarily use gas or oil for heating and the electrical service is
inadequate. With the Seisco utilized as a booster or backup downstream from the storage
tank heater, it is still possible for a large family or heavy users to enjoy endless hot water.
In this arrangement, the Seisco will not turn on until the temperature of the hot water
from the storage tank has dropped below the desired temperature setting of the Seisco
heater. While the storage tank is recovering, the Seisco will turn on and continue to
provide hot water. Models to be considered for this application are the RA-18 and the RA-
22. Refer to the Product Specification Tables for the ratings of these two models to
determine the one that will work with the electrical capacity of the home.

Water Heating - High Flow Applications

Combining two or more Seisco heaters in the parallel plumbing configuration (as shown in
this section) is the most effective design for high flow applications. However, split
systems, such as using a Seisco booster application in series with the main Seisco heater,
are also effective when the parallel configuration cannot be located closer to the high flow
faucet. Body spa showers (single shower stalls with multiple nozzles or sprayers), whirl
pool and Jacuzzi tubs are among the fixtures with the highest flow rates found in the

                                                                                                                8
                                            SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




home (7 to 14 GPM’s). Other high flow fixtures may be the standard tub faucet, shower,
utility sink or the washing machine (3 to 6 GPM’s). In addition, the life style expectations
for hot water usage in the home needs to be considered. For instance, if two or more
showers will always be required to run at the same time (particularly in the winter), then
the flow rate of the combined shower faucets must be added together to arrive at the
peak flow rate demand and thus the appropriate Seisco system design.

It is important to start with the Seisco selection criteria to first determine the design
parameters, such as the cold water inlet temperature, combined peak flow rate, and the
electrical capacity in the home. It is recommended to install multiple Seisco heaters in
parallel or in a split series configuration so that the peak flow is matched. If one is
planning to install multiple Seisco heaters, zoning multiple Seisco heaters on individual
branches of the plumbing system should be avoided. This will deprive high flow
applications the sum of the two heating benefits of the combination of two or more
heaters working in parallel.

Water Heating - Circulating System Application

Some homes have a hot water circulating or re-circulating system designed to maintain
hot water in the plumbing system throughout the house. This allows the user at any
faucet on the system to receive hot water instantaneously. In most cases, these systems
maintain the temperature between 90 and 125°F with an auxiliary thermostat connected
to the circulating pump. The Seisco control works independently in this type of system and
does not require wiring to the pump or the auxiliary thermostat. The Seisco control is
designed to detect flow and heat the water, which in this case occurs when the pump is
activated by the auxiliary thermostat. The Seisco heater works very effectively with this
arrangement as shown in the application diagram in this section. However, the same
selection criteria applies to matching the proper model for this application and should be
done using the cold water temperature entering the home and not the re-circulated water
temperature in the system. Like any other high flow application, it is desirable to install
multiple Seisco heaters in parallel on this system if necessary. Refer to High Flow
Applications in this section for details and the High Flow Application Diagram.

Space Heating – Radiant Floor Heating Systems

Radiant floor heating systems are not only growing in popularity in the north, but also in
new homes across the mid-section of the U.S. as well. Many feel that radiant floor heat
provides the most comfort and warmth of any heating system. Using Seisco heaters in
radiant floor heating systems can help make the installation and operating costs more
affordable. As shown in the application diagram in this section, most radiant floor systems
are plumbed in a closed-loop configuration and often use not less than 50% antifreeze
/ 50% water solutions (i.e. ethylene glycol) as the heating fluid. Note, that the Seisco
works independently with its temperature activated control and does not require wiring to
the circulating pump or the auxiliary thermostat.


                                                                                                               9
                                            SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




As with most circulating or re-circulating systems, some of the heat or BTU’s produced by
the Seisco heater is recovered. For instance, the fluid that is initially heated to 125°F by
the Seisco heater may return to the heater at 80 or 90°F, depending on the heat loss rate
or BTU loss of the building. Qualified HVAC (Heating, Ventilation & Cooling) Contractors
will calculate the heating requirements of a building, in BTU’s per hour. For radiant floor
heating applications, it is recommended to use two Seisco heaters plumbed in parallel, not
in series. The recommended use of two Seisco heaters is to provide a backup in the event
either heater needs service. The BTU per hour rating of the combined Seisco heaters
should equal not less than 125% of the BTU per hour requirements to heat the building.
Refer to the chart in the application diagram for suggested heater sizes for a variety of
home sizes in square feet.

Space Heating, Dual System – Radiant Floor & Domestic Hot Water

The use of a Plate Heat Exchanger enables two systems of Space Heating and Domestic
Hot Water to be combined, and without interchanging fluids. In this case, a single heating
source, such as the Seisco, can be used to provide the heating for both systems, Radiant
Floor Heating and Domestic Hot Water. One of the advantages of combining these two
systems is to reduce the need for higher electrical capacity. In most homes with standard
faucets, one Seisco Model SH-28 can be used to handle both demands. Therefore, the
required minimum, whole-house, electrical service can be as little as 200 amps, which is
standard for most modern homes. A home can now enjoy the same energy and operating
cost savings for both systems with one and the SAME Seisco heater. For details on this
system’s configuration, refer to the Dual System – Radiant Floor & Domestic Hot Water
System in this section.

In this application, the Domestic Hot Water side of the system typically requires a higher
demand for hot water. Therefore, it is necessary to install a priority flow switch on the
Domestic Hot Water line to help insure that the primary need for hot water is available.
The priority flow switch detects flow to the domestic side and temporarily turns off the
dual system circulating pumps. When the flow of Domestic Hot Water stops, the priority
flow switch will allow the circulating pumps to turn on providing heat for the Radiant Floor
Heating system as required.

The Seisco’s output temperature setting should be between 115 and 125°F to enable the
Radiant Floor Heating System to provide the required output rating (BTU per hour rating).
There will be some heat loss in the Plate Heat Exchanger and will vary depending on the
model and efficiency of the Plate Heat Exchanger selected. So it is important to adjust the
temperature output of the Seisco heater to provide for the most effective temperature for
both systems. Note, that today’s building codes may require that the domestic hot water
supply temperature to be limited to 120°F.
The same Seisco selection criteria applies in selecting the proper model for this application
and should be done using the cold water temperature entering the home and not the re-
circulated water temperature in the system. Also, it is appropriate to install multiple Seisco


                                                                                                             10
                                            SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




heaters in parallel on this system if necessary for high flow requirements. Refer to High
Flow Applications in this section for details and the High Flow Application Diagram.

Space Heating – Indoor Hydro-Heating Systems

Hydro-Heating technology is generally used for indoor space heating systems in
apartments and condominiums across the middle and southern sections of the U.S. The
system was designed to extract heat from hot water circulating through an open-loop heat
exchanger. The small and compact size of the Sesico heater saves valuable space
generally occupied by a boiler or large storage tank heater used with this application. Also,
the Seisco provides the domestic hot water needed for household sinks, showers and tubs
as well. See the Hydro-Heating Application Diagram in this section, illustrating the
components generally used with this system.

Because of the high demand for hot water in this application, it is necessary to install a
priority flow switch that helps insure all the hot water is available for the domestic needs.
The priority flow switch detects flow to the domestic side and temporarily turns the hydro-
heating pump off. When the flow of Domestic Hot Water stops, the priority flow switch will
allow the circulating pump to turn on providing heat for the Hydro-Heating system if the
necessary.

The Seisco’s output temperature setting should be between 125 and 130°F to enable the
hydro-heating system to provide the required output rating (BTU per hour rating). Note,
that today’s building codes may require the use of a mixing valve on the domestic hot
water supply to limit the temperature to 120°F. The hydro-heating systems used for
apartments and condominiums, are generally rated from about 27,000 to 40,000 BTU’s
per hour. However, the BTU requirements for the domestic hot water side may exceed
75,000 BTU’s per hour during periods of peak flow, such as running the bath tub or the
washing machine. The output of the Seisco Model SH-28 is about 96,000 BTU per hour
and is ideal for this application.

Water Heating - Solar Backup Application

Heating water with solar collectors in certain geographic regions is one of the most
efficient systems. The sun is obviously free energy, but when the sun is not available for
replenishing the heat used from the storage tank or batch collector, the Seisco heater
provides the perfect back-up. As a back-up heater, the Seisco allows the passive system
do what it was designed to do, to recover on it’s own. Solar heating systems are
particularly vulnerable to running out of hot water during the evening and early morning
hours. Particularly, if the tank only holds 40 or 50 gallons. Two or three baths or showers
taken during this period can deplete the tank when there is no sun available to recover or
replenish the tank. The Seisco heater will only turn on and provide hot water when it
senses the temperature from the storage tank or batch system is lower than it’s set point,
making it the perfect back-up. In addition, the Seisco will only use the energy necessary to
raise the temperature it senses to the set point, typically 120°F.

                                                                                                             11
                                           SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




Refer to the Solar Backup Diagram in this section and note that a mixing valve must be
used between the storage tank and the Seisco. Temperatures generated by the solar
collectors can exceed 160°F, too hot for domestic use. Also, the Seisco is equipped with a
180°F high temperature shut down switch. So temperatures of 180°F or greater will
disable the Seisco heater and require a manual reset. Because there will be periods when
the solar collectors are not heating the water and the storage of hot water can be
depleted, the Seisco heater should be sized to heat the water as if there were no solar
heating system. Use the selection criteria at the beginning of this section the Product
Specification Tables to size and match the Seisco for this application using the cold
water inlet temperature.

Water Heating - Geothermal Backup Application

There are geothermal heat pump systems used for space heating that are also designed to
heat water for domestic use. These systems utilize an auxiliary de-super heater (or heat
exchanger) designed to heat water in a storage tank heater. This is a closed-loop system
that transfers heat from the de-super heater to heat exchanger coils inside the storage
tank. The Seisco heater located down stream from the storage tank provides the perfect
back-up for this application. Refer to the Geothermal Backup Application diagram for an
illustration of how this system is configured.

As with the backup to the solar water heating system, the Seisco allows this passive
geothermal heating system to recover the hot water in the storage tank when not in use.
The Seisco will heat water only when the tank is depleted or the water temperature drops
below the set point of the Seisco heater during usage. The Seisco will not turn on during
periods of standby while the geothermal system is recovering. Because there will be
periods when the geothermal heat pump is not operating (spring and fall months), and the
stored hot water can be depleted, the Seisco heater should be sized to heat the water as if
there were no geo-exchange heating system. Use the selection criteria at the beginning of
this section from the Product Specification Tables to size and match the Seisco for
this application using the cold water inlet temperature.




                                                                                                            12
                                         SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




    Standard Whole House Application                                              SEISCO Model RA-28
                                                                                  Tank-Less!! ELECTRIC
  for Domestic Hot Water with a SEISCO,                                         Continuous Water Heater-
                                                                                WHOLE HOUSE Application
               Model RA-28




                                                           Cold Water Inlet
            Hot Water to House




                     Shut-off                                    Shut-off
                       Valve                                      Valve
                     (Optional)




                                                                             30 AMP




                                      SEISCO                                 30 AMP



                                       RA-28                                 30 AMP



                                                                             30 AMP



                                                                       220/240 VAC Power*



• The Seisco, Model RA-28, was designed to provide hot water at 120°F for a home with
  standard faucets (2.5 GPM’s) and minimum inlet cold water temperatures of 40
  degrees. For ratings, refer to the Product Specification Tables in the “Description &
  Specifications” section of the Seisco Product Manual.
• However, special applications in a home, such as body spa showers, whirl pool and
  Jacuzzi tubs may require the use of multiple Seisco heaters. Refer to the “High Flow
  Applications” diagram in this section for the arrangement of multiple Seisco heaters.


        * The RA-28 Model requires FOUR 30 Amp, Double Pole, 220/240 VAC
        circuits from the main electrical panel or from an installed sub-panel or
        disconnect box.




                                                                                                          13
                                            SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




       Storage Tank Booster Application                                                SEISCO Model RA-18
                                                                                       Tank-Less!! ELECTRIC
For Endless Domestic Hot Water with a SEISCO,                                        Continuous Water Heater-
                                                                                       BOOSTER Application
                 Model RA-18




                                   Heated Water From Tank                                Cold Water Inlet


Hot Water to House

                                                      Shut-off
                                                       Valve


      Shut-off
        Valve
      (Optional)

                                           40
                                          Amp

                       SEISCO
                                         220/240 VAC Power*
                        RA-18
                                           40
                                                                               Existing
                                          Amp
                                                                            Storage Tank
                                                                            Water Heater




  • The Seisco RA-18 will turn on initially during the
    period before the heated water arrives from the
    Tank and / or when the Tank runs out.
  • Seisco Water Heaters are pre-set at about 120
    degrees F. Typically, Storage Tank Heaters are set
    at 130 to 140°F. The Seisco’s temperature can be
    adjusted if necessary, up to 130°F.




         * The RA-18 Model requires TWO 40 Amp, 220/240 VAC circuits from the main
         electrical panel or from an installed 80 Amp sub-panel or disconnect box.




                                                                                                             14
                                              SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




           High Flow Application                                                 SEISCO Model RA-28
                                                                                 Tank-Less!! ELECTRIC
     Parallel Configuration for SEISCO,                                        Continuous Water Heater-
                                                                                HIGH FLOW Application
           Models RA-18, 22 or 28




  Hot Water to House                                                 Cold Water Inlet




       Shut-off                                                                              Shut-off
         Valve                                                                                Valve
       (Optional)
                    Shut-off              Shut-off
                     Valve                 Valve




                                                 30                                                         30
                                                AMP                                                        AMP


                                                 30                                                         30
                                                AMP                                                        AMP

                    SEISCO            240 V
                                      Power
                                                                   SEISCO                        240 V
                                                                                                 Power
                     RA-28                       30                 RA-28                                   30
                                                AMP                                                        AMP


                                                 30                                                         30
                                                AMP                                                        AMP




• For parallel installations, both Seisco heaters should be the same Model or size. At
  220/240 VAC, two RA-18’s = 36 KW, two RA-22’s = 44 KW and two RA-28’s = 56 KW
  maximum power output. Refer to the Product Specification Tables in the
  “Description & Specifications” section of the Seisco Product Manual.
• The thermostat setting of both heaters should be in the same position in order to
  balance the power of both heaters and maximize efficiency. The balance of power
  between the two heaters can be checked using a clamp-on amp meter by measuring
  the amp flow through the heating element wires.




                                                                                                                 15
                                        SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




 Hot Water Circulation System Application                                          SEISCO Model RA-28
                                                                                   Tank-Less!! ELECTRIC
  Using a Surface Mounted Thermostat in                                          Continuous Water Heater-
                                                                                 HOT WATER CIRCULATING
Combination with a Circulating Pump and a                                               Application

          SEISCO, Model RA-28.


    Expansion
      Tank
    (Optional)


                 Hot Water to House                                                Cold Water Inlet
                                                                   Shut-off
                                                                    Valve



                         Shut-off
                          Valve

                                                                       30
                                                                      AMP


                                                                       30                            Check
                                                                                 220/
                                       SEISCO                         AMP
                                                                                240 V                Valves
                                                                                Power
                                        RA-28                          30
                                                                      AMP


                                                                       30
                                                                      AMP
                                                                                                      Hot Water
             Hot Water                                                                                 Return
              Return




                                                                                 Circulating Pump
Thermostat (Surface-Mounted)                                          120 VAC
Set Temperature 95°F with 20 Degree Differential                       Power




 * Seisco Model RA-28 requires FOUR 30 Amp, double pole, 220/240 VAC
 circuits from the main panel or sub-panel / disconnect.




                                                                                                         16
                                                                  SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




     Radiant Floor or Hydronic Heating Application                                                     SEISCO Model SH-14
                                                                                                      Tank-Less!! ELECTRIC
          For Full House Closed-Loop System                                                               Space Heater
                                                                                                     RADIANT FLOOR HEATING
      using Two Seisco Model SH-14’s in Parallel.                                                          Application




                               Floor Area #1                            Floor Area #2                           Floor Area #3




       Room
     Thermostat                Circulating
                                                     Hot Water                                                     Valves
                                  Pump



                                                   Air
                                                Separator
                                                                                  MAINFOLD                          Drain

                     Expansion                                                     SYSTEM
                        Tank


  120 V                                                        Return                         SIZING GUIDE FOR FULL HOUSE
  Power
                                                               Water
                     Check Valve                                                              Ø   3,000+ Sq. Ft. Homes w/50,000
                                                                                                  to 90,000 BTU Heat Loss, use
                                                                Shut-                             two SH-14’s as shown or two
                                                                 off                              SH-11’s in Parallel.
                                                                Valve
                                                                                              •   2,500 to 3,000 Sq. Ft. Homes w/
                                                                                                  30,000 to 50,000 BTU Heat
                                                                                                  Loss, suggest two SH-09’s in
                                              40                                    40            Parallel or one SH-18*.
                                             Amp                                   Amp
                     SEISCO                                 SEISCO                            •   1,500 to 2,400 Sq. Ft. Homes w/
                       SH-14                  40              SH-14                 40            20,000 to 30,000 BTU Heat
                                             Amp                                   Amp            Loss, suggest one SH-11 or one
                                                                                                  SH-09*.
                                             240 V                                240 V
                                             Power                                Power       •   800 to 1,400 Sq. Ft. Homes w/
                                                                                                  15,000 TO 20,000 BTU Heat
*Note: If possible, use two Seisco units plumbed in parallel for radiant floor heating            Loss, suggest one SH-07 or one
systems. If one unit fails, the second unit would continue to provide heat by at least            SH-05*.
heating a critical area or by heating alternating zones, until the failed unit is repaired.


                                                                                                                                   17
                                                         SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)



Dual System – Radiant Floor & Domestic Hot Water                                                   SEISCO Model SH-28
                                                                                                  Tank-Less!! ELECTRIC
 Combination, Using a Plate Heat Exchanger and a                                                     Space Heater-
                                                                                                 DUAL SYSTEM – RADIANT
SEISCO Model SH-28 as the Single Heating Source                                                 FLOOR AND DOMESTIC HOT
                                                                                                    WATER Application


                               Air

   CIRCULATING
                            Separator        PLATE HEAT
      PUMP                                   EXCHANGER                Shut-off
                                                                       Valve
                                                                                                        Cold Water Inlet
       ‘A’



                                                                                                          Shut-off               Check
                                                                                                                                 Valve
                    Expansion                                                                              Valves
                     Tank


                                                                                                                 40
                                                                                                                AMP

                                                                                    SEISCO                       40
                                                                                                                AMP
                         CLOSED LOOP
                           ETHYLENE
                                                                                     SH-28                       40
                                                                                                                AMP
                            GLYCOL                         Shut-off
                                                                                                                 40
                                                            Valve                                               AMP


                                                                                                                240 V
                   MANIFOLD                                                                                     Power
                                                                              Air          CIRCULATING
                    SYSTEM                                                 Separator          PUMP
                                                                                                ‘B’
                                              DRAIN




                                                            Check Valves
                                                                              Expansion
                                             Priority
                                              Flow                               Tank
                                                                                                              120 VAC
                  HEATING ZONES              Switch*                                                           Power




  Room                             PUMP
Thermostat                      CONTROLLER
                                 (RELAYS)

                                                             Hot Water To House

       *A “Priority Flow Switch” or a surface mounted thermostat could be used. Each serves the same
       function of turning off both circulating pumps when domestic hot water flow is sensed.

  •    SPACE HEATING OPERATION: When the room thermostat calls for heat, both circulating pumps ‘A’ & ‘B’
       will turn on. Pump ‘B’ circulates water through the Seisco creating the heat flow through the Plate Heat
       Exchanger. Heat is transferred to the Closed Loop Radiant Floor Heating System and circulated by Pump ‘A’
       until the thermostat is satisfied. When satisfied, the room thermostat will signal to both pumps to turn off.

   •    DOMESTIC HOT WATER OPERATION: The “Priority Flow Switch” will sense flow for any demand for
        domestic hot water and prevent Pumps ‘A’ & ‘B’ from turning on. The circulating pumps will not turn on until
        the demand for domestic hot water stops, even if the room thermostat calls for heat.

                                                                                                                          18
                                                       SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




       Hydro-Heating or Indoor Heat Pump System for                                                   SEISCO Model SH-28
        a Combined Space Heating and Water Heating                                                   Tank-Less!! ELECTRIC
                                                                                                        Space Heater-
          Application using a SEISCO, Model SH-28                                                   GEOTHERMAL Application


                                                                                                   Hydro Heating Unit
                                         Hot Water To Space Heat
    Hot Water To House


                              Shut-off                   Warm
         Priority              Valve
          Flow                                           Water
         Switch*                                         Return
                       Control Wires
                       to Circulator
                                                                                      Circulator
                                                                                                          Heat Exchanger
                                                                  Drain

                                                                                          Check
                                                                                          Valves
                                                                                                      Cold Water Inlet
                          o       o
                     (125 – 135 F)

      Mixing
      Valve
                                                                  Shut-off                     Shut-off
      Set to
                                                                   Valve                        Valve
      120o F         Cold
                     Water
                     Inlet                                                  40
                                                                           AMP



                                           SEISCO
                                                                            40
                                                                           AMP
                                                                                  220/240 VAC Power
                                            SH-28                           40
                                                                           AMP


                                                                            40
                                                                           AMP




•    Hydro-Heating systems are generally used for apartments and condominiums throughout the central and
     southern regions of the United States. Typically, the BTU ratings for these systems range from
     approximately 27,000 to 40,000 BTU. The Seisco Model SH-28 is rated for over 96,000 BTU output.

•    For the Hydro-Heating system to obtain it’s maximum BTU rating, the Seisco temperature setting may need
     to be between 125o – 135oF.



*A “Priority Flow Switch” or a surface mounted thermostat could be used. Each serves the same function
of turning off the circulator pump to the Hydro-Heating system when domestic hot water flow is sensed.




                                                                                                                        19
                                                         SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




       Solar Backup Water Heating Application                                                   SEISCO Model RA-28
       With Storage Tank and Closed-Loop Heat                                                   Tank-Less!! ELECTRIC
                                                                                              Continuous Water Heater-
       Exchanger using a SEISCO, Model RA-28                                                     SOLAR Application




                                  Cold Water Inlet
  Hot Water to House                                                                                                     Solar
                                                                                                                         Collectors


                                  Shut-off
                                                                 Check
                                  Valve                          Valves
     Shut-off
       Valve
     (Optional)
                                             Mixing
                                             Valve Set
                                             To 130o F



                                              30
                                             AMP

                    SEISCO                    30
                                             AMP                   Controller                   120 V

                     RA-28                         240 V                                        Power
                                              30   Power
                                             AMP

                                              30                                                                                 Drain
                                             AMP
                                                                                                                                 Down




                          Storage Tank
                           40 or 50 Gal. (No
                           Heating Elements
                              Required)
                                                                                                            Circulator
                                                                                                              Pump

♦ Temperatures from the Solar Heated Storage Tank can reach 160oF, thus requiring a mixing
  valve ahead of the Seisco to prevent the high temperature switch from tripping and disabling the
  Seisco.
♦ If the Storage Tank contains heating elements, they should be disconnected or the power
  turned off to enable the Seisco to provide the back-up heating. The Seisco should be set to turn
  on when the water from the Storage Tank drops below 120oF.

       * The RA-28 Model requires FOUR 30 Amp, 220/240 VAC circuits from the main
       electrical panel or from an installed 120 Amp sub-panel or disconnect box.
                                                                                                                           20
                                                     SEISCO Product Guide – Applications & Diagrams (Version 11.03, Sec 4)




            Geothermal Backup Application                                                     SEISCO Model RA-28
                                                                                              Tank-Less!! ELECTRIC
    with a De-Super-Heater for Domestic Hot Water                                           Continuous Water Heater-
                                                                                            GEOTHERMAL Application
             using a Seisco, Model RA-28.


                        Hot
                        Water To
                                                                                   Supply Air



                                             Cold
                                 220/240     Water
                                 VAC
                                 Power                                                       Return
                                                                                               Air
           SEISCO
           RA-28*                                           Geothermal
                                           Shut-            Heat Pump
                                           off
                                           Valve
                                                           De-Super
                                                            Heater

     Storage Tank
    40 or 50 Gal. (No
    Heating Elements
       Required)




                                                                                                  Manifold
                                                                                Pump
                                                                                                     with
                                                                                                  Circulator




                                                                     Earth Connection
                                                                           Loop

♦ If the Storage Tank contains heating elements, they should be disconnected or the power turned off to enable
  the GeoExchange System to provide as much of the heated water in the tank as possible. Seisco provides
  back-up hot water only when the GeoExchange System is not running or not providing enough heat to the
  Storage Tank. This typically occurs during the spring and fall.
♦ Seisco also provides the added feature of endless hot water after t he storage tank has been depleted during
   heavy domestic hot water usage.

          * Seisco Model RA-28 requires FOUR 30 Amp, 220/240 VAC circuits from the main
          panel or from an installed 120 Amp sub-panel or disconnect box.
                                                                                                                      21
6HLVFR3URGXFW*XLGH± $SSOLFDWLRQV	'LDJUDPV9HUVLRQ




                                                         
                                      SEISCO Product Guide – Electrical Requirements (Version 11.03)




                       SEISCO®
      5    ELECTRICAL WIRING REQUIREMENTS
                          &
              SAMPLE LOAD CALCULATIONS
                           (28 pages – 477 KB)




A. Introduction to SEISCO Electrical Requirements

B. National Electric Code Rules – Load Calculations

C. Sample Residential Load Calculations

D. National Electric Code Rules - Branch Circuit Protection

E. SEISCO Electrical Wiring & Breaker Guides

  1. “RA” Water Heating Models

  2. “SH” Space Heating Models

F. Single and Three Phase Wiring Diagrams

  1. Single Phase 240 VAC or 208 VAC Wiring

  2. Single Phase 240 VAC or 208 VAC with 2 Circuit Option

  3. Single Phase Heater Wired to 240 VAC or 208 VAC Three
     Phase Supply

  4. Three Phase Heater Wired to 380 VAC Supply




                                                                                                  1
                                                           SEISCO Product Guide – Electrical Requirements (Version 11.03)


A. Introduction to Seisco Electrical Requirements
     The Seisco heater saves on energy costs because it uses less energy than a typical tank-type
heater. However, because it is an on-demand heater, it will generally require more power (kW) to
operate than a tank-type heater. The tank-type heater will operate for much longer periods and
less efficiently. The trade-off of using more power to heat only as it is needed proves to be a less
costly and more efficient alternative than heating with other methods, such as with tank-type
heaters and boilers. The tank-type heater continues to heat water whether you need it or not. The
energy savings associated with the on-demand technology of the Seisco heater versus storage
tank heaters is discussed in the Cost Comparison section of this manual.

     Like most electric storage tank water heaters, the Seisco heater requires a supply circuit
voltage nominally rated for 220 / 240 volts (VAC) (or 208 VAC). Several of the Seisco models
require multiple double pole circuits and breakers (see Chart 1 below for 240 volt electrical
ratings and requirements). Ratings for 208 volt commercial service and 208 volt ratings can be
found in the Product Description & Specification section of this manual.

CHART 1 - SEISCO ELECTRICAL RATINGS FOR “RA” WATER HEATING MODELS
   Water          Maximum           Voltage          Maximum         Number of        Number of Circuit            Circuit
   Heater           Power            Rating        Current Rating      Circuits            Breakers             Breaker Size
   Model         Rating (kW)         (VAC)             (Amps)       (Two Wire)          (Double Pole)             (Amps)
   RA-09               9            220/240             37.5               1                    1                    40
   RA-11              11            220/240               46               1                    1                    50
   RA-14              14            220/240               58              2*                   2*                    30
   RA-18              18            220/240               75               2                    2                    40
   RA-22              22            220/240               91               2                    2                    50
   RA-28              28            220/240              116             4**                  4**                    30
* U.L. approved one 60-amp circuit as an option under NEC – 2002 Edition, Article 422.11(f)(3)
** U.L. approved two 60-amp circuits as an option under NEC – 2002 Edition, Article 422.11(f)(3)

CHART 2 - SEISCO ELECTRICAL RATINGS FOR “SH” SPACE HEATING MODELS
   Space          Maximum           Voltage          Maximum         Number of        Number of Circuit            Circuit
   Heater           Power            Rating        Current Rating      Circuits            Breakers             Breaker Size
   Model         Rating (kW)         (VAC)             (Amps)       (Two Wire)          (Double Pole)             (Amps)
   SH-09               9            220/240             37.5               1                    1                    50
   SH-11              11            220/240               46               1                    1                    60
   SH-14              14            220/240               58              2*                   2*                    40
   SH-18              18            220/240               75               2                    2                    50
   SH-22              22            220/240               91               2                    2                    60
   SH-28              28            220/240              116             4**                  4**                    40
* U.L. approved one 75-amp circuit as an option under NEC – 2002 Edition, Article 422.11(f)(3)
** U.L. approved two 75-amp circuits as an option under NEC – 2002 Edition, Article 422.11(f)(3)

Electrical Service:

    The Seisco Water Heater in the U.S. is generally considered a non-continuous heating
appliance according to the definitions in the National Electric Code, sections NEC 410 and 411.
An appliance load that is not continuous for 3 hours or more is considered non-continuous. The
Seisco heater, when used for standard domestic hot water applications, is considered a non-
continuous heating appliance. Due to the diversity of water heating in a home, the load (amps)
contribution of the Seisco heater to the overall service load of the home or building can be
calculated using the

                                                                                                                       2
                                                         SEISCO Product Guide – Electrical Requirements (Version 11.03)


optional methods from the National Electrical Code, sections NEC 220-30 or 220-31. The
methods and rules for calculating these loads can be found in the following section of this
manual under B. National Electric Code Rules – Load Calculations.

    For new dwellings, the service load should be calculated using NEC 220-30. For existing
dwellings, the service load should be calculated using NEC 220-31. By both calculation
methods, the Seisco load is generally added to the service load at 40% of it’s maximum
nameplate rating. For instance, the maximum current (amp) rating of the Seisco Model RA-28 is
116 amps and 40% of this rating is about 47 amps. The 47 amps is typically the load added to the
overall service load of the dwelling when using the optional calculation methods as described in
NEC 220-30 and 220-31, not the maximum current rating, 116 amps. As a result, the Seisco
Model RA-28 will fit in most homes up to 3000 square feet that have a 200 amp whole-house
electrical service. Also, it is important to refer to the Seisco Product Specifications for flow rate
and temperature rise ratings of each model before selecting the Seisco(s) for a home or building.

Power/Voltage Modulation:

    During operation, the Seisco heater is designed to use only the power necessary to heat the
water for various combinations of temperature rise and flow rate. Also, it is designed to
distribute the power evenly to its heating elements. This is called the “Power Sharing”
technology and is patented by Seisco.

    The on-board microprocessor control of the Seisco determines the temperature rise and flow
rate through it’s temperature sensors mounted on the heating chamber. The control then staggers
the application of power to the heating elements using voltage modulation. The result is a smooth
and efficient use of power to heat the water. This advanced control technology is extremely
important in eliminating light flicker and fluctuations within the home or building. Also, the
Seisco heater will use only about 40 to 60% of it’s power rating for most domestic water heating
applications in a home, such as a standard shower, bath or kitchen sink. The Seisco heater may
use more power when heating water for multiple tasks or for higher flow faucets, such as bath
tub and washing machine faucets.

Sub-panels:

    Electrical sub-panels, containing circuit breakers, may be used with appliances such as the
Seisco water heater in residential and commercial applications. Particularly for the models
requiring multiple circuits, which are water-heating models RA-14, RA-18, RA-22 and RA-28
and space heating models SH-14, SH-18, SH-22 and SH-28 (see previous Chart – Seisco
Electrical Ratings in this section).

    In new residential construction, there are usually enough spaces for additional breakers in the
main electrical panel to accommodate multiple circuit breakers for the Seisco heater. However,
in existing homes, the main electrical panel may be nearly full with circuit breakers serving
existing load. In these cases, a single large breaker, rated for the entire load of the Seisco heater,
can be installed at the main panel. From the main panel, a single circuit or sub-feed is installed to
a sub-panel where the appropriate number of circuit breakers can be installed for the Seisco
heater. Refer to the “Electrical Wiring & Breaker Guides” in this section for options that can
be used to serve various Seisco Models requiring multiple circuits.



                                                                                                                     3
                                                        SEISCO Product Guide – Electrical Requirements (Version 11.03)
Branch Circuits and Breakers:

     Water Heaters: SEISCO Water Heaters (“RA” Models) are considered a non-continuous
heating appliance and the branch circuit wires and breakers protecting the appliance must be
sized to 100% (percent) of it’s maximum ampere rating. It is recommended that the wire and
breakers of the branch circuits and sub-feeds be rated for at least 75 degrees C. This is
particularly important to avoid over heating of the wires at the connections to the breakers. Over
heating at the breaker connections may cause nuisance or premature breaker trips. Refer to D.
National Electrical Code Rules – Branch Circuit Protection in this section of the Seisco
Product Manual for further detail and explanation.

   Space Heaters: SEISCO Space Heaters (“SH” Models) in the U.S. are generally considered a
non-continuous heating load since it is highly unlikely that it will be on full power for over 3
hours. However, in Canada, the load is considered to be continuous. More likely, since heated
water is being returned to the unit, it will operate at a relatively low current even if it operates all
the time. Therefore, it would not be "continuously loaded to its maximum current" when
considered an appliance in Article 422. However, as the rule for "fixed electric space heating
equipment" in Article 424 is written, there is no reference to continuous loads and it is required
that the circuits to every fixed electric space-heating equipment shall not be less than 125 %
(percent) of it’s maximum ampere rating.

Voltage Rating:

     Seisco heaters are manufactured with common heating elements designed for optimum
operation on a standard residential 220/240 VAC electric service. Also, the Seisco will operate at
208 VAC, a common commercial voltage, with standard 220/240 VAC heating elements.
However, when operating the heater at 208 VAC, the power rating and the heat output rating is
significantly reduced. Seisco models can be special ordered with 208 VAC heating elements to
help maximize the power and heating output. Refer to the Product Specifications Table for
details on the various voltage ratings.

B. National Electrical Code Rules – Load Calculations
C. Optional Calculations for Computing Feeder and Service Loads
220-30. Optional Calculation — New Dwelling Unit
(a) Feeder and Service Load. For a dwelling unit having the total connected load served by a
single 3-wire, 120/240-volt or 208Y/120-volt set of service-entrance or feeder conductors with
an ampacity of 100 or greater, it shall be permissible to compute the feeder and service loads in
accordance with this section instead of the method specified in Part B of this article. The
calculated load shall be the result of adding the loads from (b) and (c). Feeder and service-
entrance conductors whose demand load is determined by this optional calculation shall be
permitted to have the neutral load determined by Section 220-22.

(b) General Loads. The general calculated load shall be not less than 100 percent of the
first 10 kVA plus 40 percent of the remainder of the following loads:

1. 1500 volt-amperes for each 2-wire, 20-ampere small-appliance branch circuit and each
laundry branch circuit specified in Section 220-16
2. 3 volt-amperes per square foot (0.093 m2) for general lighting and general-use receptacles



                                                                                                                    4
                                                       SEISCO Product Guide – Electrical Requirements (Version 11.03)


3. The nameplate rating of all appliances that are fastened in place, permanently connected, or
located to be on a specific circuit, ranges, wall-mounted ovens, counter-mounted cooking units,
clothes dryers, and water heaters
4. The nameplate ampere or kVA rating of all motors and of all low-power-factor loads
(c) Heating and Air-Conditioning Load. Include the largest of the following six selections (load
in kVA).

1. 100 percent of the nameplate rating(s) of the air conditioning and cooling.
2. 100 percent of the nameplate ratings of the heat pump compressors and supplemental heating
unless the controller prevents the compressor and supplemental heating from operating at the
same time.
3. 100 percent of the nameplate ratings of electric thermal storage and other heating systems
where the usual load is expected to be continuous at the full nameplate value. Systems qualifying
under this selection shall not be calculated under any other selection in (c).
4. 65 percent of the nameplate rating(s) of the central electric space heating, including integral
supplemental heating in heat pumps where the controller prevents the compressor and
supplemental heating from operating at the same time.
5. 65 percent of the nameplate rating(s) of electric space heating if less than four separately
controlled units.
6. 40 percent of the nameplate rating(s) of electric space heating if four or more separately
controlled units.

220-31. Optional Calculation for Additional Loads in Existing Dwelling Unit
For an existing dwelling unit presently being served by an existing 120/240-volt or 208Y/120-
volt, 3-wire service, it shall be permissible to compute load calculations as follows:

Load (kVa)                         Percent of Load
First 8 kVA of load at             100
Remainder of load at               40

Load calculations shall include lighting at 3 volt-amperes/ft2 (0.093 m2); 1500 volt-amperes for
each 2-wire, small-appliance branch circuit and each laundry branch circuit as specified in
Section 220-16; range or wall-mounted oven and counter-mounted cooking unit; and other
appliances that are permanently connected or fastened in place, at nameplate rating.
If air-conditioning equipment or electric space-heating equipment is to be installed, the following
formula shall be applied to determine if the existing service is of sufficient size.

Air-conditioning equipment*                                                 100%
Central electric space heating*                                             100%
Less than four separately controlled space-heating units*                   100%
First 8 kVA of all other loads                                              100%
Remainder of all other loads                                                40%

*Use larger connected load of air conditioning and space heating, but not both.
Other loads shall include the following:
1. 1500 volt-amperes for each 20-ampere appliance circuit
2. Lighting and portable appliances at 3 volt-amperes/ft2 (0.093 m2)
3. Household range or wall-mounted oven and counter-mounted cooking unit
4. All other appliances fastened in place, including four or more separately controlled space-
heating units, at nameplate rating

                                                                                                                   5
                                                 SEISCO Product Guide – Electrical Requirements (Version 11.03)


C. Sample Residential Load Calculation – 3800 S.F. Home*
  (*All electric home with a SEISCO RA -28)


Dwelling with RA-28 Seisco Water Heater
Dwelling with range (12kW), dishwasher (1.2kVA), clothes dryer (5kW),
and two air conditioners, one 3.5 ton, 12 SEER, 17.9A + 3.3A air
handler; one 3.0 ton, 12 SEER, A + A air handler.
120/240V Service

Dwelling Area (Sq. ft.)                  3800    Square Feet
Seisco water heater                     RA-28
                                       Line VA
Lighting       3VA/sq.ft.x Area         11400
Appliance      2x1500VA                  3000
Laundry        1500VA                    1500
                    Subtotal (VA)       15900    VA

Range          12kW                    12000
Water Heater   28kW                    28000
Dishwasher     1.2kVA                   1200
Dryer          5kW                      5000

               Total Other Load (VA)   62100     VA

                Demand Factors
               10kW @ 100%             10000
               Remainder at 40%        20840

3.5 Ton A/C    AC 240V x 21.2A          5088
3.5 Ton A/C    AC 240V x 21.2A          5088
               Service Load (VA)       41016     VA

                   Current (A)         170.9     A
                 Service Panel         200A
Notes:
Load of Seisco RA-28 is 40% (VA)       11200




                                                                                                             6
                                                  SEISCO Product Guide – Electrical Requirements (Version 11.03)


C. Sample Residential Load Calculation – 3800 S.F. Home*
   (*All Electric Home with a SEISCO RA -28)


Feeder or Service Load - Optional 220-30
Dwelling with RA-28 Seisco Water Heater

Dwelling with range (12kW), dishwasher (1.2kVA), clothes dryer
(5kW), and two air conditioners, each (3.5 ton, 12 SEER, 21.2A
plus 10kW strip heater),120/240V Service

Dwelling Area (Sq. ft.)                   3800       Square Feet
Seisco water heater                      RA-28
                                        Line VA
Lighting       3VA/sq.ft.x Area          11400
Appliance      2x1500VA                   3000
Laundry        1500VA                     1500
                    Subtotal (VA)        15900       VA

Range          12kW                      12000
Water Heater   28kW                      28000
Dishwasher     1.2kVA                     1200
Dryer          5kW                        5000

               Total Other Load (VA)     62100       VA

               Demand Factors
               10kW @ 100%               10000
               Remainder at 40%          20840

3.5 Ton A/C    240V x (21.2+41.6)A       15072
3.5 Ton A/C    240V x (21.2+41.6)A       15072
               Service Load (VA)         60984       VA

                   Current (A)           254.1   A
                 Service Panels        200A+100A

Notes:
Load of Seisco RA-28 is 40% (VA)         11200




                                                                                                              7
                                                  SEISCO Product Guide – Electrical Requirements (Version 11.03)


C. Sample Residential Load Calculations – 2000 S.F. Home*
  (*All Electric Home with various SEISCO Heaters, RA-14, RA -22 & RA -28)


Dwelling Feeder or Service Load - Optional 220-30
 Comparing Seisco Water heater Loads

Dwelling with range (12kW), dishwasher (1.2kVA), clothes dryer
(5kW), and air conditioner (3.5 ton, 12 SEER, 17.9A + 3.3A air
handler), 120/240V service

Dwelling Area (Sq. ft.)                              2000 Square Feet
Seisco water heater                                 RA-14  RA-22      RA-28
                                                   Line VA Line VA Line VA
Lighting          3VA/sq. ft.xArea                   6000    6000      6000
Appliance         2x1500VA                           3000    3000      3000
Laundry           1500VA                             1500    1500      1500
                                     Subtotal       10500   10500     10500

Range             12kW                              12000          12000         12000
Water Heater      Seisco RA-14/RA-22/RA-28          14000          22000         28000
Dishwasher        1.2kVA                             1200           1200          1200
Dryer             5kW                                5000           5000          5000

                             Total Other Load       42700          50700         56700

                  Application of Demand Factors
                  10kW @ 100%                       10000          10000         10000
                  Remainder at 40%                  13080          16280         18680

3.5 Ton A/C       AC 240V x 21.2A                    5088          5088           5088

                            Service Load (VA)       28168          31368         33768

                                 Current (A)         117.4         130.7          140.7
                                      Use            125A          150A           150A

Notes:      Load of Seisco water heater is 40%       5600          8800          11200




                                                                                                              8
                                               SEISCO Product Guide – Electrical Requirements (Version 11.03)


C. Sample Residential Load Calculation – 2000 S.F. Home*
  (* All Electric Home with a SEISCO RA -28)


Feeder or Service Load - Optional 220-30
Dwelling with RA-28 Seisco Water Heater

Dwelling with range (12kW), dishwasher (1.2kVA), clothes dryer
(5kW) and air conditioner (3.5 ton, 12 SEER, 21.2A + 10kW strip
heater),120/240V Service

Dwelling Area (Sq. ft.)                    2000      Square Feet
Seisco water heater                        RA-28
                                          Line VA
Lighting       3VA/sq.ft. x Area           6000
Appliance      2x1500VA                    3000
Laundry        1500VA                      1500
                    Subtotal (VA)          10500     VA

Range          12kW                       12000
Water Heater   28kW                       28000
Dishwasher     1.2kVA                     1200
Dryer          5kW                        5000

               Total Other Load (VA)      56700      VA

                Demand Factors
               10kW @ 100%                10000
               Remainder at 40%           18680

3.5 Ton AC     240V X (21.2+41.6)A        15072

               Service Load (VA)          43752      VA

                    Current (A)            182.3     A
                  Service Panel            200A

Notes:
Load of Seisco RA-28 is 40% (VA)          11200




                                                                                                           9
                                                SEISCO Product Guide – Electrical Requirements (Version 11.03)


C. Sample Residential Load Calculations – 1600 S.F. Home*
  (All Electric Home with various SEISCO Models, RA -14, RA -22 & RA -28)



Dwelling Feeder or Service Load - Optional 220-30
 Comparing Seisco Water Heater Loads
Dwelling with range (12kW), dishwasher (1.2kVA), clothes dryer
(5kW) and air conditioner (3.5 ton, 12 SEER, 17.9A + 3.3A air
handler), 120/240V service

Dwelling Area (Sq. ft.)                               1600        Square Feet
Seisco water heater                                  RA-14           RA-22          RA-28
                                                    Line VA         Line VA        Line VA
Lighting        3VA/sq. ft.xArea                     4800            4800           4800
Appliance       2x1500VA                             3000            3000           3000
Laundry         1500VA                               1500            1500           1500
                                   Subtotal          9300            9300           9300

Range           12kW                                 12000           12000          12000
Water Heater    Seisco RA-14/RA-22/RA-28             14000           22000          28000
Dishwasher      1.2kVA                               1200            1200           1200
Dryer           5kW                                  5000            5000           5000

                           Total Other Load          41500           49500          55500

                Application of Demand Factors
                10kW @ 100%                          10000           10000          10000
                Remainder at 40%                     12600           15800          18200

3.5 Ton AC      AC 240V x 21.2A                       5088            5088           5088

                           Service Load (VA)         27688           30888          33288

                                Current (A)           115.4          128.7           138.7
                                     Use              125A           150A            150A

Notes:   Load of Seisco RA-28 is 40%                  5600            8800          11200




                                                                                                           10
                                                     SEISCO Product Guide – Electrical Requirements (Version 11.03)


C. Sample Residential Load Calculation – 1600 S.F. Home*
  (*All Electric Home with a SEISCO RA -28)



Feeder or Service Load - Optional 220-30
Dwelling with Seisco RA-28 Water Heater

Dwelling with range (12kW), dishwasher (1.2kVA), clothes dryer
(5kW), and air conditioner (3.5 ton, 12 SEER, 21.2A + 10kW strip
heater), 120/240V Service

Dwelling Area (Sq. ft.)                       1600         Square Feet
Seisco water heater                       RA-28
                                         Line VA
Lighting       3VA/sq.ft.xArea            4800
Appliance      2x1500VA                   3000
Laundry        1500VA                     1500
                    Subtotal (VA)         9300             VA

Range          12kW                       12000
Water Heater   Seisco RA-28               28000
Dishwasher     1.2kVA                     1200
Dryer          5kW                        5000

               Total Other Load (VA)      55500            VA

                Demand Factors
               10kW @ 100%                10000
               Remainder at 40%           18200

3.5 Ton AC     240V X (21.2+41.6)A        15072

               Service Load (VA)          43272            VA

                    Current (A)           180.3            A
                  Service Panel           200A

Notes:
Load of Seisco RA-28 is 40% (VA)          11200




                                                                                                                11
                                                       SEISCO Product Guide – Electrical Requirements (Version 11.03)



D. National Electrical Code Rules – Branch Circuit Protection
422-10. Branch-Circuit Rating
This section specifies the ratings of branch circuits capable of carrying appliance current without
overheating under the conditions specified.
(a) Individual Circuits. The rating of an individual branch circuit shall not be less than the
marked rating of the appliance or the marked rating of an appliance having combined loads as
provided in Section 422-62.
The rating of an individual branch-circuit for motor-operated appliances not having a marked
rating shall be in accordance with Part B of Article 430.
The branch-circuit rating for an appliance that is continuously loaded, other than a motor-
operated appliance, shall not be less than 125 percent of the marked rating; or not less than 100
percent of the marked rating if the branch-circuit device and its assembly are listed for
continuous loading at 100 percent of its rating.

NOTE: The SEISCO is not continuous!!

Continuous Load. A load for which the maximum current is expected to continue
for 3 hours or more.

NEC 422-11. Overcurrent Protection
Appliances shall be protected against overcurrent in accordance with (a) through (g) and Section
422-10.
(a) Branch-Circuit Overcurrent Protection. Branch circuits shall be protected in accordance with
Section 240-3.
If a protective device rating is marked on an appliance, the branch-circuit overcurrent device
rating shall not exceed the protective device rating marked on the appliance.

NEC 422-11(f) Exception (3): (2002 Edition) Water Heaters and Steam Boilers.
Water heaters and steam boilers employing resistance-type immersion electric heating elements
contained in an ASME-rated and stamped vessel or listed instantaneous water heaters shall be
permitted to be subdivided into circuits not exceeding 120 amperes and protected at not more
than 150 amperes.

For example; the RA-28 with four 7000-Watt elements can each draw 29 amperes at 240
volts. Thus, under NEC 422-11(f), Exception 3 above, and as listed with U.L., the RA-28
Water Heating Model can be supplied with two (2) - 60 ampere circuits and the SH-28
Space Heating Model can be supplied with two (2) – 75 ampere circuits. Likewise, the RA-
14 model can be supplied with one (1) – 60 ampere circuit and the SH-14 model with one
(1) – 75 ampere circuit.

422-47. Water Heater Controls
All storage or instantaneous-type water heaters shall be equipped with a temperature-limiting
means in addition to its control thermostat to disconnect all ungrounded conductors. Such means
shall be as follows:
    1) Installed to sense maximum water temperature; and
    2) Either a trip-free, manually reset type or a type having a replacement element. Such water
         heaters shall be marked to require the installation of a temperature and pressure relief
         valve

                                                                                                                  12
                                                         SEISCO Product Guide – Electrical Requirements (Version 11.03)


Exception No. 1: Storage water heaters that are identified as being suitable for use with supply
water temperature of 82ºC (180ºF) or above and a capacity of 60 kW or above, or

Exception No. 2: Instantaneous-type water heaters that are identified as being suitable for such
use, with a capacity of 1 gal (3.785 L) or less.

See ANSI Z21.22-1999/CSA 4.4-M99, Relief Valves for Hot Water Systems.

NOTE: No pressure relief valve required according to the NEC



Table 310-16. Allowable Ampacities of Insulated Conductors Rated 0 Through 2000 Volts, 60ºC Through
90ºC (140ºF Through 194ºF) Not More than Three Current-Carrying Conductors in Raceway, Cable, or Earth
(Directly Buried), Based on Ambient Temperature of 30ºC (86ºF)


Size                           Temperature Rating of Conductor (See Table 310-13)                                 Size
         60ºC    75ºC          90ºC                 60ºC        75ºC              90ºC
         (140ºF) (167ºF)       (194ºF)              (140ºF)     (167ºF)           (194ºF)

AWG      Types   Types FEPW,   Types TBS, SA, SIS,   Types        Types RH, RHW,       Types TBS, SA, SIS, AWG
or       TW,     RH, RHW,      FEP, FEPB, MI,        TW,          THHW, THW,           THHN, THHW, THW- or
kcmil    UF      THHW,         RHH, RHW-2,           UF           THWN, XHHW,          2, THWN-2, RHH,     kcmil
                 THW,          THHN, THHW,                        USE                  RHW-2, USE-2,
                 THWN,         THW-2, THWN-2,                                          XHH< XHHW,
                 XHHW,         USE-2, XHH,                                             XHHW-2, ZW-2
                 USE, ZW       XHHW, XHHW-2,
                               ZW-2
                           COPPER                    ALUMINUM OR COPPER-CLAD ALUMINUM
18       —       —             14                    —       —            —                                       —
16       —       —             18                    —       —            —                                       —
14*      20      20            25                    —       —            —                                       —
12*      25      25            30                    20      20           25                                      12*
10*      30      35            40                    25      30           35                                      10*
8        40      50            55                    30      40           45                                      8
6        55      65            75                    40      50           60                                      6
4        70      85            95                    55      65           75                                      4
3        85      100           110                   65      75           85                                      3
2        95      115           130                   75      90           100                                     2
1        110     130           150                   85      100          115                                     1
1/0      125     150           170                   100     120          135                                     1/0
2/0      145     175           195                   115     135          150                                     2/0
3/0      165     200           225                   130     155          175                                     3/0
4/0      195     230           260                   150     180          205                                     4/0




                                                                                                                    13
                                                       SEISCO Product Guide – Electrical Requirements (Version 11.03)


E1. SEISCO® Wiring & Breaker Guide* (RA-28)
    (* For Nominal 240 Volt Electrical Service)




                               1


                                                                                         MAIN
                               2


    SEISCO                                                                                                    OPTION
                                     (FOUR PAIRS OF) #8 CU AWG WITH                 30            30
     RA-28                     3                 GROUND                                                            A
                               4
                                                                                    30            30



A  – Main panel requires 8 spaces or four (4) double-pole, 30 amp, 240 volt breaker positions.
Breaker lugs must have a 75 deg C rating. A 200 AMP MAIN SERVICE IS RECOMMENDED.

                                        SUBPANELS
                                                         #6 CU AWG
                                                          ONE PAIR
                                                  30        W/G                          MAIN
                                                  30
                                                         #6 CU AWG                                           OPTION
    SEISCO                      #8 CU                     ONE PAIR
                                                                                    60            60
     RA-28                                                  W/G                                                  B
                                                  30

                                                  30


B – Main panel requires 4 spaces or two (2) double-pole, 60 amp, 240 volt breaker positions.
Breaker lugs must have 75 deg C rating to feed sub-feed, from main panel. A 200 AMP MAIN
SERVICE IS RECOMMENDED.
                                           SUBPANEL


                                                  30                                     MAIN
                                                        #1 CU AWG
    SEISCO                                        30   ONE PAIR W/G                                          OPTION
                               #8 CU
     RA-28
                                                                                  125
                                                                                                                  C
                                                  30    or #2/0 AL
                                                       ONE PAIR W/G
                                                  30

C – Main panel requires 2 spaces or one (1) double-pole, 125 amp, 240 volt breaker position.
Breaker lugs must have 75 deg C rating to feed sub-feed, from main panel. A 200 AMP MAIN
SERVICE IS RECOMMENDED.




                                                                                                                  14
                                                       SEISCO Product Guide – Electrical Requirements (Version 11.03)


E1. SEISCO® Electrical Wiring & Breaker Guide* (RA-22 & RA-18)
   (* For Nominal 240 Volt Electrical Service )




                                                                                         MAIN

    SEISCO                                                                                                   OPTION
     RA-22
                                      (TWO PAIRS OF) #6 CU AWG
                                            WITH GROUND
                                                                                    50            50              A


A – Main panel requires 4 spaces or two (2) double-pole, 50 amp, 240 volt breaker positions.

                                        SUBPANEL          #3 CU AWG                      MAIN
                                                           ONE PAIR
                                                             W/G
                                                                                                             OPTION
    SEISCO                                        50
     RA-22
                                #6 CU                                              100                           B
                                                  50    or #1 AL ONE
                                                         PAIR W/G




B – Main panel requires 2 spaces or one (1) double-pole, 100 amp, 240 volt breaker position.



                                                                                         MAIN
    SEISCO                                                                                                     OPTION
                                  (TWO PAIRS OF) #8 CU AWG
     RA-18                        WITH GROUND                                       40            40                A


A – Main panel requires 4 spaces or two (2) double-pole, 40 amp, 240 volt breaker positions.

                                            SUBPANEL
                                                         #4 CU AWG                       MAIN
                                                        ONE PAIR W/G                                           OPTION
    SEISCO                                        40
     RA-18                      #8 CU                                               75                             B
                                                  40       or #2 AL
                                                         or #3 AL ONE
                                                          PAIR W/G



B – Main panel requires 2 spaces or one (1) double-pole, 75 amp, 240 volt breaker position.
                                                                                                                  15
                                                       SEISCO Product Guide – Electrical Requirements (Version 11.03)


E1. SEISCO® Electrical Wiring & Breaker Guide* (RA-14, 11 & 9)
    (* For Nominal 240 Volt Electrical Service)




                                                                                       MAIN

   SEISCO                                                                                                    OPTION
  RA-14                          (TWO PAIRS OF) #8 CU AWG
                                       WITH GROUND
                                                                                    30            30              A


A – Main panel requires 4 spaces or two (2) double-pole, 30 amp, 240 volt breaker positions.

                                        SUBPANEL                                         MAIN
                                                         #6 CU AWG
                                                        ONE PAIR W/G                                         OPTION
                                                  30
  SEISCO
  RA-14                     #8 CU
                                                                                    60                           B
                                                  30      or #4 AL
                                                        ONE PAIR W/G




B – Main panel requires 2 spaces or one (1) double-pole, 60 amp, 240 volt breaker position.


                                 (ONE PAIR OF) #6 CU AWG                                 MAIN
                                 WITH GROUND
                                                                                                                ONLY
   SEISCO                                                                           50                         OPTION
  RA-11




RA-11       Main panel requires 2 spaces or one (1) double-pole, 50 amp, 240 volt breaker positions.




                                    (ONE PAIR OF) #8 CU AWG                              MAIN
                                         WITH GROUND                                                              ONLY
   SEISCO
                                                                                    40                           OPTION
   RA-9




RA-9      Main panel requires 2 spaces or one (1) double-pole, 40 amp, 240 volt breaker position.

                                                                                                                  16
                                                                SEISCO Product Guide – Electrical Requirements (Version 11.03)


   E1. SEISCO® Wiring & Breaker Guide* (Model RA-28)
         (* For Nominal 240 Volt Electrical Service)



Under the 2002 Edition of the National Electric Code (NEC), article 422.11(f)(3), water heaters and steam boilers employing
resistance-type immersion electric heating elements contained in an ASME-rated and stamped vessel or listed instantaneous
water heaters shall be permitted to be subdivided into circuits not exceeding 120 amperes and protected at not more than 150
amperes.
As a result, U.L. has given authorization to Microtherm, Inc., under U.L. Standard 499, to use their U.L. marking on the
SEISCO® model RA-28 for connections to two (2) 60 Amp branch circuits instead of the four (4) 30 Amp branch circuits, as
was previously required.

The wiring guide on this page illustrates two new wiring options for the RA-28. In accordance with NEC 422.11(f)(3), two 60
Amp branch circuits are shown connected to the RA-28 directly from the Main Service Panel in the Option A diagram below.
In Option B, two 60 Amp branch circuits are shown connected to the RA-28 directly from a sub-panel downstream from the
Main Service Panel.

                                                - - - CAUTION - - -
  Before using this two circuit option for the RA-28 Model, check with the Manufacturer to make sure
  that either the jumpers have been installed on the control board at the factory or they have been
  ordered or shipped with the unit. There should be four jumpers, 4 inches in length, 2 red and 2 black.

                                              #6 CU AWG ONE
                                              PAIR W/Ground                                       MAIN


         SEISCO                                                                              60            60         OPTION
          RA-28
                                                #6 CU AWG ONE
                                                PAIR W/Ground
                                                                                                                           A


   A – Main panel requires 4 spaces or two (2) double-pole, 60 amp, 240 volt breaker positions.
   Breaker lugs must have 75 deg C rating from main panel. A 200 AMP MAIN SERVICE IS
   RECOMMENDED.


                                              SUBPANEL
                                                                                                  MAIN

         SEISCO                                        60
                                                                 #1 CU AWG                                            OPTION
                                  #6 CU                         ONE PAIR W/G
          RA-28                  AWG TWO
                                   PAIR
                                                                                           125
                                                                                                                          B
                                 W/Ground                        or #2/0 AL
                                                       60       ONE PAIR W/G



   B – Main panel requires 2 spaces or one (1) double-pole, 125 amp, 240 volt breaker position.
   Breaker lugs must have 75 deg C rating to feed sub-feed, from main panel. A 200 AMP MAIN
   SERVICE IS RECOMMENDED.




                                                                                                                           17
                                                                 SEISCO Product Guide – Electrical Requirements (Version 11.03)


   E1. SEISCO® Electrical Wiring & Breaker Guide* (Model RA-14)
         (* For Nominal 240 Volt Electrical Service)


Under the 2002 Edition of the National Electric Code (NEC), article 422.11(f)(3), Water heaters and steam boilers employing
resistance-type immersion electric heating elements contained in an ASME-rated and stamped vessel or listed instantaneous
water heaters shall be permitted to be subdivided into circuits not exceeding 120 amperes and protected at not more than 150
amperes.

As a result, U.L. has given authorization to Microtherm, Inc., under U.L. Standard 499, to use their U.L. marking on the
SEISCO® model RA-14 for connections to one (1) 60 Amp branch circuit instead of the two (2) 30 Amp branch circuits, as
was previously required.

The wiring guide on this page illustrates the new wiring option for the RA-14. In accordance with NEC 422.11(f)(3), one 60
Amp branch circuit is shown connected to the RA-14 directly from the Main Service Panel in the diagram below.




                                                       - - - CAUTION - - -

  Before using this one circuit option for the RA-14 Model, check with the Manufacturer to make sure
  that the jumpers have been installed on the control board at the factory or they have been ordered or
  shipped with the unit. There should be two jumpers, 4 inches in length, 1 red and 1 black.




                                              #6 CU AWG
                                                                                                   MAIN
                                        ONE PAIR WITH GROUND                                                             OPTIONAL
       SEISCO                                                                                 60                            ONE
       RA-14
                                                                                                                          CIRCUIT
                                                                                                                          METHOD



   RA-14         Main panel requires 2 spaces or one (1) double-pole, 60 amp, 240 volt breaker positions.




                                                                                                                            18
                                                       SEISCO Product Guide – Electrical Requirements (Version 11.03)



E2. SEISCO® Wiring & Breaker Guide* (SH-28)
    (* For Nominal 240 Volt Electrical Service)




                               1


                                                                                         MAIN
                               2


    SEISCO                                                                                                    OPTION
                                     (FOUR PAIRS OF) #8 CU AWG WITH                 40            40
     SH-28                     3                 GROUND                                                            A
                               4
                                                                                    40            40



A  – Main panel requires 8 spaces or four (4) double-pole, 40 amp, 240 volt breaker positions.
Breaker lugs must have a 75 deg C rating. A 200 AMP MAIN SERVICE IS RECOMMENDED.

                                        SUBPANELS
                                                         #6 CU AWG
                                                          ONE PAIR
                                                  40        W/G                          MAIN
                                                  40
                                                         #6 CU AWG                                           OPTION
    SEISCO                      #8 CU                     ONE PAIR
                                                                                    75            75
     SH-28
                                                  40
                                                            W/G                                                  B
                                                  40


B – Main panel requires 4 spaces or two (2) double-pole, 75 amp, 240 volt breaker positions.
Breaker lugs must have 75 deg C rating to feed sub-feed, from main panel. A 200 AMP MAIN
SERVICE IS RECOMMENDED.
                                           SUBPANEL


                                                  40                                     MAIN
                                                        #1 CU AWG
    SEISCO                                        40   ONE PAIR W/G                                          OPTION
                               #8 CU
     SH-28
                                                                                  150
                                                                                                                  C
                                                  40    or #2/0 AL
                                                       ONE PAIR W/G
                                                  40

C – Main panel requires 2 spaces or one (1) double-pole, 150 amp, 240 volt breaker position.
Breaker lugs must have 75 deg C rating to feed sub-feed, from main panel. A 200 AMP MAIN
SERVICE IS RECOMMENDED.




                                                                                                                  19
                                                       SEISCO Product Guide – Electrical Requirements (Version 11.03)



E2. SEISCO® Electrical Wiring & Breaker Guide* (SH-22 & SH-18)
    (* For Nominal 240 Volt Electrical Service)




                                                                                         MAIN

    SEISCO                                                                                                   OPTION
     SH-22
                                      (TWO PAIRS OF) #6 CU AWG
                                            WITH GROUND
                                                                                    60            60              A


A – Main panel requires 4 spaces or two (2) double-pole, 60 amp, 240 volt breaker positions.

                                        SUBPANEL          #3 CU AWG                      MAIN
                                                           ONE PAIR
                                                                                                             OPTION
                                                             W/G
    SEISCO                                        60
     SH-22                      #6 CU
                                                                                   120                           B
                                                  60    or #1 AL ONE
                                                         PAIR W/G




B – Main panel requires 2 spaces or one (1) double-pole, 120 amp, 240 volt breaker position.



                                                                                         MAIN
    SEISCO                                                                                                     OPTION
                                  (TWO PAIRS OF) #8 CU AWG
     SH-18                        WITH GROUND                                       50            50                A


A – Main panel requires 4 spaces or two (2) double-pole, 50 amp, 240 volt breaker positions.

                                            SUBPANEL
                                                         #4 CU AWG                       MAIN
                                                        ONE PAIR W/G                                           OPTION
    SEISCO                                        50
     SH-18                      #8 CU                                              100                             B
                                                  50       or #2 AL
                                                         or #3 AL ONE
                                                          PAIR W/G



B – Main panel requires 2 spaces or one (1) double-pole, 100 amp, 240 volt breaker position.
                                                                                                                  20
                                                       SEISCO Product Guide – Electrical Requirements (Version 11.03)


E2. SEISCO® Electrical Wiring & Breaker Guide* (SH-14, 11 & 9)
    (* For Nominal 240 Volt Electrical Service)




                                                                                       MAIN

   SEISCO                                                                                                    OPTION
  SH-14                          (TWO PAIRS OF) #8 CU AWG
                                       WITH GROUND
                                                                                    40            40              A


A – Main panel requires 4 spaces or two (2) double-pole, 40 amp, 240 volt breaker positions.

                                        SUBPANEL                                         MAIN
                                                         #6 CU AWG
                                                        ONE PAIR W/G                                         OPTION
                                                  40
  SEISCO
  SH-14                     #8 CU
                                                                                    75                           B
                                                  40      or #4 AL
                                                        ONE PAIR W/G




B – Main panel requires 2 spaces or one (1) double-pole, 75 amp, 240 volt breaker position.


                                 (ONE PAIR OF) #6 CU AWG                                 MAIN
                                 WITH GROUND
                                                                                                                ONLY
   SEISCO                                                                           60                         OPTION
  SH-11




SH-11       Main panel requires 2 spaces or one (1) double-pole, 60 amp, 240 volt breaker positions.




                                    (ONE PAIR OF) #8 CU AWG                              MAIN
                                         WITH GROUND                                                              ONLY
   SEISCO
                                                                                    50                           OPTION
   SH-9




SH-9      Main panel requires 2 spaces or one (1) double-pole, 50 amp, 240 volt breaker position.

                                                                                                                  21
                                                                SEISCO Product Guide – Electrical Requirements (Version 11.03)


   E2. SEISCO® Wiring & Breaker Guide* (Model SH-28)
         (* For Nominal 240 Volt Electrical Service)



Under the 2002 Edition of the National Electric Code (NEC), article 422.11(f)(3), water heaters and steam boilers employing
resistance-type immersion electric heating elements contained in an ASME-rated and stamped vessel or listed instantaneous
water heaters shall be permitted to be subdivided into circuits not exceeding 120 amperes and protected at not more than 150
amperes.
As a result, U.L. has given authorization to Microtherm, Inc., under U.L. Standard 499, to use their U.L. marking on the
SEISCO® model SH-28 for connections to two (2) 75 Amp branch circuits instead of the four (4) 40 Amp branch circuits, as
was previously required.

The wiring guide on this page illustrates two new wiring options for the SH-28. In accordance with NEC 422.11(f)(3), two 75
Amp branch circuits are shown connected to the SH-28 directly from the Main Service Panel in the Option A diagram below.
In Option B, two 75 Amp branch circuits are shown connected to the SH-28 directly from a sub-panel downstream from the
Main Service Panel.

                                                - - - CAUTION - - -
  Before using this two circuit option for the SH-28 Model, check with the Manufacturer to make sure
  that either the jumpers have been installed on the control board at the factory or they have been
  ordered or shipped with the unit. There should be four jumpers, 4 inches in length, 2 red and 2 black.

                                              #6 CU AWG ONE
                                              PAIR W/Ground                                       MAIN


         SEISCO                                                                              75            75         OPTION
          SH-28
                                                #6 CU AWG ONE
                                                PAIR W/Ground
                                                                                                                           A


   A – Main panel requires 4 spaces or two (2) double-pole, 75 amp, 240 volt breaker positions.
   Breaker lugs must have 75 deg C rating from main panel. A 200 AMP MAIN SERVICE IS
   RECOMMENDED.


                                              SUBPANEL
                                                                                                  MAIN

         SEISCO                                        75
                                                                 #1 CU AWG                                            OPTION
                                  #6 CU                         ONE PAIR W/G
          SH-28                  AWG TWO
                                   PAIR
                                                                                           150
                                                                                                                          B
                                 W/Ground                        or #2/0 AL
                                                       75       ONE PAIR W/G



   B – Main panel requires 2 spaces or one (1) double-pole, 150 amp, 240 volt breaker position.
   Breaker lugs must have 75 deg C rating to feed sub-feed, from main panel. A 200 AMP MAIN
   SERVICE IS RECOMMENDED.




                                                                                                                           22
                                                                 SEISCO Product Guide – Electrical Requirements (Version 11.03)



   E2. SEISCO® Electrical Wiring & Breaker Guide* (Model SH-14)
         (* For Nominal 240 Volt Electrical Service)


Under the 2002 Edition of the National Electric Code (NEC), article 422.11(f)(3), Water heaters and steam boilers employing
resistance-type immersion electric heating elements contained in an ASME-rated and stamped vessel or listed instantaneous
water heaters shall be permitted to be subdivided into circuits not exceeding 120 amperes and protected at not more than 150
amperes.

As a result, U.L. has given authorization to Microtherm, Inc., under U.L. Standard 499, to use their U.L. marking on the
SEISCO® model SH-14 for connections to one (1) 75 Amp branch circuit instead of the two (2) 40 Amp branch circuits, as
was previously required.

The wiring guide on this page illustrates the new wiring option for the SH-14. In accordance with NEC 422.11(f)(3), one 75
Amp branch circuit is shown connected to the SH-14 directly from the Main Service Panel in the diagram below.




                                                       - - - CAUTION - - -

  Before using this one circuit option for the SH-14 Model, check with the Manufacturer to make sure
  that the jumpers have been installed on the control board at the factory or they have been ordered or
  shipped with the unit. There should be two jumpers, 4 inches in length, 1 red and 1 black.




                                              #6 CU AWG
                                                                                                   MAIN
                                        ONE PAIR WITH GROUND                                                             OPTIONAL
       SEISCO                                                                                 75                            ONE
       SH-14
                                                                                                                          CIRCUIT
                                                                                                                          METHOD



   SH-14         Main panel requires 2 spaces or one (1) double-pole, 75 amp, 240 volt breaker positions.




                                                                                                                            23
                                                        SEISCO Product Guide – Electrical Requirements (Version 11.03)


F. Single and Three Phase Wiring Diagrams

Single-Phase Connections:

     The Seisco Water Heater was designed for single-phase, standard 220/240 VAC operation
on residential and light commercial electrical services. When properly connected, the load of the
Seisco is automatically balanced across both legs (or poles) of the service. It doesn’t matter how
many circuits the Seisco requires, the load will always be balanced on a single-phase service.

    However, the only way the Seisco will work properly, is with both distinct poles and legs
connected to each circuit. If the legs making up the circuit are from the same side of the service
bus, then they will cancel and the resultant voltage will be zero (0) volts instead of 220/240 volts.
This is usually referred to as “out-of-phase” or simply having the circuit wires crossed or out of
sequence. Refer to the Single-Phase Diagram that illustrates the correct connections to the
single-phase service in this section of the manual.

Three-Phase Connections to Single-Phase Heater:

      The Seisco heater will operate on 220/240 or 208 VAC three-phase systems that are
commonly used in commercial and industrial buildings. However, the Seisco heater will not
work on 480 volt three-phase or 277 VAC phase-to-ground services. In three-phase applications,
it is recommended to balance the Seisco load as much as possible, particularly, on 208 VAC wye
services.

     Since the Seisco has an even number of heating elements and associated circuits, the load
cannot be balanced evenly across a three-phase service. However, it is possible to spread the load
across the three phases so that all the load of the Seisco is not on one phase. Refer to the Three-
Phase Diagram, F3, that illustrates proper connections to the three-phase service in this section
of the manual.

    As shown in the diagram, F3, the Seisco RA-28 Water Heating Model requires four (4) 30
amp, double pole 220/240 or 208 VAC circuits. The Seisco SH-28 Space Heating Model
requires four (4) 40 amp, double pole 220/240 or 208 VAC circuits. The load of the four circuits
can be connected to each phase of a three-phase service. Six of the eight legs from the four
circuits can be distributed evenly across the three phases. The remaining two legs have to be
connected to two phases, leaving one phase out of balance. In some buildings with three-phase
service, there is a lighting load or single phase load that creates an imbalance anyway. So it may
be possible to spread the load of the Seisco to the non-lighting load phase, which will help
balance the load of the whole building.




                                                                                                                   24
                                               SEISCO Product Guide – Electrical Requirements (Version 11.03)


F1. Wiring connections to SINGLE PHASE 240 VAC supply:
                            SEISCO® Model RA-28
(Note: The SH-28 Model requires (four) double pole 40 amp circuits)
                                                                                              SINGLE PHASE
                                                                                                 SERVICE

                                                                                               A       B        N
SEISCO CONTROL BOARD                                         BREAKERS
                                          A
         #1               L1                                    30 AMP
      HEATING                      240                           DOUBLE
                                                                                       240
      ELEMENT                      Vac    B                       POLE
                                                                                       Vac
    CIRCUIT RY                                                  BREAKER
                          L2


                                                                         G
                                                                         G
                                          A
         #2               L1
      HEATING                                                   30 AMP
      ELEMENT                      240                           DOUBLE
                                   Vac                            POLE                 240
                                          B
    CIRCUITRY             L2                                    BREAKER                Vac




                                                                         G
                                          A
         #3               L1
      HEATING                                                   30 AMP
      ELEMENT                      240                           DOUBLE
                                   Vac                            POLE                 240
                                          B
    CIRCUITRY             L2                                    BREAKER                Vac




                                                                         G
         #4                               A
                          L1
      HEATING                                                   30 AMP
      ELEMENT                      240                           DOUBLE
    CIRCUITRY                      Vac    B                       POLE                 240
                                                                                       Vac
                          L2                                    BREAKER

                                   120        120
 GROUND                            Vac        Vac
   LUG        G

                                          G                        G                           A       B        N



N = NEUTRAL G = GROUND A = HOT LEG B = HOT LEG
L1 = PWER LUG #1       L2 = POWER LUG #2




                                                                                                           25
                                               SEISCO Product Guide – Electrical Requirements (Version 11.03)


F2. Wiring connections to SINGLE PHASE 240 VAC supply:
                          SEISCO® Model RA-28
                        (Optional 2-Circuit Supply)
(Note: The SH-28 Model requires (two) double pole 75 amp circuits)
                                                                                              SINGLE PHASE
                                                                                                 SERVICE

                                                                                               A       B        N
SEISCO CONTROL BOARD


     #1                   L1
  HEATING
  ELEMENT
CIRCUITRY                 L2         JUMPERS

                                                             BREAKERS

     #2                   L1              A                       60 AMP
  HEATING                                                        DOUBLE
  ELEMENT                          240                                                 240
                                   Vac                             POLE                Vac
CIRCUITRY                                                        BREAKER
                          L2              B



                                                                          G
     #3                   L1              A                       60 AMP
  HEATING                                                        DOUBLE
  ELEMENT                          240                                                 240
                                   Vac                             POLE                Vac
CIRCUITRY                                                        BREAKER
                          L2              B



                                                                          G
                                              120
     #4                                       Vac
  HEATING                 L1       120
  ELEMENT                          Vac

CIRCUITRY
                          L2


 GROUND
   LUG        G
                                          G
                                                                                               A       B        N
                                                                      G



N = NEUTRAL G = GROUND A = HOT LEG B = HOT LEG
L1 = LUG #1 L2 = LUG #2



                                                                                                           26
                                                 SEISCO Product Guide – Electrical Requirements (Version 11.03)



  F3. Wiring connections to 208 or 240 VAC THREE-PHASE supply:
                              SEISCO® Model RA-28
  (Note: The SH-28 Model requires (four) double pole 40 amp circuits)
                                                                                          THREE PHASE SERVICE
                                                                                          (PHASE DESIGNATION)

                                                                                                 A        B        C
   SEISCO CONTROL BOARD                                        BREAKERS
                                                  A
           #1               L1                                    30 AMP                              A
        HEATING                       208 OR      B
                                                                   DOUBLE
                                                                                         208 OR
        ELEMENT                       240 Vac                       POLE
                                                                                         240 Vac
      CIRCUITRY                                                   BREAKER
                            L2                                                                                 B

                                                                           G
                                                                           G
                                                 C
           #2               L1
        HEATING                                                   30 AMP                                               C
        ELEMENT                      208 OR                        DOUBLE
                                     240 Vac     A                  POLE
      CIRCUITRY             L2                                    BREAKER
                                                                                                      A


                                                                           G
                                                 B
           #3               L1
        HEATING                                                   30 AMP                                       B
        ELEMENT                      208 OR                        DOUBLE
                                     240 Vac                        POLE                 208 OR
                                                 C
      CIRCUITRY             L2                                    BREAKER                240 Vac
                                                                                                                       C


                                                                           G
           #4                                    A
                            L1
        HEATING                                                   30 AMP                              A
        ELEMENT                      208 OR                        DOUBLE
      CIRCUITRY                      240 Vac     B                  POLE                 208 OR
                                                                                         240 Vac
                            L2                                    BREAKER
                                                                                                               B
                                     120        120
   GROUND                            Vac        Vac
     LUG        G

                                                 G                   G                           A        B        C


                                                                                                     N
N = NEUTRAL G = GROUND A = HOT LEG B = HOT LEG C = HOT LEG
L1 = LUG #1 L2 = LUG #2




                                                                                                              27
                                               SEISCO Product Guide – Electrical Requirements (Version 11.03)



  F4. Wiring for THREE-PHASE Heater with 380 VAC supply:
                            SEISCO® Model RA-18-3
  (Note: The SH-18-3 Model requires (THREE) double pole 15 amp circuits)
                                                                                        THREE PHASE SERVICE
                                                                                        (PHASE DESIGNATION)

                                                                                               A        B        C
   SEISCO CONTROL BOARD                                      BREAKERS
                                                A
           #2              L1                                   10 AMP                              A
        HEATING                       380       B
                                                                 DOUBLE
                                                                                       380
        ELEMENT                       Vac                         POLE
                                                                                       Vac
      CIRCUITRY                                                 BREAKER
                           L2                                                                                B
       (6000W)
                                                                         G
                                                                         G
                                                C
           #3              L1
        HEATING                                                 10 AMP                                               C
        ELEMENT                       380                        DOUBLE
                                      Vac      A                  POLE                 380
      CIRCUITRY            L2                                   BREAKER                Vac
       (6000W)                                                                                      A


                                                                         G
                                                B
           #4              L1
        HEATING                                                 10 AMP                                       B
        ELEMENT                       380                        DOUBLE
                                      Vac                         POLE                 380
                                                C
      CIRCUITRY            L2                                   BREAKER                Vac
       (6000W)                                                                                                       C


                                                                         G




   GROUND
     LUG        G

                                                G                  G                           A        B        C


                                                                                                   N
N = NEUTRAL G = GROUND A = HOT LEG B = HOT LEG C = HOT LEG
L1 = LUG #1 L2 = LUG #2




                                                                                                            28
                                                            SEISCO Product Guide - Installation Guide (Version 11.03)




                              SEISCO®
          6      INSTALLATION GUIDE AND WARRANTY
                                      (13 pages – 381 KB)




      A. Mounting and Clearance Requirements

          1. Suggested Clearances

          2. HUD Rules for Manufactured Housing

      B. Plumbing Installation

          1. Plumbing Connections

          2. NO Temperature & Pressure Relief Valve Required

      C. Electrical Installation*

          1. Connection to Power Supply

          2. Functional Checks

      D. WARRANTY

          1. Residential Water Heater Models RA-28 thru RA-05

          2. Space Heater / Micro-boiler Models SH-28 thru SH-05

      E. Trouble Shooting Guide

      F. Service & WARRANTY Record




* Also refer to the “Electrical Service Requirements & Sample Residential Load Calculations”.

                                             1
                                                                   SEISCO Product Guide - Installation Guide (Version 11.03)


 A1.            SEISCO® MOUNTING CLEARANCES
          FRONT VIEW
                                                                  Horizontal Spacing**
         Two-Chamber Unit
                                                                                24 ”

                                                   12” *
                                                                        15 ¾ ”
             Models
              Rated         Screw
             5KW to         Holes
             14KW           14 ¾”

                                                                      FRONT
                                                                       VIEW                       Screw
                                                 15 ¾ ”               (Four-                      Holes
              Screw                                                  Chamber                      14 ¾ ”
              Holes
              10 7/8”                                                  Unit)


       SIDE VIEW

                                                                        Screw
                                                                        Holes
                                                                       16 1/8 ”

        Front
      Clearance                               Mounting
     (See Below)                               Wall
        ****                                                   Minimum Mounting
                                                               Height: 10 inches
                                                               above floor ***



                           6½”

                                                              FLOOR



*    Top Clearance : For removal of heating elements and to provide room for plumbing connections, a
minimum of 12 inches is required.

** Side clearance : Allow an overall minimum horizontal space for the heater of 24 inches for removal of
protective cover screws and access to electrical wires entering the heater from the side.

*** Mounting height : For safety, ease of installation and service, the suggested height above the floor is 42
to 48 inches, (minimum 10 inches). Do not install electrical disconnect or sub-panels below heater as this may
interfere with access to the clean out plates located under the heater.

**** Front Clearance : In the absence of a door or removal access panel in front of the heater, allow 32 to 36
inch clearance in front of the heater for protective cover removal and ease of service.


                                                      2
                                                                     SEISCO Product Guide - Installation Guide (Version 11.03)


A2.              HUD Rules for Manufactured Housing
Where to Install SEISCO® Water Heaters & Space Heaters

         The Seisco heater should be installed as specified in the Federal Manufactured Housing Construction
and Safety Standards (Standards). This was further clarified in a letter from HUD, dated Aug. 1, 2000.
         In summary, the Seisco heater can be installed in any room, including closets, alcoves, utility rooms,
and storage rooms, in which all walls and ceilings have a spread rating of 25 or less. Walls and ceilings
consisting of unpainted or painted 5/16 inch or greater gypsum board or 5/16 inch or greater tape/textured
gypsum board meet these flame-spread ratings. When installed in such a room, the Seisco can be mounted at
any convenient location and without any additional enclosure.
         If any of the walls or ceilings in a room have vinyl covered gypsum board, 5/16 inch or greater, the
room may not meet the flame spread index of 25 or less, for the purpose of installing the Seisco heater. If one or
more of the walls is paneling, the 25 or less flame-spread rating is not met. In these situations, the Seisco heater
can be installed if a surrounding enclosure is constructed of 5/16 inch or greater gypsum. Vinyl covered
gypsum board that is labeled with a flame-spread rating of 25 or less is acceptable to use in the heater
compartment without any additional enclosure.

Prevention of Storage

          When the Seisco heater is installed in a closet, storage room or similar room, the area surrounding the
appliance should be framed-in or guarded with noncombustible material such that the distance from the
appliance to the framing or guarding is not greater than 3 inches. (When clearance required by the listing is
greater than 3 inches, the guarding or framing shall not be closer to the appliance than the distance required by
the listing.)
Clearance spaces surrounding the Seisco heater are not required to be framed or guarded when:
          1. the space is specifically design for a clothes washer or dryer;
          2. dimensions surrounding the appliance do not exceed 3 inches; or
          3. the home manufacturer affixes either to the side of the storage area or closet containing the
              appliance, or to the appliance itself, in a clearly visible location, a 3”X5” adhesive backed plastic
              laminated label or the equivalent which reads as follows:

                                                “Warning”
This compartment is not to be used as a storage area. Storage of combustible materials or containers on or
near any appliance in this compartment may create a fire hazard. Do not store any materials or containers in
this compartment.

        All Seisco heaters shipped to Manufactured Home Builders will have a warning label as shown above
on the exterior of the heater.

Temperature and Pressure (T&P) Valves – SEISCO Water Heaters

        As of August 1, 2000, there is no longer a requirement to install a T&P Valve with the Seisco Water
Heater. The HUD letter recognizes and accepts the Underwriters Laboratories, Inc. (UL) Standard 499
endorsing the National Electrical Code (NEC) as an appropriate standard to the installation of valves for
temperature and pressure relief as mandated by Standard 3280.609(c). Since the Seisco Water Heater meets the
requirements of UL 499 and NEC as a Tankless Water Heater, there is no requirement for a T&P Valve when
the Seisco Water Heater is installed in a Manufactured Home.

Also see - Water Heater Controls, National Electrical Code, NEC, 422-47
FPN: See Relief Valves and Automatic Gas Shutoff Devices for Hot Water Supply Systems, ANSI Z21.22-986.




                                                        3
                                                                  SEISCO Product Guide - Installation Guide (Version 11.03)



B.                      PLUMBING INSTALLATION GUIDE

      NOTE: This water heater must be installed to meet the current National Electric Code,
and any applicable Local Plumbing, Electrical, Heating and Air Conditioning Codes.

                                                GENERAL

         Unpack the water heater from the shipping carton carefully. DO NOT CUT THE SHIPPING
CARTON WITH A SHARP INSTRUMENT. Stand the unit upright and remove the plastic wrap.
Locate the four (4) mounting holes in the metal back plate. Position the unit against the wall with the
two inlets and outlet fitting tubes pointed up toward the ceiling. Refer to Mounting Clearances in this
section of the manual. Make sure the unit is level and attach to the wall with ¼ inch or larger lag bolts
that are at least 1 ½ inches long. If attaching to sheet-rock or paneling, anchors or molly bolts should
be used to prevent the screws from pulling through the wall. If the water heater is to be installed on a
cinder block or concrete wall, attach a ½ or ¾ inch section of plywood (20” x 20 “ square) to the wall
first. Then use wood screws to attach the water heater to the plywood.

                            PROPERTY DAMAGE PROTECTION

     IF THE WATER HEATER IS INSTALLED IN ANY AREA WHERE LEAKAGE OF
THE TANK OR CONNECTIONS WOULD RESULT IN DAMAGE TO THE AREA
ADJACENT TO THE WATER HEATER, OR WHERE SUCH A LOCATION IS
UNAVOIDABLE, A SUITABLE DRAIN PAN OR FLOOR DRAIN WAS NOT INSTALLED
UNDER THE WATER HEATER.

     WHEN A DRAIN PAN MUST BE USED, THE PAN MUST MEET ALL APPLICABLE
PLUMBING CODES AND BE AT LEAST 1-1/2” DEEP, EXTENDING NOT LESS THAN 1”
ABOUT THE UNIT’S BASE PLATES, MUST PROTECT AN AREA AT LEAST 1-1/2”
GREATER THAN THE LOWER EXTERNAL DIMENSIONS OF THE WATER HEATER,
INCLUDE A SPLASH COVER FOR THE AREA OF ATTACHMENT TO THE WALL, AND
MUST BE PIPED BY 1” PIPE TO AN ADEQUATE DRAIN.

Exception: Drain Pan is not required in first floor installations in manufactured housing when the
home is manufactured under the HUD Standard.

                                   PLUMBING CONNECTIONS
ATTACHING WATER SUPPLY /

WARNING #1: Always use two wrenches when making any attachments of the water supply. Hold
the water heater’s inlet and outlet fittings secure while attaching the cold water and hot water lines.
Never attempt to attach water lines to the heater’s fittings without using a second wrench to hold the
fittings secure. The heater’s inlet and outlet fittings are designed to turn freely.

WARNING #2: Never solder water supply lines to the water heater’s fittings. Heat from the soldering
may damage the heat exchanger.

                                                     4
                                                                  SEISCO Product Guide - Installation Guide (Version 11.03)

WARNING #3: Do not use Plumber’s Putty or PVC/CPVC primer and glue on the threads of the
heater’s inlet and outlet fittings. Some of the putty compounds on the market are very aggressive and
could potentially dissolve the threads on the heater’s fittings. PVC/CPVC primer and glue will also
dissolve the threads on the heater’s fittings. Teflon Tape is the only sealer that should be used on the
threads of the inlet and outlet fittings.
                                              COLD                                                           COLD
            HOT                                                                        T&P
                                                                                      Valve
                                                            HOT




                     SEISCO                                                       SEISCO



         Above diagram shows approved                             Above diagram shows plumbing
         plumbing connections without                             connections with a T&P Valve if
         T&P Valve (T&P NOT REQUIRED                              required by local codes.
         BY MANUFACTURERER).


TEMPERATURE & PRESSURE VALVE/

        A temperature and pressure relief valve (T&P Valve) may be required by local code.
When a T&P valve is installed (which is not provided by the manufacturer), it should be checked after
the water supply to the heater is turned on. With the water supply on, there should be no water flowing
from the valve. Operate the valve manually two or three times to purge the trapped air from the top of
the heater’s chamber. CLOSE VALVE. Water should stop flowing completely prior to connecting the
drain piping to the valve.

SINCE THE SEISCO HEATER DOES NOT UTILIZE A STORAGE TANK, THE USE OF A
T&P RELIEF VALVE IS NOT REQUIRED BY MANY NATIONAL STANDARDS,
INCLUDING UL STANDARD 499. Seisco heaters are designed with control logic as well as
elctro-mechanical high limit thermostat switches for over-temperature protection. With these
built-in safety features, the use of a T&P Relief Valve is not required by the Manufacturer.

DRAIN PAN/

        If the Seisco heater is installed in an area where water damage can occur to the area adjacent to
the heater, a drain pan must be installed. The pan must be at least 1 ½ inches deep and large enough to
protect the area below the heater (the pan should be at least 1 ½ inches larger than the lower external
dimensions of the heater) and must be piped by 1 inch pipe to a suitable drain. A splash cover must be
included to protect the area of attachment to the wall.


NOTE: THIS HEATER MUST BE INSTALLED TO MEET THE CURRENT NATIONAL
ELECTRICAL CODE, AND ANY APPLICABLE LOCAL PLUMBING, ELECTRICAL, OR
HEATING AND AIR CONDITIONING CODES.

                                                     5
                                                                  SEISCO Product Guide - Installation Guide (Version 11.03)




C1.                ELECTRICAL INSTALLATION GUIDE

                              CONNECTION TO POWER SUPPLY
       WARNING: Installation and service must be by qualified personnel only!
NOTE: This unit must be installed to meet the current National Electric Code, and any
applicable local plumbing, electrical, heating and air conditioning codes.

Install wiring (see wiring diagram) from the unit to the Main Power Circuit Breaker Panel. Connect the wiring
to the unit as shown on the wiring diagram attached to the inside of the unit's cover.

                                                             MAIN POWER CIRCUIT BREAKER
                  WARNING
   MODELS RATED 14KW* THRU 28KW*
   REQUIRE   MULTIPLE     POWER SOURCES.
   WHEN WIRED DIRECTLY TO THE BREAKER
   BOX, THEY REQUIRE MORE THAN ONE
   DOUBLE POLE CIRCUIT BREAKER.

   RISK OF ELECTRICAL SHOCK. HEATING
   ELEMENT IS NOT GROUNDED. SOME UNITS
   HAVE     MULTIPLE  POWER     SUPPLIES.
   DISCONNECT ALL POWER SUPPLIES BEFORE
   SERVICING.

   IF USING STRANDED WIRE, MAKE SURE
   THAT ALL STRANDS ARE IN SECURE
   PLACEMENT IN THE TERMINAL BLOCK. A
   LOOSE STRAND IN CONTACT WITH THE
   CIRCUIT    BOARD     CAN      IMPAIR
   PERFORMANCE OR DAMAGE THE BOARD.


    HEATER SUPPLY SIDE CONNECTION

   FOR MODELS RATED 5KW THRU l1KW, ONE
   PAIR OF WIRES SHOULD BE ATTACHED
   WITHIN THE UNIT AT POWER CIRCUIT 1
   (CKT 1)-ONE WIRE TO L1 AND ONE WIRE TO
   L2. FOR MODELS 14KW* THRU 22KW, A
   SECOND PAIR OF WIRES MUST ALSO BE
   ATTACHED AT POWER CIRCUIT 2 (CKT2)-
   ONE TO Ll AND ONE TO L2. FOR MODEL
   RATED 28KW*, A THIRD AND FOURTH PAIR
   OF WIRES ARE REQUIRED FOR POWER
   CIRCUITS 3 AND 4 (CKT 3 & CKT 4).

   *NEC branch circuit rule has changed which allows          WHERE REQUIRED BY CODE, USE A
   the option to wire the 14KW unit with one 75 AMP           DISCONNECT SWITCH ADJACENT TO THE
   circuit and the 28KW unit with two 75 AMP                  WATER HEATER.    WHEN MAKING THIS
   circuits. Contact the manufacturer for jumpers that        TYPE OF INSTALLATION, BE SURE THE
   must be installed on the control board before using        MAIN   FEEDER   WIRES   USED  ARE
   these wiring options.                                      PROPERLY SIZED.

                                                         6
                                                                 SEISCO Product Guide – Installation (Version 11.03)


Install the proper size circuit breaker (see Product Specifications). Be sure that the unit-to-power supply circuits
are properly connected. For models rated 5KW thru 1lKW, the pair of feeders attached to power circuit 1 (CKT
1) should be attached to one 2-pole breaker, and for models rated 14KW* thru 22KW, the second pair attached
to power circuit 2 (CKT 2) should be attached to a second 2         -pole breaker such that the total load will be
balanced. For model rated 28KW*, two additional breakers are required for power circuits 3 and 4 (CKT 3 & 4).

       *NEC branch circuit rule has changed which allows the option to wire the 14KW unit with one 75 AMP
       circuit and the 28KW unit with two 75 AMP circuits. Contact the manufacturer for jumpers that must be
       installed on the control board before using these wiring options.

  PRE-POWER CHECK

1. After all electrical connections have been made, every effort should be made to verify a safe installation.
Again check to be sure all connections in the unit disconnect and/or circuit breaker panel are secure. Check to be
sure that an adequate ground has been properly connected. Check to be sure that adequate size breakers have
been installed properly. Remember that breakers that are too large are more dangerous than breakers that are too
small.

3. RUN WATER THROUGH THE UNIT UNTIL AIR IS PURGED.

  POWER CHECK

Check only after the Pre-Power Check has been completed and the unit filled with water. Turn on the Main
Power Circuit Breakers. Verify that the heater’s GREEN POWER-ON “FLASHING” indicator light is
illuminated.

USE EXTREME CAUTION WHEN CHECKING VOLTAGE TO THE UNIT.

Check the voltage available to each active power circuit. SEISCO models rated 5KW to 28KW are designed to
operate from a 208V to 240V power supply. Connect a voltmeter at power circuit 1 (CKT 1) between L1 and L2.
(For models with multiple power circuits utilized, continue to check voltage at each additional power circuit.)

  OPERATIONAL CHECKS

Turn water on MEDIUM-LOW utilizing any sink allowing water to run for a couple of minutes to ensure that
all air is purged from the unit. You will hear a "click" as the relays on the circuit board engage. It is normal to
hear a “hissing” or "crackling" noise from the heat exchanger after the unit is started. With the unit's cover
removed, verify with an ammeter that there is ELECTRICAL CURRENT through each heating element circuit.
DISREGARD THE WATER TEMPERATURE WHILE DOING THIS TEST.

TURN OFF FAUCETS after completing Operational Check.

Thermostat settings are factory preset for units employing a circuit board potentiometer (thermostat).

THIS INSTALLATION MUST BE DONE BY QUALIFIED AND LICENSED CONTRACTORS. Refer
to your local electrical, plumbing and HVAC codes for additional information.




                                                      7
                                                                  SEISCO Product Guide – Installation (Version 11.03)



C2.                              Functional Checks
After the initial start-up, following the Pre -Power and Operational Checks described in the Electrical
Installation section of this manual, it may be necessary to make adjustments to the system to insure that
the heater is functional and providing hot water.

Beeps & Flashing Lights – What do they Mean?
It is normal at start-up or any time the heater is powered-on for the control board to beep and the LED to
flash red and then green. Normal status of the heater is for the control to flash all green repeatedly. The
initial 2 to 4 red flashes and beeps after power-on are normal, but should not continue.

SEISCO Provides On-Board Self Diagnostics
However, in the event that the LED light continues to flash a red sequence after power-on, then there may
be a need for further investigation. The heater’s control provides self diagnostics by emitting a red
flashing code. The code definitions and possible solutions can be found in the Trouble Shooting section
of the Seisco Service Manual.

Some of the most common problems discovered during installation and initial start-up are as follows:
        •   Circuit breakers are not turned-on (especially, heaters with multiple circuits)

        •   Incoming power wires to the heater are out-of-phase (heaters with multiple circuits)

        •   Water supply valve not turned-on, no water or fluid in the heater chamber

        •   Water supply lines are reversed; hot and cold reversed

        •   Water supply connection(s) are leaking

        •   T&P Relief Valve (where required by local code) is leaking or stuck open


The Seisco Heater Alerts the User of Water Leaks!
Diagnostic codes are designed to tell the installer or user if there is a problem and what the problem might
be. Also, the heater has a built in alarm that will sound if there is water leaking onto the water heater,
possibly from a leaky water line connection or from a leaky T&P Relief Valve. Check equipment
connected nearby the heater for the possibility of leaks and spraying onto the heater’s control board. It is
important to turn off all of the circuit breakers and water supply to the heater whenever a leak is
detected to prevent possible damage to the control board. After the leak is discovered and repaired, it is
important to dry any moisture or water accumulation on the heater. This can be done with a standard
household hair dryer or dry towels. Any attempts to dry the heater should be done with all the power off
to the heater.




                                                        8
                                                                    SEISCO Product Guide – Installation (Version 11.03)


System Match – Faucets and Heater
When a Seisco water heater is selected for the home or building, the faucets should also be selected to
match the flow rating and temperature rise specifications of the heater. The Seisco water heater
specifications can be found in the Product Description and Specifications section of the Product Guide.
Sometimes, this is overlooked and the user discovers that the faucets in the home are a higher flow rate
than the design of the Seisco model(s) selected. In space heating, excessive flow can occur with too large
of a circulator pump or excessive system pressure or flow in the circulatory loop connected to the micro-
boiler. It may be necessary to reduce flow or select a model capable of matching the flow and temperature
rise required for your heating system.

Solutions for High Flow Applications
Another oversight may be the lifestyle of the user. For instance, if the user wants to take two showers at
the same time or run the washing machine and the bathtub at the same time, then the flow rate demands of
the water heater are increased, sometimes beyond the capability of the Seisco heater. Multiple Seisco
heaters are used for higher flow applications, such as for multiple task lifestyles, whirl pool and Jacuzzi
tubs and body spa showers as well. Refer to Product Applications and Diagrams section of the Product
Guide for recommended multiple Seisco heater arrangements. Note, it is important to evaluate the
electrical capacity of the home or building when selecting multiple Seisco heaters for a high flow
application. Refer to the Electrical Service Requirements and Sample Load Calculations section in the
Product Guide.

                   Typical Flow-Use Rates in Gallons per Minute (gpm)
         Fixture
          Type       Lavatory     Bathtub     Shower          Kitchen       Pantry         Laundry         Dish-
                                                                Sink         Sink            Sink         Washer
          Flow
          Rates      0.8 – 1.5   2.0 – 4.0    1.5 – 3.0       1.0 – 1.5    1.5 – 2.5      2.5 – 3.0      2.0 – 3.0



Temperature Adjustment
After the water heater / space heater has been installed and the operational checks are completed, the
output of the hot water can be measured and adjusted if necessary. The temperature-adjusting knob can be
found on the left side of the control board. The factory setting is usually between 118 and 122 degrees F.
The knob will usually be in the 2 to 3 o’clock position. Turning the knob to the left decreases the
temperature and turning it to the right increases the temperature.

Note: it is important to understand the effects of increasing the temperature above the factory setting as
follows:

1. A higher temperature setting could cause the heater to use more power, thus energy savings are
   reduced.
2. A higher temperature setting could increase the potential for scaling and sediment build-up.
3. The water heater or space heater may not achieve a higher temperature setting, if the flow rate is
   greater than its designed temperature rise capacity. Check to insure that the proper size model has
   been chosen for the application.




                                                          9
D1. LIMITED WARRANTY – RESIDENTIAL WATER HEATING
                              SEISCO Product Guide – Installation (Version 11.03)
                                              Models RA-05 though RA-28
Microtherm, Inc. warrants the tank and electronic circuit board of its residential water heaters against defects in materials and
workmanship for three (3) years. Model numbers, beginning with the letter “RA”, are classified as residential units. The tank as referred to
herein shall mean the body of the heat exchanger only and does not include component parts attached to the body of the heat exchanger
including but not limited to the heating elements, temperature sensors, pipe nipples, pressure relief valve, circuit board, TRIACS, and limit
thermostat. These component parts are covered under the “Limited Parts Warranty". This warranty begins on the date of original retail
purchase or, in the absence of proof of purchase verifying said date, from the date indicated by the serial plate affixed to the water heater;
provided, however, that use of this water heater for commercial, institutional, industrial, or other non-residential purposes shall limit the
maximum duration of this tank and electronic circuit board warranty to five (5) years from the date of original retail purchase. All
residential models, which are labeled with RA, are warranted for residential water heating applications only and are not
warranted for commercial and space heating applications.

In the event of a defect in materials or workmanship, Microtherm, Inc. will repair or replace free of charge any tank part or circuit board
found to be defective within a period of three (3) years from the date of original retail purchase. Microtherm, Inc. reserves the right to use
repaired or remanufactured parts and heaters when repair or replacement becomes necessary. During the first 90 days of this warranty,
Microtherm, Inc. will pay up to $65.00 for labor to install or replace any SEISCO part or component found to be defective in material or
workmanship. (CIRCUIT BOARD OR TANK REPLACEMENTS TO THE ORIGINAL PURCHASER, MADE AFTER THREE (3) YEARS
AND NOT LATER THAN TEN (10) YEARS FROM THE DATE OF THE ORIGINAL RETAIL PURCHASE WILL BE REPLACED BY
MICROTHERM, INC.) SUBJECT TO REPLACEMENT AND HANDLING CHARGES NOT TO EXCEED 15% OF THE
MANUFACTURER'S SUGGESTED RETAIL PRICE OF THE UNIT MODEL FOR WHICH THE CIRCUIT BOARD OR TANK WAS
ORIGINALLY INSTALLED, OR CURRENTLY SOLD COMPARABLE UNIT. This warranty does not include the cost, it any, of labor,
installation or freight charges incurred more than 90 days following the purchase of this unit.

LIMITED PARTS WARRANTY
Microtherm, Inc. warrants the other remaining component parts other than the tank and circuit board of the SEISCO heater to be free of
defects in materials and workmanship for a period of one (1) year from the date of original retail purchase or, in the absence of proof of
purchase verifying said date, from the date indicated on the serial plate affixed to the SEISCO heater. In the event that a part is defective,
Microtherm, Inc., at its option will repair or replace the part free of charge for the part itself. Microtherm, Inc. reserves the right to use
repaired or remanufactured parts when replacement is necessary. During the first 90 days of this warranty, Microtherm, Inc. will pay up to
$65.00 for labor on installation of any SEISCO part or component found to be defective in material or workmanship. After the first 90 days
following the purchase of this unit, no labor, installation, or freight charges, if any are included in this warranty.

EXCLUSIONS AND LIMITATIONS OF THESE LIMITED WARRANTIES
1) THE LIMITED WARRANTIES PROVIDED HEREIN ARE IN LIEU OF ANY AND ALL WARRANTIES, EXPRESSED OR IMPLIED,
    INCLUDING BUT NOT LIMITED TO IMPLIED WARRANTIES OF MERCHANTABILITY AND THE FITNESS FOR A PARTICULAR
    PURPOSE; PROVIDED, HOWEVER, THAT IMPLIED WARRANTIES ARE NOT DISCLAIMED DURING THE ONE YEAR PERIOD
    FROM THE DATE OF ORIGINAL RETAIL PURCHASE.
2) Microtherm, Inc., SHALL HAVE NO LIABILITY HEREUNDER, EITHER DIRECT OR CONTINGENT, FOR INCIDENTAL OR
    CONSEQUENTIAL DAMAGES. SOME STATES DO NOT ALLOW THE EXCLUSION OR LIMITATION OF INCIDENTAL OR
    CONSEQUENTIAL DAM         AGES, SO THE ABOVE LIMITATION OR EXCLUSION MAY NOT APPLY TO YOU.
3) This warranty gives you specific legal rights, and you may have other rights THAT vary from state to state.
    a) These warranties shall be void and have no effect.
    b) If the design or structure of the water heater is modified or altered in any way;
    c) If appliances or equipment not approved by Microtherm, Inc. are attached to the water heater;
    d) If the water heater is not properly installed in compliance with the latest issue of (1) the National Electric Code, (2) the
         applicable plumbing codes, (3) all local ordinances and regulations pertinent to similar water heaters, and (4) the installation
         guide and operational manual provided with the water heater;
    e) If nipples are exposed to PVC primer, petroleum based plumbing sealing compound.
    f ) If the water heater supply lines or fittings within 18” of the water heater have been soldered while connected to the water heater.
    g) If the water heater is not operated within the factory calibrated temperature limits;
    h) If leaks in the tank or defects in other parts arise as the result of improper use, improper installation, negligence in operation
         (such as elements burned out in a dry tank, etc.), failures resulting from sediment deposit or accident, or from inability of the
         water heater or any parts to function because of improperly made replacements and repairs, or damage by fire, floods, lightning,
         or any other act of God;
    i)   If the heating element or elements fail due to air entrapment;
    j)   If the serial plate has been altered or discarded and the purchase date cannot be verified with proof of purchase;
    k) IF THE WATER HEATER IS INSTALLED IN ANY AREA WHERE LEAKAGE OF THE TANK OR CONNECTIONS WOULD
         RESULT IN DAMAGE TO THE AREA ADJACENT TO THE WATER HEATER, OR WHER SUCH A LOCATION IS
         UNAVOIDABLE, A SUITABLE DRAIN PAN OR FLOOR DRAIN WAS NOT INSTALLED UNDER THE WATER HEATER.
         WHEN A DRAIN PAN MUST BE USED, THE PAN MUST MEET ALL APPLICABLE PLUMBING CODES AND BE AT LEAST
         1-1/2” DEEP, EXTENDING NOT LESS THAN 1” ABOUT THE UNIT’S BASE PLATES, MUST PROTECT AN AREA AT
         LEAST 1-1/2” GREATER THAN THE LOWER EXTERNAL DIMENSIONS OF THE WATER HEATER, INCLUDE A SPLASH
         COVER FOR THE AREA OF ATTACHMENT TO THE WALL, AND MUST BE PIPED BY 1” PIPE TO AN ADEQUATE
         DRAIN;
    l)   If the water heater or any of its components warranted herein are used other than as a part of the complete and integrated
         system as sold to the original purchaser;
    m) If leaks in the tank or defects in other parts occur as a result of the water heater containing or being operated with de-ionized
         water;
    n) If leaks in the tank or defects in other parts arise as a result of sizing that does not comply with the manufacturers currently
         published sizing recommendations.
5. Replacements and/or repairs furnished under warranty carry only the un-expired portion of the original warranty.
6. The terms of this warranty may not be varied by any person, whether or not purporting to represent or act on behalf of Microtherm,
   Inc.


                                                                   10
D2.            LIMITED WARRANTY for SPACE HEATING
                                SEISCO Product Guide – Installation (Version 11.03)

                                                 Models SH-05 through SH-28
Microtherm, Inc. warrants the tank and electronic circuit board of its space heater against defects in materials and workmanship for three
(3) years. Model numbers, beginning with the letter “SH”, are classified as space heating units. The tank as referred to herein shall mean
the body of the heat exchanger only and does not include component parts attached to the body of the heat exchanger including but not
limited to the heating elements, temperature sensors, pipe nipples, pressure relief valve, circuit board, TRIACS, and limit thermostat.
These component parts are covered under the “Limited Parts Warranty". This warranty begins on the date of original retail purchase or, in
the absence of proof of purchase verifying said date, from the date indicated by the serial plate affixed to the micro-boiler; provided,
however, that use of this micro-boiler for commercial, institutional, industrial, or other non-residential purposes shall limit the maximum
duration of this tank and electronic circuit board warranty to five (5) years from the date of original retail purchase. Space-heating
models, which are designated by “SH”, are not warranted for residential, commercial or industrial water heating applications.

In the event of a defect in materials or workmanship, Microtherm, Inc. will repair or replace free of charge any tank part or circuit board
found to be defective within a period of three (3) years from the date of original retail purchase. Microtherm, Inc. reserves the right to use
repaired or remanufactured parts and micro-boilers when repair or replacement becomes necessary. During the first 90 days of this
warranty, Microtherm, Inc. will pay up to $65.00 for labor to install or replace any part or component found to be defective in material or
workmanship. (CIRCUIT BOARD OR TANK REPLACEMENTS TO THE ORIGINAL PURCHASER, MADE AFTER THREE (3) YEARS
AND NOT LATER THAN TEN (10) YEARS FROM THE DATE OF THE ORIGINAL RETAIL PURCHASE WILL BE REPLACED BY
Microtherm, Inc.) SUBJECT TO REPLACEMENT AND HANDLING CHARGES NOT TO EXCEED 15% OF THE MANUFACTURER'S
SUGGESTED RETAIL PRICE OF THE UNIT MODEL FOR WHICH THE CIRCUIT BOARD OR TANK WAS ORIGINALLY INSTALLED,
OR CURRENTLY SOLD COMPARABLE UNIT. This warranty does not include the cost, it any, of labor, installation or freight charges
incurred more than 90 days following the purchase of this unit.

LIMITED PARTS WARRANTY
Microtherm, Inc. warrants the other remaining component parts other than the tank and circuit board of the micro-boiler to be free of
defects in materials and workmanship for a period of one (1) year from the date of original retail purchase or, in the absence of proof of
purchase verifying said date, from the date indicated on the serial plate affixed to the heater. In the event that a part is defective,
Microtherm, Inc., at its option will repair or replace the part free of charge for the part itself. Microtherm, Inc. reserves the right to use
repaired or remanufactured parts when replacement is necessary. During the first 90 days of this warranty, Microtherm, Inc. will pay up
to $65.00 for labor on installation of any part or component found to be defective in material or workmanship. After the first 90 days
following the purchase of this unit, no labor, installation, or freight charges, if any are included in this warranty.

EXCLUSIONS AND LIMITATIONS OF THESE LIMITED WARRANTIES
4) THE LIMITED WARRANTIES PROVIDED HEREIN ARE IN LIEU OF ANY AND ALL WARRANTIES, EXPRESSED OR IMPLIED,
    INCLUDING BUT NOT LIMITED TO IMPLIED WARRANTIES OF MERCHANTABILITY AND THE FITNESS FOR A PARTICULAR
    PURPOSE; PROVIDED, HOWEVER, THAT IMPLIED WARRANTIES ARE NOT DISCLAIMED DURING THE ONE YEAR PERIOD
    FROM THE DATE OF ORIGINAL RETAIL PURCHASE.
5) Microtherm, Inc., SHALL HAVE NO LIABILITY HEREUNDER, EITHER DIRECT OR CONTINGENT, FOR INCIDENTAL OR
    CONSEQUENTIAL DAMAGES. SOME STATES DO NOT ALLOW THE EXCLUSION OR LIMITATION OF INCIDENTAL OR
    CONSEQUENTIAL DAMAGES, SO THE ABOVE LIMITATION OR EXCLUSION MAY NOT APPLY TO YOU.
6) This warranty gives you specific legal rights, and you may have other rights THAT vary from state to state.
    a) These warranties shall be void and have no effect.
    b) If the design or structure of the micro-boiler is modified or altered in any way;
    c) If appliances or equipment not approved by Microtherm, Inc. are attached to the micro-boiler;
    d) If the micro-boiler is not properly installed in compliance with the latest issue of (1) the National Electric Code, (2) the applicable
         plumbing codes, (3) all local ordinances and regulations pertinent to similar micro-boilers, and (4) the installation guide and
         operational manual provided with the micro-boiler;
    e) If nipples are exposed to PVC primer, petroleum based plumbing sealing compound.
    f ) If the micro-boiler supply lines or fittings within 18” of the micro-boiler have been soldered while connected to the micro-boiler.
    g) If the micro-boiler is not operated within the factory calibrated temperature limits;
    h) If leaks in the tank or defects in other parts arise as the result of improper use, improper installation, negligence in operation
         (such as elements burned out in a dry tank, etc.), failures resulting from sediment deposit or accident, or from inability of the
         micro-boiler or any parts to function because of improperly made replacements and repairs, or damage by fire, floods, lightning,
         or any other act of God;
    i)   If the heating element or elements fail due to air entrapment;
    j)   If the serial plate has been altered or discarded and the purchase date cannot be verified with proof of purchase;
    k) IF THE MICRO-BOILER IS INSTALLED IN ANY AREA WHERE LEAKAGE OF THE TANK OR CONNECTIONS WOULD
         RESULT IN DAMAGE TO THE AREA ADJACENT TO THE MICRO-BOILER, OR WHER SUCH A LOCATION IS
         UNAVOIDABLE, A SUITABLE DRAIN PAN OR FLOOR DRAIN WAS NOT INSTALLED UNDER THE MICRO-BOILER.
         WHEN A DRAIN PAN MUST BE USED, THE PAN MUST MEET ALL APPLICABLE PLUMBING CODES AND BE AT LEAST
         1-1/2” DEEP, EXTENDING NOT LESS THAN 1” ABOUT THE UNIT’S BASE PLATES, MUST PROTECT AN AREA AT
         LEAST 1-1/2” GREATER THAN THE LOWER EXTERNAL DIMENSIONS OF THE MICRO-BOILER, INCLUDE A SPLASH
         COVER FOR THE AREA OF ATTACHMENT TO THE WALL, AND MUST BE PIPED BY 1” PIPE TO AN ADEQUATE
         DRAIN;
    l)   If the micro-boiler or any of its components warranted herein are used other than as a part of the complete and integrated
         system as sold to the original purchaser;
    m) If leaks in the tank or defects in other parts occur as a result of the micro-boiler containing or being operated with de-ionized
         water;
    n) If leaks in the tank or defects in other parts arise as a result of sizing that does not comply with the manufacturers currently
         published sizing recommendations.
5. Replacements and/or repairs furnished under warranty carry only the un-expired portion of the original warranty.
6. The terms of this warranty may not be varied by any person, whether or not purporting to represent or act on behalf of Microtherm,
   Inc.


                                                                   11
                                                                  SEISCO Product Guide – Installation (Version 11.03)



E.                        TROUBLESHOOTING GUIDE

          SYMPTOM                               POSSIBLE CAUSE                          CORRECTIVE ACTION


Hot water supply is warm but           FLOW is too high.*                            Reduce flow.
does not get HOT!
                                       ONE OF THE MAIN POWER                         Check power panel. Reset
                                       BREAKERS may be tripped.                      breaker if tripped.

                                       BAD Heating Element.                          Call local service contractor.**

                                       BAD Temperature Sensor.                       Call local service contractor.**


Hot water supply is COLD!              FLOW is too high.*                            Reduce flow.

                                       HIGH TEMPERATURE LIMIT                        Verify if Limit Switch is
                                       SWITCH may be tripped.                        tripped. Reset if tripped.

                                       ONE OF THE MAIN POWER                         Check power panel. Reset
                                       BREAKERS may be tripped.                      breaker if tripped.

                                       BAD Heating Element or                        Call local service contractor.**
                                       Temperature Sensor.

                                       CIRCUIT BOARD failure.                        Call local service contractor.**


Hot water supply temperature           FLOW is too high.*                            Reduce flow.
fluctuates.
                                       ONE OF THE MAIN POWER                         Check power panel. Reset
                                       BREAKERS may be tripped.                      breaker if tripped.

                                       BAD Heating Element.                          Call local service contractor.**

                                       BAD Temperature Sensor.                       Call local service contractor.**

 * Do not attempt to fill a large bathtub at full faucet flow. Tub faucets are designed to literally dump hot
 water from a storage tank heater to maximize the useful quantity available. You SEISCO® will fill a tub
 slightly slower, but you will continue to have hot water for as long as you wish to bathe. In space heating,
 excessive flow can occur with too large of a circulator pump or excessive system pressure or flow in the circulatory
 loop connected to the micro-boiler. It may be necessary to reduce flow or select a model capable of matching the
 flow and temperature rise required for your heating system.

 ** Check listings in your area for local Heating & Plumbing or Appliance Repair companies for labor estimates.
 Check for Warranty coverage on labor charges. For further assistance, call Microtherm, Inc. at 888-296-9293,
 Central Time, during regular business hours for available parts, diagnostics and repair information.

                                                       12
                                                              SEISCO Product Guide – Installation (Version 11.03)



F.              SERVICE & WARRANTY RECORD


 Purchased from: _____________________________________________________________


 Date of Purchase:______________________             Serial No.:___________________________


Your Name:___________________________

 Address:______________________________                  Phone:_____________________________

          ______________________________

          ______________________________



NOTES AND SERVICE




Your water heater or space heater can be serviced by most major brand authorized appliance repair or
heating and plumbing centers in your area. If your preferred service center does not already have service
information, Microtherm, Inc. will, upon request and with no charge, promptly fax the information to the
service center. For information regarding service companies in your immediate area you may contact your
original installer or Microtherm, Inc. at 800-355-4945.

                                           Microtherm, Inc.
                                             223 W. Airtex
                                           Houston, TX 77090
                                            (888) 296-9293




                                                    13
6(,6&23URGXFW0DQXDO ,QVWDOODWLRQ




                                 
                   6HLVFR3URGXFW*XLGH± &RVW&RPSDULVRQV9HUVLRQ


                    6(,6&2Š
               &RVW&RPSDULVRQV


$ ,1752'8&7,2172&267&203$5,6216

    7KH$YHUDJH$PHULFDQ+RPH

    1HZ+RPHYHUVXV([LVWLQJ+RPH,QVWDOODWLRQ

% 127(6$1'$668037,216

    /DEHODQGWKH5HDO:RUOG

    $GGLWLRQDO(QHUJ\&RVW(VWLPDWHVDQG,VVXHV

    6HLVFRKDV³1R+LGGHQ&RVWV´

    6HLVFR$OORZV<RXWR6DYH(QHUJ\DQG0RQH\7RR

     $VVXPSWLRQVWR&RVW&RPSDULVRQ7DEOHV

& &267&203$5,6217$%/(6

    7DEOH± (VWLPDWHG$QQXDO:DWHU+HDWLQJ&RVW&RPSDULVRQV

    7DEOH± (VWLPDWHG$QQXDO6WDQGE\&RVW&RPSDULVRQV

    7DEOH± (VWLPDWHG,QVWDOODWLRQ&RVW&RPSDULVRQV

    7DEOH± 6HLVFR(VWLPDWHG$QQXDO:DWHU+HDWLQJ&RVWV

    7DEOH± 6XPPDU\RI)LUVW<HDU&RVW&RPSDULVRQV




                                                                      
                                   6HLVFR3URGXFW*XLGH± &RVW&RPSDULVRQV9HUVLRQ


$ ,1752'8&7,2172&267&203$5,6216
        7KLVVHFWLRQSURYLGHVHVWLPDWHGFRVWFRPSDULVRQVIRUWKHLQVWDOODWLRQ DQG
RSHUDWLRQ RIWKH6(,6&2ZDWHUKHDWHULQQHZUHVLGHQWLDOKRPHV&RQYHQWLRQDOHOHFWULF
DQGJDVVWRUDJHWDQNKHDWHUVKDYHEHHQWKHVWDQGDUGLQQHZFRQVWUXFWLRQXQWLOWKHODWH
¶V6(,6&2¶VWHFKQRORJ\KDVRSHQHGWKHZD\IRUQHZGHVLJQRSWLRQVIRUDOOZDWHU
KHDWLQJDSSOLFDWLRQVLQFOXGLQJVSDFHKHDWLQJ7KHUHDUHDJUHDWPDQ\RWKHULVVXHVWKDWDUH
IDYRUDEO\LPSDFWLQJWKHDFFHSWDQFHDQGXVHRI6(,6&2W\SHHOHFWULFZDWHUKHDWLQJ
V\VWHPVLQFOXGLQJWKHFXUUHQWGHUHJXODWLRQRIHOHFWULFXWLOLWLHVLQWKH86DQGUDSLGO\
ULVLQJHQHUJ\FRVWV7KHFRVWLQFUHDVHLVSDUWLFXODUO\VLJQLILFDQWIRUKHDWHUVXVLQJQDWXUDO
JDV7KHJOREDOPRYHPHQWWRUHGXFHWKHEXUQLQJRIIRVVLOIXHOVLVH[SHFWHGWRFUHDWH
HQHUJ\VKLIWVDQGQHZWHFKQRORJLHV7KHVHLVVXHVDOWKRXJKYHU\VLJQLILFDQWDUHVREURDG
DQGFRPSOH[WKDWWKH\FDQRQO\EHQRWHGDWWKLVWLPH

   7KH$YHUDJH$PHULFDQ+RPH

         ,QWKHDYHUDJHHOHFWULFDOO\KHDWHGRUFRROHGKRPHWKHHOHFWULFVWRUDJHWDQNZDWHU
KHDWHULVWKHVHFRQGODUJHVWXVHURIHOHFWULFLW\UDQJLQJIURPWRRIWRWDOHQHUJ\
XVH,WLVWKHODUJHVWXVHURIHOHFWULFLW\LQKRPHVZLWKQRQHOHFWULFKHDW6(,6&2¶VHQHUJ\
HIILFLHQF\DQGWHFKQRORJ\JLYHVWKHKRPHRZQHUDQRSSRUWXQLW\WRVLJQLILFDQWO\UHGXFHWKH
RSHUDWLQJFRVWDQGHQHUJ\XVHIRUKRWZDWHU,QDGGLWLRQWKH6HLVFRKHDWHUSURYLGHV
QXPHURXVRWKHUEHQHILWVRYHUVWRUDJHWDQNKHDWHUVDVIROORZV

           E   $&RQWLQXRXVDQG(QGOHVV6XSSO\RI+RW:DWHU
           E   6SDFH6DYLQJV
           E   6DIHW\DQG+HDOWK%HQHILWV
           E   6PDUW7HFKQRORJ\
           E   1R0DLQWHQDQFH
           E   (QYLURQPHQWDO%HQHILWV

    1HZ+RPH9HUVXV([LVWLQJ+RPH,QVWDOODWLRQ

         'HVLJQLQJDQHZKRPHZLWKQHZWHFKQRORJ\FDQEHIXQDQGUHZDUGLQJ7KHFRVW
RILQVWDOOLQJQHZWHFKQRORJ\LQDQHZKRPH FDQDOVREHFRQWUROOHG7KHLQVWDOODWLRQFRVW
DWWKHWLPHRIFRQVWUXFWLRQFDQEHPDQ\WLPHV ORZHUWKDQWKHFRVWRILQVWDOOLQJWKHVDPH
WHFKQRORJ\LQDQH[LVWLQJKRPH$OWKRXJKWKLVLVQRWQHFHVVDULO\WUXHLQDOOFDVHVWKHUH
DUHDIHZIDFWRUVDQGYDULDEOHVWKDWDIIHFWWKHFRVWRIUHWURILWWLQJWKH6HLVFRKHDWHULQWRDQ
H[LVWLQJKRPH

        &RVWVRILQVWDOOLQJD6HLVFRKHDWHULQDQH[LVWLQJKRPH FDQYDU\JUHDWO\)RU
LQVWDQFHWKHSRVVLELOLW\RIUXQQLQJDGGLWLRQDOHOHFWULFDOFLUFXLWVWKURXJKILQLVKHGZDOOV
DQGFHLOLQJVFDQEHPRUHFRVWO\7KHVHDGGLWLRQDOFRVWIDFWRUVDUHJHQHUDOO\HOLPLQDWHG
GXULQJWKHFRQVWUXFWLRQSKDVHRIDKRPHEHFDXVHWKHHTXLSPHQWDQGODERUFRVWVFDQEH
DQWLFLSDWHG:LULQJDQGSOXPELQJIRUWKH6HLVFRKHDWHUFDQEHSODQQHGDKHDGWRDYRLG
ILVKLQJZLUHVDQGSLSHVWKURXJKILQLVKHGZDOOVDQGFHLOLQJV$OVRDSURSHUO\VL]HG
HOHFWULFDOVHUYLFHDQGWKHDSSURSULDWHHOHFWULFDOSDQHOFDQEHSODQQHGIRULQDGYDQFH7KH



                                                                                              
                                  6HLVFR3URGXFW*XLGH± &RVW&RPSDULVRQV9HUVLRQ


ORFDWLRQRIWKH6HLVFRKHDWHUFDQEHVHOHFWHGLQDQ\KRPH WRDOORZVKRUWHUSOXPELQJUXQV
DQGWKXVUHGXFHWKHFRVWGXHWRZDVWHZDWHU

% &267&203$5,6216127(6$1'$668037,216

        7KHFRQVXPHUFRQWLQXHVWRDVNIRUDEURDGUDQJHRIFRVWFRPSDULVRQVEHWZHHQWKH
6(,6&2VWRUDJHWDQNHOHFWULFKHDWHUDQGJDVZDWHUKHDWHUV2IWHQWKHFRQVXPHUZDQWV
WKHFRPSDULVRQVWRUHODWHWRWKHVWDWHPHQWVRIWKH³(VWLPDWHG(QHUJ\&RVW´DVVKRZQRQ
WKHVWRUDJHWDQNZDWHUKHDWHUODEHOV

   7KH/DEHODQGWKH5HDO:RUOG6RPHWLPHV'LIIHU

        ,W¶VLPSRUWDQWWKDWWKHFRQVXPHUXQGHUVWDQGWKDWODEHOLQJLVUHTXLUHGIRUFHUWDLQ
DSSOLDQFHVWRFRQIRUPWRWKH(QHUJ\3ROLF\DQG&RQVHUYDWLRQ$FW7HVWVKDYHEHHQ
GHYHORSHGWRHVWLPDWHWKHHQHUJ\HIILFLHQF\DQGFRVWRIRSHUDWLRQVIRUFHUWDLQFODVVHVRI
ZDWHUKHDWHUV:KLOHWKHWHVWSURWRFROLVLQWHQGHGWRSURYLGHDPHWKRGIRUDIDLUPHDQVRI
HQHUJ\FRVWFRPSDULVRQVWKHSDUDPHWHUVDQGSURWRFROIRUWKHVHWHVWVKDYHEHHQ
TXHVWLRQHGRUFKDOOHQJHG7KHSUREOHPZLWKXVLQJVXFKFRPSDULVRQVLVWKDWWKHWHVWLQJ
KDVEHHQHVWDEOLVKHGXQGHUVSHFLILFODERUDWRU\FRQGLWLRQVPRVWRIZKLFKFDQDQGGRYDU\
VXEVWDQWLDOO\LQDFWXDODSSOLFDWLRQV0RVWLPSRUWDQWLVWKHIDFWWKDWVRPHYDULDWLRQVLQ
DFWXDODSSOLFDWLRQZLOOHIIHFWWKHHQHUJ\HIILFLHQF\DQGRSHUDWLQJFRVWVRIRQHFODVVRI
ZDWHUKHDWHUPRUHWKDQDQRWKHU9HU\RIWHQWKHW\SHKHDWHUDQGLWVORFDWLRQUHVXOWLQ
VXEVWDQWLDOLQFUHDVHLQWKHDLUFRQGLWLRQLQJRUKHDWLQJFRVWVIRUWKHKRPH7KHIROORZLQJ
VHJPHQWVVHUYHDVH[DPSOHV

E 8QOLNHWKHODERUDWRU\WHVWFRQGLWLRQVWKH%78FRQWHQWIRUDWKHUP%78VRI
  QDWXUDOJDVZLOOYDU\IURPDUHDWRDUHD$UHDVZKRVHQDWXUDOJDVKDVDORZHU%78
  FRQWHQWWKDQXVHGLQWKHODERUDWRU\WHVWLQJZLOOFRQVXPHPRUHJDVDQGWKXVFRVWPRUH
  PRQH\KHDWLQJZDWHU

E 7KHLQFRPLQJZDWHUWHPSHUDWXUHIURPZKLFKWKH'2(WHVWFDOFXODWLRQVDUHEHLQJ
  PDGHKDVEHHQHVWDEOLVKHGDWG ),QPDQ\SDUWVRIWKH86RQHGRHVQRWQRUPDOO\
  H[SHULHQFH LQOHWZDWHUWHPSHUDWXUHVGHOLYHUHGWRWKHIL[WXUH WKLVFROG\HDU
  URXQG

E 7KHDPELHQWDLUWHPSHUDWXUHLQZKLFKWKHZDWHUKHDWHULVWHVWHGLVG )+RZHYHU
  WKHUHDUHPDQ\LQVWDOODWLRQVVXFKDVLQDFUDZOVSDFHLQDEDVHPHQWRUDWWLFZKHUH
  WKLVWHPSHUDWXUHGRHVQRWUHSUHVHQWDJHQXLQHDYHUDJHDPELHQWWHPSHUDWXUH

E 7KHVWRUDJHWDQNJDVKHDWHUKDVWREHYHQWHG6RORQJDVWKHKHDWHULVSODFHGRXWVLGH
  WKHOLYLQJDUHDRIWKHKRPHYHQWLQJGRHVQ¶WKDYHDQHJDWLYHHIIHFWRQRWKHUHQHUJ\
  FRVWV,QDYHU\ODUJHSHUFHQWDJHRIWKHKRPHVLQWKH86KRZHYHUJDVKHDWHUVDUH
  ORFDWHGLQWKHOLYLQJDUHDDQGDVVXFKDOORZFRQGLWLRQHGDLUDLUWKDWRQHKDVSDLGWR
  KHDWRUFRROWREHIRUFHGRXWRIWKHKRPH7KHFRQGLWLRQHGDLUWKDWLVORVWLV
  UHSODFHGE\LQILOWUDWLRQRI DLUGUDZQLQWRWKHKRPHIURPWKHRXWVLGHUHTXLULQJ
  DGGLWLRQDOKHDWRUDLUFRQGLWLRQLQJWRKHDWRUFRROWKLVRXWVLGHUHSODFHPHQWDLU


                                                                                              
                                 6HLVFR3URGXFW*XLGH± &RVW&RPSDULVRQV9HUVLRQ


   )XUWKHUPRUHDIXHOEXUQLQJZDWHUKHDWHUZLOOJLYHRIIFRQVLGHUDEOHKHDWWRWKHLQVLGH
   RIDKRPHE\YLUWXHRIWKHSLORWDQGWKHKRWYHQW7KHYHQWLWVHOIUHDFKHVWHPSHUDWXUHV
   RIG )DERYHWKHLQVLGHWHPSHUDWXUHRIWKHKRPH7KHHIIHFWRIWKHVHFRQGLWLRQV
   DGGVWRWKHKHDWLQJRUDLUFRQGLWLRQLQJFRVW7KHVHFRVWVDUHQRWDGGHGRUHYHQ
   HVWLPDWHGLQWKHHQHUJ\ODEHORQD JDVILUHGZDWHUKHDWHU,PDJLQHSXWWLQJD´KROHLQ
   \RXUURRIDQGSHULRGLFDOO\KHDWLQJDVL[IRRWSLSHWRG )IRUWKHKRXUVSHU
   GD\\RXUZDWHUKHDWHULVKHDWLQJLQXVHRUUHFRYHU\7KLVKROHLQWKHURRILV
   DSSUR[LPDWHO\HTXLYDOHQWWRD´ZLQGRZOHIWRSHQRQHKDOILQFKKRXUVDGD\
   GD\VD\HDU

   $GGLWLRQDO(QHUJ\&RVW(VWLPDWHVDQG,VVXHV

        7KH(QHUJ\&RQVHUYDWLRQ'HSDUWPHQWRIWKH&DOLIRUQLD(QHUJ\&RPPLVVLRQ
SUHSDUHGDSDSHURQJDVZDWHUKHDWLQJFRVWV7KH\GHYHORSHGDVSUHDGVKHHWSURJUDPIRU
HVWLPDWLQJWKHRSHUDWLQJFRVWVIRUJDVVWRUDJHWDQNZDWHUKHDWHUVORFDWHGRXWVLGHWKH
KRPHDQGQRWLQDFRQGLWLRQHGVSDFH7KHSURJUDPDVVXPHVDKRXVHKROG XVLQJ
JDOORQVRIKRWZDWHUGDLO\'2(GDLO\HVWLPDWHGKRWZDWHUXVDJHSHUKRXVHKROG:LWK
QDWXUDOJDVFRVWFXUUHQWO\DWSHUWKHUPRIJDVWKHHVWLPDWHGRSHUDWLQJFRVWVIRUD
JDOORQJDVWDQNKHDWHULVRYHUSHU\HDU

       2IFRXUVHKRXVHKROGVDUHPDGHXSRIGLIIHUHQWVL]HIDPLOLHVWKDWXVHYDULRXV
DPRXQWVRIKRWZDWHU7KHDPRXQWRIKRWZDWHUXVHGLPSDFWVWKHHQHUJ\FRVWSHU
KRXVHKROG$YHUDJHKRWZDWHUFRQVXPSWLRQ¶VIRUYDULRXVVL]HKRXVHKROGVDFFRUGLQJWR
)HGHUDO$JHQFLHVDUHDVIROORZV

               SHUVRQ WRJDOORQVGD\
               SHRSOH WRJDOORQVGD\
               SHRSOH WRJDOORQVGD\
               SHRSOH WRJDOORQVGD\

   6(,6&2+DV1R+LGGHQ&RVWV

        ,QUHDOLW\GHSHQGLQJXSRQWKHFOLPDWHDQGZDWHUWHPSHUDWXUHVDFWXDOZDWHU
KHDWLQJFRVWVIRUDJDOORQJDVKHDWHUFRXOGEHOHVV WKDQ RUPRUH WKDQSHU
\HDUHYHQZLWKRXWLQFOXGLQJWKHLPSDFWRIYHQWDQGVWDFNORVVRQVSDFHKHDWLQJDQGDLU
FRQGLWLRQLQJ&RQVHUYDWLYHFDOFXODWLRQVIRUWKHDGGLWLRQDOFRVWUHODWHGWRWKHORVVRI
FRQGLWLRQHGDLUVKRZDFRVWH[FHHGLQJDQDGGLWLRQDOSHU\HDU

         7KHHQHUJ\HIILFLHQF\$)8(DVWKHFRQVXPHUXQGHUVWDQGVWKHWHUPIRUPRVW
FRPPRQO\LQVWDOOHGHOHFWULFVWRUDJHWDQNKHDWHUVLVDSSUR[LPDWHO\7KHVDPH
HIILFLHQF\IRUDFRPSDUDEOHVWDQGDUGJDVILUHGZDWHUKHDWHULV7KHHIILFLHQF\IRUD
6(,6&2³IORZWKURXJK´ZDWHUKHDWLQJV\VWHPLVRYHU,QDVWXG\ZDVGRQH
E\DQLQGHSHQGHQWFRQVXOWLQJILUPLQ&ROOHJH6WDWLRQ7H[DVWRFRPSDUHWKHRSHUDWLQJ
FRVWVRIDQHZJDOORQVWRUDJHWDQNHOHFWULFZDWHUKHDWHUZLWKWKHFRVWRIWKH6(,6&2


                                                                                           
                                  6HLVFR3URGXFW*XLGH± &RVW&RPSDULVRQV9HUVLRQ


7KHWHVWZDVGRQHLQ-DQXDU\ RIO7KHUHVXOWVRIWKLVZLQWHUWHVWLQGLFDWHGD
PRQWKO\FRVWIRUKHDWLQJZDWHUZLWKWKH6(,6&2LQWKLVFLW\GXULQJWKHPRQWKRI
-DQXDU\WREHOHVVWKDQDQGDVDYLQJVRYHUWKHJDOHOHFWULFVWRUDJH
WDQNZDWHUKHDWHU
        *DVZDWHUKHDWHUVEHFRPHOHVVHIILFLHQWZLWKXVHSDUWLFXODUO\LQDUHDVRI
KDUGZDWHU6FDOHEXLOGVXSRQWKHZDOOVRIWKHWDQNVDQGPLQHUDOGHSRVLWVFROOHFWDWWKH
ERWWRPRIWKHWDQNERWKDFWLQJDVLQVXODWLRQUHGXFLQJWKHHIILFLHQF\IRUWKHWUDQVIHURI
KHDWIURPWKHEXUQHUWRWKHZDWHU

   6(,6&2$OORZV<RX7R6DYH(QHUJ\DQG:DWHU722

        6WXGLHVKDYHLQGLFDWHGDQRUPDOKRXVHKROGZLOOGUDZYDU\LQJDPRXQWVRIKRW
ZDWHUWXUQLQJWKHIDXFHWRIIDQGRQRYHUWLPHVGDLO\7KHQRUPDOIORZUDWHIURPD
IDXFHWGUDZLQJKRWZDWHULVHVWLPDWHGDWJDOORQVSHUPLQXWH7KHUHDUHREYLRXVO\
WLPHVDQGXVHVVXFKDVWKHZDVKLQJPDFKLQHZKHQWKLVGUDZLVKLJKHU$WWKLVQRPLQDO
IORZUDWHDVVXPLQJDZDLWIRUWKHKRWZDWHURIDQDYHUDJH RIRQO\VHFRQGVRQHKDOID
JDOORQRIZDWHULVZDVWHG7KHWRWDOKRWZDWHUZDVWHGGDLO\IRUVXFKGUDZVZRXOG
EHDWOHDVWJDOORQV$JUHDWPDQ\KRXVHKROGVSHRSOHH[SHULHQFHPXFKORQJHUZDLWV
DQGWKHUHIRUHPRUHKRWZDWHULVZDVWHGSDUWLFXODUO\LQWKHZLQWHU

        ,WKDVEHHQGHWHUPLQHGE\LQGHSHQGHQWVRXUFHVWKDWDQDYHUDJHKRXVHKROGZLOO
ZDVWHDSSUR[LPDWHO\JDOORQVRIZDWHUSHU\HDUUXQQLQJGRZQWKHGUDLQZKLOHWKH
RFFXSDQWVZDLWIRUKRWZDWHU.HHSLQPLQGWKDWWKHZDWHU\RXGUDZRXWRIWKHKRWZDWHU
IDXFHWZDVRULJLQDOO\GHOLYHUHGIURPWKHZDWHUKHDWHU$WRQHWLPHWKLVVDPHZDWHUKDG
EHHQKHDWHGRQO\WRODWHUFRROGRZQLQDORQJUXQRISLSHV%\ORFDWLQJWKH6(,6&2
FHQWUDOWRWKHPDMRUSRLQWVRIXVHWKHHVWLPDWHGUHGXFWLRQLQZDVWHGKRWZDWHULV
EHLQJJDOORQVSHU\HDUDQGDOPRVWJDOORQVSHUGD\7KHFRVWWRKHDWWKLV
JDOORQVRIZDWHUIURPG )WRG )LQDQHOHFWULFVWRUDJHWDQNKHDWHUHIILFLHQW
DWN:KLV7KHVDYLQJVZKLFKDUHHVWLPDWHGLQWKHIROORZLQJFRPSDULVRQV
EHWZHHQ WKHHVWLPDWHGFRVWRIYDULRXVW\SHVRIZDWHUKHDWHUVLQFOXGHVDQHVWLPDWHRIRQO\
JDOORQVVDYHGDVDUHVXOWRIRQH¶VDELOLW\WRORFDWHWKH6(,6&2FHQWUDOWRWKHPDMRU
SRLQWVRIKRWZDWHUXVDJH

   $VVXPSWLRQVWR&RVW&RPSDULVRQV7DEOHV

       7KHIROORZLQJWDEOHVDUHLQWHQGHGWRUHSUHVHQWDIDLUFRPSDULVRQIRUWKH
HVWLPDWHRIWKHFRVWRIKHDWLQJZDWHUWKURXJKWKHXVHRID6(,6&2DJDOORQHOHFWULFD
JDOORQQDWXUDOJDVDQGJDOORQ/3*VWRUDJHWDQNKHDWHUV7KHDVVXPSWLRQVDUHDV
IROORZV

¾ 7KH\HDUO\DYHUDJHWHPSHUDWXUHIRUWKHLQFRPLQJZDWHULVG )
¾ 7KHKRWZDWHUWHPSHUDWXUHLVVHWIRUWKH6(,6&2DWG )FRQWLQXRXV
¾ 7KHVWRUDJHWDQNKHDWHUVKDYHDFDSDFLW\RIJDOORQV
¾ 7KHVWRUDJHWDQNKHDWHUVDUHVHWDWG )ZKHUHWKHPDMRULW\RIXVHUVVHWWKHP



                                                                                              
                                   6HLVFR3URGXFW*XLGH± &RVW&RPSDULVRQV9HUVLRQ


¾ 8WLOLW\FRVWVDUHEDVHGRQN:KWKHUP1DW*DVDQG
   JDOIRU/3*
¾ $FDOFXODWLRQRIDFRQVHUYDWLYHHVWLPDWHRIWKHLPSDFWVWDFNYHQWORVVHVDVZHOODV
   FRPEXVWLRQDLUUHTXLUHPHQWVWRDGGLWLRQDOKHDWLQJDQGDLUFRQGLWLRQLQJFRVWV
   DGGLWLRQDOKHDWLQJRUFRROLQJFRVWV$+&UHVXOWLQJIURPORFDWLQJDJDVVWRUDJH
   WDQNKHDWHUZLWKLQWKHKRPHVFRQGLWLRQHGDLUVSDFHEDVHPHQW
¾ 7KHKRWZDWHUFRQVXPHGGDLO\LVVKRZQ
   N   ,QLWLDOO\DWJDOIRUHDFK
   N   JDOIRUWKH6(,6&2UHIOHFWLQJWKHJDOORQVSHUGD\HVWLPDWHGKRWZDWHU
       VDYLQJVWKDWFDQEHREWDLQHGIURPWKHDELOLW\WRORFDWHWKH6(,6&2ZLWKLQWKH
       OLYLQJVSDFHFHQWUDOHTXDOGLVWDQWWRWKHPDMRUSRLQWVRIXVH
   N   7KHQDWJDOGDLO\IRUHDFKGHPRQVWUDWLQJWKDWWKHUHGXFWLRQLQJDOORQVRIXVH
       GRHVQRWSURYLGHWKHVDPHSHUFHQWDJHVDYLQJVIRUDVWRUDJHWDQNJDVZDWHU
       KHDWHUHIIDVLWGRHVIRUHOHFWULFHII7KHUHDVRQLVVLPSO\WKH
       LQKHUHQWO\KLJKHUVWDQGE\ORVVHVIRUWKHJDVKHDWHULUUHVSHFWLYHRIYROXPHRIKRW
       ZDWHUFRQVXPSWLRQ




                                                                                             
                                6HLVFR3URGXFW*XLGH± &RVW&RPSDULVRQV9HUVLRQ


                                       7$%/(

                    &203$5,6212)(67,0$7('$118$/
                         :$7(5+($7,1*&2676
127( (VWLPDWHG&RVWVDUH%DVHGRQ1RUPDO8VDJH862SHUDWLQJFRVWZLOOYDU\
EDVHGRQPDQ\IDFWRUVLQFOXGLQJWKHORFDOFRVWIRUHOHFWULFLW\RUJDVWKHLQVWDOODWLRQ
ORFDWLRQDQGVL]HRIWKHVWRUDJHWDQNKHDWHUDQGWRWDOKRWZDWHUXVH

                            6HLVFR      (OHFWULF        1DWXUDO*DV             /3*
                            5$         67               67                 67
  &DSDFLW\                   1$       JDOORQ    JDOJDO   JDOORQ
  'DLO\8VDJH            JDOORQV   JDOORQV   JDOJDO   JDOORQV
  $QQXDO&RVWRI+RW                       
  :DWHU8VDJH86
  $+&
                                           
  7RWDO2SHUDWLQJ&RVW                     

  'DLO\8VDJH            JDOORQV   JDOORQV   JDO JDO       JDOORQV
  $QQXDO&RVWRI+RW                       
  :DWHU8VDJH86
  $+&
                                           
  7RWDO2SHUDWLQJ&RVW                     

  'DLO\8VDJH            JDOORQV   JDOORQV   JDOJDO   JDOORQV
  $QQXDO&RVWRI+RW                       
  :DWHU8VDJH86
  $+&
                                           
  7RWDO2SHUDWLQJ&RVW                     


$+&UHIHUVWRDGGLWLRQDOKHDWLQJDQGFRROLQJFRVWVDVVRFLDWHGZLWKWKHVWDFNRU
YHQWORVVRIFRQGLWLRQHGDLU


                                       7$%/(

       (VWLPDWHG$QQXDO2SHUDWLQJ&RVWIRUHDFKW\SHLQWKH³6WDQGE\0RGH´
           %()25(7+(),567'5232):$7(5+$6%((186('

  6(,6&2N:KDWN:K««86
  JDOHOHFWULFVWRUDJHWDQN«««««
  JDOQDWXUDOJDVVWRUDJHWDQN«««
  JDOQDWXUDOJDVVWRUDJHWDQN«««
  JDO/3*JDVVWRUDJHWDQN««««


                                                                                          
                                   6HLVFR3URGXFW*XLGH± &RVW&RPSDULVRQV9HUVLRQ




                                          7$%/(

      (67,0$7(',167$//$7,21&267&203$5,6216%(7:((17+(
             6(,6&2$1'6725$*(7$1.7<3(+($7(56
                    1HZ5HVLGHQWLDO&RQVWUXFWLRQ 86


                     8QLW       7	3      (OHFWULFDO        *DV       9HQW	           7RWDO
                  ,QVWDOODWLRQ   'UDLQ      &LUFXLWV         &LUFXLW   5RRI-DFN

6HLVFR5$                      
                       

(OHFWULF
JDOORQ                      
                         
1DWXUDOJDV
JDOORQ                                                  
1DWXUDO*DV
JDOORQ
'LUHFW3RZHU
9HQWHGV\VWHP                  
                 
1DWXUDO*DV
JDOORQ                                               
1DWXUDO*DV
JDOORQ
'LUHFW3RZHU
9HQWHG6\VWHP                   
                

  
6HLVFR)RXU YROWFLUFXLWV#HDFK+HUHWKHFRVWRIWKHIRXU
  FLUFXLWVZDVHVWLPDWHGWREHORZHUWKDQLQWKHIROORZLQJHOHFWULFJDOORQWDQN
  KHDWHUEHFDXVHRIWKHORZFRVWRIPDWHULDODQGHDVHRIUXQQLQJWKHH[WUDFLUFXLWV

     (OHFWULF6WRUDJH7DQN$VLQJOH
     YROWFLUFXLW7\SLFDOSULFHIRUVLQJOHDPS
     FLUFXLW6DPHLVWUXHIRUDQHOHFWULFGU\HUFLUFXLW

     1DWXUDO*DVJDO'LUHFW3RZHU9HQWHG$VLQJOHYROWFLUFXLW

     1DWXUDO*DVJDO'LUHFW3RZHU9HQWHG6DPH




                                                                                           
                                6HLVFR3URGXFW*XLGH± &RVW&RPSDULVRQV9HUVLRQ




                                      7$%/(

           6(,6&2(67,0$7('$118$/23(5$7,1*&2676
                            )RU9DULRXV
       (/(&75,&5$7(6DQG180%(5RI+286(+2/'2&&83$176

127( (VWLPDWHG$QQXDO2SHUDWLQJ&RVWVDUHEDVHGRQDGHJUHH)WHPSHUDWXUH
ULVHDQGW\SLFDOKRPHFRQVWUXFWLRQZLWKDYHUDJHOHQJWKVRISOXPELQJDQGSLSH
LQVXODWLRQ7KHVHFRVWVGRQRWUHIOHFWORVVHVLQFXUUHGGXHWRQRQLQVXODWHGSLSHV
UXQQLQJXQGHUDFRQFUHWHVODERUSLSHVUXQQLQJXQGHUDKRPHZLWKDQRQLQVXODWHG
FUDZOVSDFH

 (OHFWULF      3HUVRQ       3HRSOH      $YJ+RPH      3HRSOH        3HRSOH
  5DWHV       JDOGD\   JDOGD\   JDOGD\   JDOGD\   JDOGD\
&HQWVSHU     $QQXDO       $QQXDO       $QQXDO       $QQXDO        $QQXDO
  N:K         2SHUDWLQJ     2SHUDWLQJ     2SHUDWLQJ     2SHUDWLQJ      2SHUDWLQJ
                  &RVW         &RVW         &RVW
          &RVW           &RVW
                                                                
                                                               
                                                              
                                                              
    
                                                       
                                                              
                                                             
                                                             
                                                             
                                                             
                                                             
                                                             


5HSUHVHQWVWKHQDWLRQDODYHUDJHIRUHOHFWULFUDWHV&HQWVSHUN:KDQGWKH
DYHUDJHGDLO\KRXVHKROGKRWZDWHUXVDJHJDOORQVSHUGD\




                                                                                     
                                        6HLVFR3URGXFW*XLGH± &RVW&RPSDULVRQV9HUVLRQ



                                               7$%/(

          6800$5<2)),567<($5(670$7('&267&203$5,6216
                              1HZ5HVLGHQWLDO&RQVWUXFWLRQ 86



7\SHRI:DWHU           (VWLPDWHG            (VWLPDWHG           (VWLPDWHG             7RWDO)LUVW
  +HDWHUV                $QQXDO             ,QVWDOODWLRQ        &RVWRI6SDFH          <HDU&RVW
 &RPSDUHG                2SHUDWLQJ              &RVW
                           &RVW


      6(,6&2                                                                        
       5$


     *DOORQ                                                                     
     HOHFWULF


      *DOORQ                                                                   
    QDWXUDOJDV


  *DOORQ
QDWXUDOJDV±                                                                    
SRZHUYHQWHG


      *DOORQ                                                                   
    QDWXUDOJDV


  *DOORQ
QDWXUDOJDV±                                                                    
SRZHUYHQWHG





  5HIHUWR'DWDIURP7DEOHIRU(VWLPDWHG$QQXDO2SHUDWLQJ&RVWVDQG$VVXPSWLRQV

  5HIHUWR7DEOHIRU(VWLPDWHG,QVWDOODWLRQ&RVWVDQG$VVXPSWLRQV

  7KH(VWLPDWHG&RVWRI6SDFHZDVFDOFXODWHGXVLQJSHUVTIWIRUDQGJDOORQVWRUDJHWDQNV
RFFXS\LQJDIORRUVSDFHRIVTIWDQGVTIWUHVSHFWLYHO\

  7KH7RWDO)LUVW<HDU&RVWGRHVQRWLQFOXGHWKHFRVWRIWKH:DWHU+HDWHU


                                                                                                         
                            6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ


                         6(,6&2Š
                 /LVWLQJV	7HVW5HSRUWV


$ 863$7(176	&203/,$1&(/,67,1*6

% (9$/8$7,21352-(&76

     6RODU%DFN8S3URMHFWV

     6SDFH+HDWLQJ%HWD6LWHV

     'XDO6SDFH+HDWLQJ	:DWHU+HDWLQJ6\VWHPV

     *RYHUQPHQW	2WKHU(YDOXDWLRQV

& 5()(5(1&(6

     79± 7KH'LVFRYHU\&KDQQHO6HJPHQW

     0DQXIDFWXUHG+RXVLQJ,QGXVWU\

     7UDGH0DJD]LQHV	$UWLFOHV

'7(67,1*	5(32576

     0DWHULDOV3HUIRUPDQFH,QF± 7DQN+HDWHU&RPSDULVRQ

     7HQQHVVHH9DOOH\$XWKRULW\79$ ± (IILFLHQF\5DWLQJ

     'HOPDUYD3RZHU± 3RZHU4XDOLW\7HVWLQJ

     6RXWKHUQ&DOLIRUQLD(GLVRQ ± 7DQN+HDWHU&RPSDULVRQV
                                        Seisco Product Guide – Listings & Reports (Version 1.1)


A. SEISCO® PATENTS AND COMPLIANCE LISTINGS

   1. U.S. Patents:
   One or more of the U.S. Patents below covers SEISCO and foreign Patents
   applications pending.

          #6,246,831 issued June 12, 2001;
          #6,080,971 issued June 23, 2000;
          #5,866,880 issued February 2, 1999;
          #5,325,822 issued July, 1994;
          #5,216,743 issued June, 1993.
   Most recent patent allowance in January, 2001, for U.S. Patent application filed June, 1999,
   not yet issued. In addition to the U.S. patents, there are many foreign patents issued as well as
   foreign patent applications in process.

   2. Compliance Listings:
   Instantaneous Water Heater System Listings with:

          U.L. (Underwriters Laboratories, Inc.) - 1996
          UL 499, File #E118679 / Listed 78P8 (Water Heating Equipment)
          UL 834, File #E232824 / Listed 8VA7 (Space Heating Equipment)
          UL – NSF Compliance with ANSI Standard 61 and 51
          UL/CSA (Canada) – Listed 78P8

          HUD (Housing & Urban Development)
          Approved for use in Manufactured Housing, Ref: NFPA 70

          NEC (National Electrical Code) - 1998

          NOM (Norma Official Mexicana) - 1998, Certification




                                                                                                  2
                                            6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ


%(9$/8$7,21352-(&76

   7KH6(,6&2KDVUHFHLYHGVLJQLILFDQWUHFRJQLWLRQDQGFRQWLQXHVWREH
   XVHGLQPDQ\QRWDEOHDSSOLFDWLRQVDIHZRIZKLFKDUHOLVWHGIURPWKHPRVW
   UHFHQW

   6RODU%DFN8S
   7KH 6HLVFR KDV EHHQ UHFRJQL]HG DV D SHUIHFW EDFN XS WR VRODU ZDWHU KHDWLQJ
   DSSOLFDWLRQVQRWRQO\IRUGRPHVWLFEXWDOVRIRUVSDFHKHDWLQJ'XULQJWKH\HDU
   WKH6HLVFRKDVEHHQVHOHFWHGDQGLVWKHEDFNXSIRUVRODUZDWHUKHDWLQJLQWKH81,7('
   67$7(6 '(3$570(17 2) 67$7( )/25,'$ 5(*,21$/ &(17(5
   %8,/',1* ZKLFK LV WKH 67$7( '(3$570(17
6 62/$5 6+2:&$6( ORFDWHG
   LQ )RUW /DXGHUGDOH )ORULGD  $GGLWLRQDOO\ DW WKH UHFRPPHQGDWLRQ RI 3$7+ DQG WKH
   1$+%5HVHDUFK'HSDUWPHQWWKH6HLVFRZDVDOVRVHOHFWHGDQGLVWKHEDFNXSIRUVRODU
   ZDWHU KHDWLQJ LQ WKH SUHVWLJLRXV $UPRU\ 3DUN GHO 6RO $ 6RODU &RPPXQLW\  7KLV
   SURMHFW LV EHLQJ FRQVWUXFWHG E\ WKH -RKQ :HVOH\ 0LOOHU &RPSDQLHV LQ WKH KLVWRULF
   $UPRU\3DUNDUHDRI7XVFRQ7KLVLVRQHRIWKHPRVWSUHVWLJLRXVVRODUSURMHFWVLQWKH
   86DQGLVDSDUWRIERWKWKH3$7+DQGWKH)HGHUDO*RYHUQPHQW
VPLOOLRQKRPHVRODU
   LQLWLDWLYHSURJUDP

   6SDFH+HDWLQJ

   7KH6HLVFRLVFXUUHQWO\-DQXDU\FRPSOHWLQJLWVWKLUG\HDURIVXFFHVVIXOUDGLDQW
   IORRUKHDWLQJLQEHWDVLWHVZKLFKDUHXWLOL]LQJWKH6HLVFRDVWKHVROHVRXUFHIRUVSDFH
   KHDWLQJ0RUHUHFHQWVSDFHKHDWLQJDSSOLFDWLRQVLQFOXGHEDVHERDUGKHDWLQJ

   6SDFH'RPHVWLF:DWHU+HDWLQJ&RPER

   7KH6HLVFRKDVGHPRQVWUDWHGLWVDELOLW\WRSURYLGHERWKVSDFHDQGGRPHVWLFKRWZDWHU
   IURP WKH VDPH KHDWHU  'RPHVWLF KRW ZDWHU LV VHSDUDWHG IURP WKH VSDFH KHDWLQJ IOXLG
   DQGSULRULW\LVJLYHQWRGRPHVWLFKRWZDWHUUHTXLUHPHQWVZKHQUHTXLUHGIURPDVPDUW
   KHDWHU SULRULW\ VZLWFK DQG FRQWURO  7KLV V\VWHP FDQ EH FRPELQHG ZLWK VRODU ZDWHU
   KHDWLQJWRSURYLGHDQH[WUHPHO\HQHUJ\HIILFLHQWDQGFRVWHIIHFWLYHGXDOV\VWHP

   *RYHUQPHQW	2WKHU(YDOXDWLRQV
   $7	76SRQVRUHG+RPHRI7RPRUURZ7KH6HLVFRZDVIHDWXUHGDWWKH6WDWH)DLU
   RI7H[DVLQ2FWREHULQWKH$7	7VSRQVRUHG+RPHRI7RPRUURZ

   3$7+ (YDOXDWHG 7HFKQRORJ\  7KH 6HLVFR ZDV IHDWXUHG DV WKH ZDWHU KHDWLQJ
   WHFKQRORJ\ RI FKRLFH LQ 3$7+
V 1DWLRQDO 'HPRQVWUDWLRQ  +RPH LQ -DQXDU\ 
   3UHVLGHQWLDO LQLWLDWLYH 7KH 3DUWQHUVKLS IRU $GYDQFLQJ 7HFKQRORJLHV LQ +RXVLQJ
   FRQVLVWLQJRIDJHQFLHVLQFOXGLQJ+8'WKH'2(DQGWKH(3$DVVLVWHGLQSURGXFW
   HYDOXDWLRQ E\ WKH 5HVHDUFK 'HSDUWPHQW RI WKH 1DWLRQDO $VVRFLDWLRQ RI +RPH
   %XLOGHUV
                                                                                                        
                                          6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ



   7HQQHVVHH 9DOOH\ $XWKRULW\  7KH 7HQQHVVHH 9DOOH\ $XWKRULW\ DQ DJHQF\ RI WKH
   )HGHUDO *RYHUQPHQW WHVWHG WKH 6(,6&2 DQG FRQILUPHG LWV SHUIRUPDQFH PHW WKH
   PDQXIDFWXUHU
VFODLPVDQGWKDWWKH6(,6&2ZDVHQHUJ\HIILFLHQW7KH79$
   SUHVHQWHG LWV ILQGLQJV WR WKH ,QWHUQDWLRQDO $6+5$( &RQIHUHQFH LQ %RVWRQ LQ -XO\
   

   %RQQHYLOOH 3RZHU /LNH WKH 79$ %RQQHYLOOH 3RZHU $GPLQLVWUDWLRQ %3$ DQ
   DJHQF\ RI WKH )HGHUDO *RYHUQPHQW VHOHFWHG WKH 6(,6&2 IRU LWV KRPH RI WKH IXWXUH
   1H;WKRXVHLQ-XO\

   $PHULFDQ 6RFLHW\ RI +HDWLQJ 5HIULJHUDWLRQ DQG $LU&RQGLWLRQLQJ (QJLQHHUV
   'X3RQWSUHVHQWHG6(,6&2WRWKH$PHULFDQ6RFLHW\RI+HDWLQJ5HIULJHUDWLRQDQG$LU
   &RQGLWLRQLQJ(QJLQHHUV$6+5$(LQ$WODQWD*HRUJLDLQ

&5()(5(1&(6
   79 7KH'LVFRYHU\&KDQQHO
   7KH 'LVFRYHU\ &KDQQHO
V <RXU 1HZ +RXVH LQLWLDOO\ ILOPHG LQ $XJXVW 
   LQFOXGHGWKH6(,6&2KHDWHULQDVHJPHQWRIWKHLUVKRZ$QHZVHJPHQWIHDWXULQJWKH
   6HLVFRZDVILOPHGLQDQGLVFXUUHQWO\DLULQJ

   0DQXIDFWXUHG+RXVLQJ,QGXVWU\
   6(,6&2 ZDV ILUVW LQWURGXFHG WR WKH PDQXIDFWXUHG KRXVLQJ LQGXVWU\ LQ 1RYHPEHU
   $IWHURYHUWKUHH\HDUVRIYHU\GLIILFXOWZRUN6HLVFRZDVJUDQWHGVHYHUDOVSHFLDO
   XVH SURYLVLRQ H[FHSWLRQV XQGHU +8'
V 0DQXIDFWXUHG +RXVLQJ &RQVWUXFWLRQ DQG
   6DIHW\ 6WDQGDUG  7KHVH DFFRPSOLVKPHQWV SURYLGHG UHFRJQLWLRQ WR D WDQNOHVV ZDWHU
   KHDWHU DV D YLDEOH ZKROH KRXVH ZDWHU KHDWHU IRU +8' PDQXIDFWXUHG KRXVLQJ  7KH
   PRVWUHFHQWSURYLVLRQZDVJUDQWHG$XJXVW6LOYHUFUHVW+RPHV+RPHVRI0HULW
   ERWK RI ZKLFK DUH GLYLVLRQV RI &KDPSLRQV (QWHUSULVHV ,QF 3DOP +DUERU +RPHV
   )XTXD +RPHV )DLUPRQW +RPHV )RXU 6HDVRQ +RPHV )OHHWZRRG DQG 7RZQ DQG
   &RXQWU\ +RPHV D GLYLVLRQ RI &DYDOLHU +RPHV DUH DPRQJ VHYHUDO RI WKH WRS WHQ
   PDQXIDFWXUHGKRXVLQJFRPSDQLHVLQWKH86RIIHULQJWKH6HLVFR

   7UDGH0DJD]LQHV	$UWLFOHV
   0LUDFOHV RI 6FLHQFH  6(,6&2 ZDV LQFOXGHG LQ 'X3RQW 0DJD]LQH 0LUDFOHV RI
   6FLHQFHLVVXHLQ-XQH

   /HDGLQJ 7UDGH 0DJD]LQH $UWLFOHV  6(,6&2 KDV EHHQ IHDWXUHG LQ DUWLFOHV LQ
   $SSOLFDQFH0DJD]LQH$SSOLFDQFH0DQXIDFWXUHU
V0DJD]LQH'X3RQW0DJD]LQH
   (GLVRQ(OHFWULF,QVWLWXWH
V0DUNHWLQJ(OHFWULFLW\7RGD\$QGPDQ\PRUHIURP
   WRWKHSUHVHQW


                                                                                                     
                                            6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ


:KDW2WKHUV$UH6D\LQJ$ERXW6(,6&2Š +HDWLQJ6\VWHPV

7KHIROORZLQJH[FHUSWVKDYHEHHQH[WUDFWHGIURPYDULRXVLQGXVWU\SXEOLFDWLRQV




)ORZGHWHFWLRQGULYHVWDQNOHVVZDWHUKHDWHU
³&RQURH7;² $QHZSDWHQWHGWDQNOHVVZDWHUKHDWHURQO\KHDWVZDWHUZKHQ
VRPHRQHWXUQVRQDIDXFHW´
²'(6,*11(:60DJD]LQHS$SULO




7H[DVILUPRIIHUVQHZW\SHRIWDQNOHVVZDWHUKHDWHU
³$QDO\VWVZKR¶YHWHVWHGWKH6(,6&2Š WDQNOHVVZDWHUKHDWHUVD\LWFDQORZHUHQHUJ\
XVHVLJQLILFDQWO\FRPSDUHGWRFRQYHQWLRQDOJDVRUHOHFWULFZDWHUKHDWHUVHPSOR\LQJ
VWRUDJHWDQNV´
²0DUNHWLQJ(OHFWULFLW\7RGD\9ROXPH1R$SULO




$ZDWHUKHDWHUIRUWKHZDOO
³$EXQGDQWFRQWLQXRXVKRWZDWHULVDFKLHYHGWKURXJKDGYDQFHGPHFKDQLFDODQG
HOHFWULFDOGHVLJQFLUFXLWU\2QHKXQGUHGSOXVVKRZHUVPD\EHWDNHQLQDURZ«
7HPSHUDWXUHFRQWUROLVYHU\SUHFLVHZLWKLQDRU± GHJUHH´
²$SSOLDQFH0DQXIDFWXUHU1RYHPEHU




3DUWVDQGVSDFHUHGXFWLRQSURYLGHGE\XVHRIQ\ORQUHVLQLQ HOHFWULFZDWHUKHDWHU
³,QDGGLWLRQWRSURYLGLQJDQXQOLPLWHGVXSSO\RIKRWZDWHUWRPHHWSHDNQHHGVORZHUHQHUJ\FRVWV
DQGVSDFHVDYLQJVWKHRQGHPDQGKHDWHUPRXQWVRQWKHZDOOLQDVPDOOFDELQHW´
²GHVLJQID[Š$SULO




,QVWDQWDQHRXVHOHFWULFZDWHUKHDWHUVHUYHVZKROHKRXVH
³«DSDWHQWHGFRQWUROV\VWHPSURYLGHVIRUFRQWLQXRXVKRWZDWHUZLWKYDULDEOHHQHUJ\LQSXWXVLQJ
RQO\WKHHQHUJ\UHTXLUHGWRKHDW WKHZDWHUWRWKHGHVLUHGWHPSHUDWXUH´
²7HFKQRORJLHVIRU(QHUJ\0DQDJHPHQWŒQRZ7HFKQRORJLHVIRU8WLOLW\6XFFHVVŒ-DQXDU\
S
                                                                                                 
                                             6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ




1RWDQNVQHFHVVDU\
³«WKHQHZXQLWXQGHUZHQWULJRURXVWHVWLQJ>E\%UDGOH\&RQVXOWLQJ*URXS@EHIRUHLWV
UHOHDVH«FRQGLWLRQVHPSOR\HGLQWKHWHVWVZHUHPXFKPRUHVHYHUHWKDQWKRVHHQFRXQWHUHGLQQRUPDO
RSHUDWLRQV«7KHUHVXOWVXUIDFHHURVLRQRIWKHFRPSRQHQWV«ZDVOHVVWKDQWKHWKLFNQHVVRIWZR
W\SLFDOKXPDQKDLUV«PLQHUDOEXLOGXSZDVQHJOLJLEOHDQGWKHUHZDVQRFRUURVLRQ´
²$SSOLDQFH0DUFKS

 HDW J	9    LOD J5
+HDWLQJ	9HQWLODWLQJ5HYLHZ
:DWHUKHDWHUPDGHLQSODVWLF
³7KH6(,6&2KHDWHUKDVEHHQGHVLJQHG«WRRYHUFRPHFDSDFLW\SUREOHPVDQGKDVDKLJKO\UHVSRQVLYH
HOHFWURQLFFRQWUROOHUZLWKGXDOEDFNXSVIRUNH\KHDWFRQWUROIXQFWLRQV´
²+HDWLQJ	9HQWLODWLQJ5HYLHZ>8.@$SULOS



<HVQRZDWHUKHDWHUXQOLPLWHGKRWZDWHUEXWQRVWRUDJHWDQN
³7KH6HLVFRKHDWHU«XVHVDSDWHQWHGIORZVHQVLQJDQGYDULDEOHSRZHUVKDULQJWHFKQRORJ\WRDYRLG
FDSDFLW\OLPLWDWLRQVPLQLPXPIORZDQGSUHVVXUHUHTXLUHPHQWVRYHUKHDWLQJRIZDWHUDQGEXUQRXWRI
KHDWLQJHOHPHQWVDWORZIORZUDWHVRUVKXWGRZQ´
²0+59%XLOGHUV1HZV0DUFK$SULO




6HLVFRWDQNOHVVHOHFWULFZDWHUKHDWHUVHWVQHZVWDQGDUG
³«WKH6HLVFRFRQWURORIIHUVWKUHHDGGLWLRQDODGYDQWDJHV)LUVWLWXVHVHOHFWURQLFVHQVRUVWRFRQWUROWKH
HOHPHQWVUDWKHUWKDQLQOLQHIORZVZLWFKHVDQGRUSUHVVXUHGLDSKUDJPVZKLFKKDYHDQRWRULRXV
KLVWRU\RIIDLOLQJ6HFRQGWKHUHDUHQRPLQLPXPSUHVVXUHRUIORZUHTXLUHPHQWV«)LQDOO\WKH
6HLVFRFRQWUROFRQWDLQVDVHSDUDWHUHGXQGDQWKLJKWHPSHUDWXUHVKXWGRZQFLUFXLWWKDW¶VLQKHUHQWLQ
WKHFRQWURO¶VGHVLJQ´
²(QHUJ\'HVLJQ8SGDWHŠ0D\




=\WHOQ\ORQILQGVXVHLQKHDWLQJFKDPEHU
³'X3RQW&RSRO\PHUVVWDQGWKHKHDWLQRQGHPDQGZDWHUKHDWHUVPDGHE\0LFURWKHUP«7KH
6(,6&2KHDWHUHOHFWULFDOO\KHDWVZDWHUZKHQQHHGHGHOLPLQDWLQJWKHQHHGIRUDEXON\VWRUDJHWDQN,W
DOVRFXWVGRZQRQKHDWORVVHVIURPDWDQNZKLOHLWLVQRWLQXVH´
²3/$67,&61(:6$SULO




                                                                                                        
                                             6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ



'7(67,1*	5(32576

:HKDYHLQFOXGHGH[FHUSWVIURPSHUIRUPDQFHVWXGLHVDQGHQJLQHHULQJHYDOXDWLRQUHSRUWVDQG
EHOLHYHWKDWWKH\DUHFRQVLVWHQWZLWKWKHUHSRUWV¶ILQGLQJVDQGFRQFOXVLRQV)XOOFRSLHVRIWKHVH
UHSRUWVPD\EHPDGHDYDLODEOHWRUHTXHVWLQJSDUWLHVRQDFDVHE\FDVHEDVLV

(QHUJ\&RPSDULVRQ6WXG\)HEUXDU\
²0DWHULDOV3HUIRUPDQFH,QFIRUPHUO\%UDGOH\&RQVXOWLQJ*URXS
                  ³&RPSDULVRQRI6HLVFR,QVWDQWDQHRXV:DWHU+HDWHU
                   DQGD6WDQGDUG(OHFWULF*DOORQ6WRUDJH7DQN

                                   E\6WHYHQ:%UDGOH\
                               0DWHULDOV3HUIRUPDQFH,QF
                           IRUPHUO\%UDGOH\&RQVXOWLQJ*URXS
                                  )06XLWH
                                &ROOHJH6WDWLRQ7;

35()$&(
7KLV UHSRUW SUHVHQWV WKH UHVXOWV RI D XWLOLW\ VWXG\ FRQGXFWHG IRU 6HLVFR E\ WKH
ODERUDWRULHVRI%UDGOH\&RQVXOWLQJ*URXSLQ&ROOHJH6WDWLRQ7H[DV$FFRUGLQJW R
QDWLRQDOHQHUJ\VWDQGDUGVWKHDYHUDJHKRXVHKROGKRWZDWHUXVDJHLVJDOORQV
SHU GD\ LQ VL[ SULPDU\ GUDZV  +RXVHKROGV RI  RU PRUH ZLOO FRPPRQO\ XVH PRUH
WKDQ WKLV DPRXQW 7KHVH WHVWV UHSUHVHQW D KLJK YROXPH FRQVXPSWLRQ FRPSDULVRQ RI
WZRGLIIHUHQWKRWZDWHUKHDWLQJV\VWHPV1RWHWKDWWKLVWHVWLQJLVQRWGHVLJQHG
WR SURYLGH D FDOFXODWLRQ RI DFWXDO RU HYHQ DYHUDJH FRVW DV WKLV ZLOO YDU\ EDVHG
RQXVDJHLQOHWZDWHUWHPSHUDWXUHVWRUDJHORFDWLRQRIKHDWHUDQGSHULRGVEHWZHHQ
KRW ZDWHU GUDZV 7KH WHVWLQJ ZDV LQLWLDWHG WR FRPSDUH WKH SHUFHQW GLIIHUHQFH RI
SRZHUFRQVXPSWLRQXQGHUWKHVDPHFRQGLWLRQVIRUHDFKKHDWHUV\VWHP

,1752'8&7,21
7KLV XWLOLW\ VWXG\ ZDV LQLWLDWHG WR FRPSDUH WKH SHUIRUPDQFH RI WKH  N: 6HLVFR
LQVWDQWDQHRXVZDWHU KHDWHUZLWKDVWDQGDUG JDOORQHOHFWULFZDWHUKHDWHU7KLV
W\SH RI LQIRUPDWLRQ LV LPSRUWDQW WR FRQVXPHUV ZKR VHHN WR ERWK LQFUHDVH WKH
DYDLODELOLW\ RI FRQWLQXRXV KRW ZDWHU ZLWK D UHGXFWLRQ LQ FRVW 7KLV UHSRUW ZLOO
FRYHU WHVWV WKDW ZHUH SHUIRUPHG RYHU D SHULRG RI WKUHH PRQWKV XQGHU VLPXODWHG
UHDOZRUOGFRQGLWLRQV


7HVWLQJ3URWRFRO
2XU FKRVHQ WHVW UHJLPHQ ZDV WR VLPXODWH VHUYLFH LQ D UHDO KRXVHKROG ZKHUH GUDZV
DUH ERWK FRQFHQWUDWHG DW FHUWDLQ WLPHV RI WKH GD\ DQG WKHQ LQWHUPLWWHQW GXULQJ
RWKHUSHULRGV7ZRSRWHQWLDOVHUYLFH FRQGLWLRQVZHUHFRQVLGHUHG7KHILUVWZDVD
ZDWHU KHDWHU VHWWLQJ RI  ƒ) IRU ERWK V\VWHPV DV UHFRPPHQGHG E\ WKH VHUYLFH
PDQXDOV7KHVHFRQGFRQGLWLRQZKLFKLVRIWHQIRXQGLQKRXVHKROGVZKHUHKRWZDWHU
VXSSO\LVH[KDXVWHGLVDUDLVHGWHPSHUDWXUHVHWWLQ JRIWKH JDOORQWDQNWR
ƒ) ,W ZDV XQQHFHVVDU\ WR UDLVH WKH 6HLVFR V\VWHP WR D KLJKHU WHPSHUDWXUH DV LW
LVDEOHWRSURYLGHFRQWLQXRXVKRWZDWHU«




                                                                                                      
                                       6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ

      7DEOH$YHUDJH7HVW&\FOH9DOXHVIRU*DOORQ7DQNDWƒ)
          &\FOH         $YHUDJH   $YHUDJH    $YHUDJH    $YHUDJH    $YHUDJH
                         (QHUJ\   2XWIORZ    )ORZLQ    )ORZLQ    2XWIORZ
                        8VHGN:      *30         &ROG       +RW      7HPSƒ)
                                                  *30        *30
       6KRZHU7HVW                                          
     'LVKZDVKHU7HVW                                        
   :DVK0DFKLQH7HVW                                     
      6WDQGE\8VDJH                                         
       7RWDO8VDJH      N:   *DO   *DO   *DO    +RW

      7DEOH$YHUDJH7HVW&\FOH9DOXHVIRU6HLVFR7DQNOHVV:DWHU+HDWHU
          &\FOH         $YHUDJH   $YHUDJH     $YHUDJH   $YHUDJH   $YHUDJH
                         (QHUJ\   2XWIORZ     )ORZLQ   )ORZLQ   2XWIORZ
                        8VHGN:      *30          &ROG      +RW     7HPSƒ)
                                                   *30       *30
       6KRZHU7HVW                                       
     'LVKZDVKHU7HVW                                     
   :DVK0DFKLQH7HVW                                    
      6WDQGE\8VDJH                                       
       7RWDO8VDJH      N:   *DO    *DO   *DO        

7KHIROORZLQJREVHUYDWLRQVPD\EHPDGHUHJDUG LQJWKHGDWD7KHILUVWF\FOHRIWKH
 JDOORQ WDQN UHTXLUHV WKH OHDVW SRZHU FRQVXPSWLRQ DV WKH WDQN KDV KDG SOHQW\
RIWLPHWRUHSOHQLVKDQGLVQHDUWKHVHWSRLQWWHPSHUDWXUH$VHDFKF\FOHLVUXQ
WKH SRZHU FRQVXPSWLRQ LQFUHDVHV DV WKH ZDWHU WHPSHUDWXUH LQ WKH  JDOORQ WDQN
GHFUHDVHV7KLVLVDOVRVHHQE\WKHLQFUHDVLQJDPRXQWRIKRWZDWHUIORZUHTXLUHG
IURPWKHJDOORQWDQNWRPDLQWDLQWKHƒ)RXWIORZWHPSHUDWXUHRQWKHVKRZHU
WHVW7KHWDQNKHDWHUZLOOFRQWLQXHWRKHDWIRUVHYHUDOPLQXWHVDIWHUFR PSOHWLRQ
RIWHVWLQJDVLWEULQJVWKHZDWHUEDFNWRVHWSRLQW

7KH 6HLVFR V\VWHP UHTXLUHV D KLJKHU FRQVXPSWLRQ GXULQJ WKH ILUVW F\FOH DV WKH
XQLW ERG\ LWVHOI LV EHLQJ KHDWHG ZLWK WKH ZDWHU ,Q VXEVHTXHQW F\FOHV D
GHFUHDVLQJ DPRXQW RI KHDW LV UHTXLUHG EHFD XVH WKH LQLWLDO WHPSHUDWXUH DW WKH
EHJLQQLQJ RI WKH F\FOH LV KLJKHU 7KH RYHUDOO FRQVXPSWLRQ RI KRW ZDWHU IURP WKH
6HLVFRV\VWHPLVORZHUDVWKHWDQNOHVVKHDWHUPDLQWDLQVVHWSRLQWWHPSHUDWXUHDQG
UHTXLUHVWKHVDPHPL[WXUHRIKRWDQGFROGZDWHUIRUWKHVKR ZHUWHVW«

,WLVFRPPRQO\KHOGWKDWPDQ\KRPHRZQHUVRSHUDWHWKHLUZDWHUKHDWHUVDWDKLJKHU
WHPSHUDWXUHVHWWLQJWKDQƒ)&RQVXOWDWLRQZLWKFRQVXPHUVFRQILUPHGWKDWWKH\
ZLOO RIWHQ VHW ZDWHU KHDWHUV DW  ±  ƒ) 7KH FRQWLQXRXV KRW ZDWHU LV DQ
DGYDQWDJHRIWKHLQ OLQHKHDWLQJV\VWHP,WGRHVQRWWHPSWKRPHRZQHUVRUEXLOGHUV
WRVHWZDWHUWHPSHUDWXUHVDWDVHWSRLQWWKDWFRXOGFDXVHVFDOGLQJ7DEOHVKRZV
HYHQ KLJKHU DPRXQW RI HQHUJ\ VDYLQJV SRVVLEOH LI  JDOORQ WDQN VHWWLQJV DUH
KLJKHU




                                                                                            
                                            6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ


       7DEOH0RQWKO\8VDJH&RPSDULVRQDWƒ)
                           'D\VLQXVH      6HLVFRPRQWKO\                  *DOORQPRQWKO\
                                               N:XVDJH                          N:XVDJH
           6KRZHUV                                                           
         'LVKZDVKHU                                                         
      :DVKLQJPDFKLQH                                                        
           6WDQGE\                                                            
            7RWDO                                                           
      3HUFHQW6DYLQJV                             

«,W DSSHDUV IURP WKHVH WHVWV WKDW WKH 6HLVFR LQ OLQH KHDWHU RIIHUV FRQVLGHUDEOH
SRZHUFRQVXPSWLRQVDYLQJVZLWKWKHEHQHILWRIFRQWLQXRXVKRWZDWHUDYDLODELOLW\
6LWXDWLRQVLQYROYLQJKLJKDPRXQWVRIVWDQGE\ZRXOGLQFUHDVHWKHVDYLQJVRIDQLQ
OLQH KHDWHU RYHU D VWDQGE\ KHDWHU ,Q DGGLWLRQ ODUJHU YROXPH XVHV DSSHDU WR EH
PRUH HIILFLHQW ZLWK WKH 6HLVFR V\VWHP )XUWKHU WHVWLQJ LV EHLQJ LQLWLDWHG WR
FRQVLGHUKHDWDQGZDWHUORVVHVGXHWRSLSLQJ´



%UDGOH\&RQVXOWDWLRQLVORFDWHGLQ&ROOHJH6WDWLRQ7H[DV ,WVSHFLDOL]HVLQFRQVXOWLQJDQGWHVWLQJLQ
WKHDUHDRIPDWHULDOVSHUIRUPDQFH >%UDGOH\&RQVXOWLQJLVQRZNQRZQDV0DWHULDO3HUIRUPDQFH,QF@




                                                                                                     
                                   6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ


(YDOXDWLRQRI6(,6&2([HFXWLYH6XPPDU\
²79$7HQQHVVHH9DOOH\$XWKRULW\
             6(,6&2,QVWDQWDQHRXV:DWHU+HDWHU0RQLWRULQJ(YDOXDWLRQ

3URMHFW%DFNJURXQGDQG([HFXWLYH6XPPDU\

5HVLGHQWLDOZDWHUKHDWLQJUHSUHVHQWVDVLJQLILFDQWSRUWLRQRI79$¶VWRWDO
HOHFWULFVDOHV+LVWRULFDOO\HOHFWULFLW\KDVEHHQWKHFKRLFHIRUZDWHUKHDWLQJ
+RZHYHUZKHUHDYDLODEOHQDWXUDOJDVKDVEHHQJDLQLQJPDUNHWVKDUHDQGUHSODFLQJ
FRQYHQWLRQDOZDWHUKHDWLQJV\VWHPV1HZUHVLGHQWLDOZDWHUKHDWLQJWHFKQRORJLHV
DUHEHLQJFRQWLQXDOO\HYDOXDWHGWRVXSSRUW79$LQGHILQLQJPRUHFRPSHWLWLYH
SRVLWLRQVDJDLQVWQDWXUDOJDVUHJDUGLQJ RSHUDWLQJFRVWVWKHFXVWRPHU7KH
5HVLGHQWLDODQG6PDOO&RPPHUFLDO0DUNHWLQJ56&0VWDIIUHTXHVWHGWKDW7HFKQRORJ\
$GYDQFHPHQWVFRQGXFWDQHYDOXDWLRQRIWKH6(,6&2WDQNOHVVZDWHUKHDWLQJV\VWHP

2YHUDOOSURMHFWUHVXOWVLQGLFDWHWKDWWKH6(,6&2V\VWHPRSH UDWHVDVWKH
PDQXIDFWXUHUFODLPV,WPDLQWDLQHGZDWHUWHPSHUDWXUHVXQGHUDOORSHUDWLRQDOIORZ
FRQGLWLRQVH[FHSWVZKHQWKHIORZUDWHH[FHHGHGWKHGHVLJQFDSDFLW\IRUWKHXQLW
7KHV\VWHPSRZHULQSXWHPXODWHVWKHLQVWDQWDQHRXVKRWZDWHUGHPDQGIRUWKH
UHVLGHQFH7KLVZLOOVLPSOLI\PRGHOLQJIRUWKHV\VWHPVIRURYHUDOOSRZHUV\VWHP
LPSDFWDVW\SLFDOUHVLGHQWLDOKRWZDWHUGHPDQGSURILOHVIRUWKHYDOOH\FDQEH
XVHG

/DVW-XO\SUHOLPLQDU\UHVXOWVRIWKHV\VWHPRSHUDWLRQZHUHSUHVHQWHGLQD
VHPLQDUDWWKH$PHULFDQ6RFLHW\RI+HDWLQJ5HIULJHUDWLRQDQG$LU &RQGLWLRQLQJ
(QJLQHHUVDQQXDOPHHWLQJLQ%RVWRQ$FRS\RIWKHVOLGHVIRUWKLVSUHVHQWDWLRQ
DUHLQFOXGHGLQ$WWDFKPHQW7KHIXOOSURMHFWUHSRUWZDVGHOD\HGZDLWLQJIRUWKH
PDQXIDFWXUHUWRGHYHORSDQGWHVWWKHQ HZVROLGVWDWHFRQWUROOHU7KLVZDV
GHOLYHUHGLQVWDOOHGDQGWHVWHGDQGIRXQGWREHVDWLVIDFWRU\LQ6HSWHPEHU

3URMHFW'HVFULSWLRQ

0LFURWKHUP,QFRUSRUDWHGRI&RQURH>QRZRI+RXVWRQ@7H[DVLVWKHPDQXIDFWXUHURI
WKH6(,6&27DQNOHVVZDWHUKHDWHU7KH\L QVWDOOHGRQHRIWKHLUV\VWHPV0RGHO5$ 
DWDUHVLGHQFHLQ&KDWWDQRRJD7HQQHVVHH

7KH6(,6&2WDQNOHVVZDWHUKHDWHULVDQLQVWDQWDQHRXVHOHFWULFZDWHUKHDWHUZLWK
WKHIROORZLQJIHDWXUHVFODLPHGE\WKHPDQXIDFWXUHU$GGLWLRQDOLQIRUPDWLRQLV
LQFOXGHGDV $WWDFKPHQWWRWKLVGRFXPHQW
 0ROGHGQ\ORQZDWHUKHDWLQJFKDPEHUV
 6ROLGVWDWHFRQWUROVIRUXQLIRUPVXSSO\ZDWHUWHPSHUDWXUHV
 'XDOVDIHW\EDFNXSFRQWUROV
 3RZHUUDWLQJVIURPN:WRN:DN:XQLWZDVPRQLWRUHG

7DEOHLGHQWLILHVWKHGLIIHUHQW6(,6& 2PRGHOVWKHLUUDWLQJVDQGSRZHU
UHTXLUHPHQWV




                                                                                       
                                   6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ

                        6(,6&2,QVWDQWDQHRXV:DWHU+HDWHU
                              0RQLWRULQJ(YDOXDWLRQ

      7DEOH6(,6&2:DWHU+HDWHU0RGHOVDQG&DSDFLWLHV
       81,7    N:    $PSHUDJH %WX¶V 7HPS5LVH     7HPS5LVH        %UHDNHUV
                                       #JSP  #JSP        5HTXLUHG

      5$   N:    DPS      GHJ

    GHJ

       DPS

      5$   N:    DPS      GHJ

    GHJ

       DPS

      5$   N:    DPS      GHJ

    GHJ

       DPS

      5$   N:   DPS      GHJ

    GHJ

       DPS

      
$OOWZRSROHYROWV$&Z*URXQGHG1HXWUDO
      

$ERYHDPELHQWWHPSHUDWXUH


2WKHUFODLPVE\6(,6&2ZKHQFRPSDUHGWRFRQYHQWLRQDOZDWHUKHDWHUVLQFOXGH
 ,QFUHDVHG5HOLDELOLW\± 6ROLGVWDWHFRQWUROVDYRLGRYHUKHDWLQJSURYLGHORQJHU
   HOHPHQWOLIHHOLPLQDWHIORZVZLWFKIDLOXUHVHOLPLQDWHPLQLPXPIORZ 	
   SUHVVXUHUHTXLUHPHQWVDQGWKHXQLWKDVDQ\ORQUHVLQPROGHGWDQN
 8QLIRUPZDWHUWHPSHUDWXUH ± WKHV\VWHPFRQWUROVPDLQWDLQZDWHUWHPSHUDWXUH
   DFURVVDOOIORZUDWHV
 (QHUJ\6DYLQJV± HOLPLQDWLRQRIVWDQGE\WDQNORVVHVN:KSHUGD\
 8QOLPLWHGKRWZDWHU VXSSO\
 6PDOOHULQVWDOODWLRQVSDFHUHTXLUHG
 8QLW0HHWV8/DQGRWKHUVWDQGDUGVIRUV\VWHPFRQWDFWZLWKSRWDEOHKRWZDWHU
 /HVVSHDNGHPDQGFRQWULEXWLRQWKDQ³VWRUDJHW\SH´HOHFWULFZDWHUKHDWHUV
   HOHPHQWFRQWUROVDUHHQHUJL]HGRQO\IRUVKRUWSHULRGVZKLOHWD QNHOHPHQWVDUH
   HQHUJL]HGGXULQJXVHDQGUHFRYHU\




                                                                                       
                                                    6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ

                           7DQNOHVV:DWHU+HDWHU
  7,0(      (OHPHQW   (OHPHQW   (OHPHQW   (OHPHQW      &:LQ     +:([LW                  ,1       287
+5016&                                         7:+	*:+       7:+      *$//216     %78        %78
                                                                   
                                                                  
                                                 
                                                 
                                                
                                               
                                               
                                               
                                              
                                                
                                             
                                             
                                               
                                             
                                                
                                                
                                                  
                                              
                                              
                                             
                                             
                                             
                                              
                                                                   
                                                                  
                                                                  

               +LJK)ORZ3HULRG
                                                                 727$/6            
                                                                           ()),&,(1&< 




                                                                                                            
                                              6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ

3RZHU4XDOLW\$SULO
²'HOPDUYD3RZHUQRZ&RQHFWLY
                                6(,6&2:DWHU+HDWHU7HVW5HSRUW

                                        E\'DYLG%9DQQR\
                                   0DQDJHU3RZHU4XDOLW\6HUYLFHV
                                          'HOPDUYD3RZHU

³«WHVWFRQVLVWHGRIWKHIROORZLQJVWDUWLQJZLWKFROGSLSHVWKHWXEKRWZDWHUIDXFHWZDVWXUQHGWRWKH
IXOORSHQSRVLWLRQ:DWHUZDVUXQIRUDERXWIRXUPLQXWHV9ROWDJHDQGFXUUHQWZHUHPRQLWRUHGXVLQJ
DQ5302PHJDSRZHUPRQLWRULQJV\VWHP«´


9ROWDJH
³«7KHIOXFWXDWLRQEHWZHHQWKHYROWDJHPLQLPXPDQGPD[LPXPUHVXOWLQJIURPFXUUHQWPRGXODWLRQ
DVWKH506FXUUHQWGURSSHGIURPLWVLQLWLDOSHDNWRWKHVXFFHHGLQJPLQLPXPLVDSSUR[LPDWHO\
YROWVRU«´


&XUUHQW
³«WKHLQLWLDOFXUUHQWRIDSSUR[LPDWHO\DPSHUHVIHOORIIWRDPSHUHVDQGUHWXUQHGWRDSHDNRI
DSSUR[LPDWHO\DPSHUHV,WWKHQRVFLOODWHGEHWZHHQDQGDPSHUHVGXULQJWKHUHPDLQGHURIWKH
WHVW7KHSHULRGRIWKLVRVFLOODWLRQLVVXFKWKDWLWGRHVQRWVHHPWRSURGXFHQRWLFHDEOHIOLFNHU«WKHUH
LVQRDSSUHFLDEOHFXUUHQWZDYHIRUPGLVWRUWLRQ´


9ROWDJH+DUPRQLF'LVWRUWLRQ
³«WKHPD[LPXPYROWDJHKDUPRQLFGLVWRUWLRQWREHDPD[LPXPRI´


)OLFNHU
³)OLFNHUDSSHDUVWREHVXEVWDQWLDOO\UHGXFHGIURPHDUOLHUPRGHOV«´




                                                                                                       
                                             6HLVFR3URGXFW*XLGH± /LVWLQJV	5HSRUWV9HUVLRQ


&RPSDUDWLYH6WXG\([HFXWLYH6XPPDU\'HFHPEHU
²6RXWKHUQ&DOLIRUQLD(GLVRQ6'68
 &203$5$7,9(678'<%(7:((17+($48$6<67(06(/(&75,&,167$17$1(286
 :$7(5+($7(56$&219(17,21$/5(6,'(17,$/7,7/((/(&75,& 6725$*(
  7<3(:$7(5+($7(5$1'$&219(17,21$/5(6,'(17,$/7,7/(1$785$/
                   *$66725$*(7<3(:$7(5+($7(5

                                          E\6DQGUD(OOLV
                                           VXEPLWWHGWR
                                6'68(QHUJ\(QJLQHHULQJ,QVWLWXWH
                               'HSDUWPHQWRI0HFKDQLFDO(QJLQHHULQJ
                                     6DQ'LHJR6WDWH8QLYHUVLW\
                                       6DQ'LHJR&$



                                      (;(&87,9(6800$5<
       ³7KHREMHFWLYHRIWKLVSURMHFWZDVWRSHUIRUPDFRPSDUDWLYHVWXG\ EHWZHHQHOHFWULFVWRUDJH
W\SHJDVVWRUDJHW\SHDQGHOHFWULFLQVWDQWDQHRXVZDWHUKHDWHUVIRUUHVLGHQWLDOHQHUJ\FXVWRPHUVLQWKH
6RXWKHUQ&DOLIRUQLD(GLVRQVHUYLFHWHUULWRU\´


       ³,QQHZFRQVWUXFWLRQDQGLQUHWURILWDSSOLFDWLRQVLWZDVGHWHUPLQHGWKDWDOOWKUHHPRGHOVRIWKH
$TXD6\VWHPVHOHFWULFLQVWDQWDQHRXVZDWHUKHDWHUV0RGHOV55DQG5ZHUHQRWRQO\PRUH
HQHUJ\HIILFLHQWEXWZHUHDOVRPRUHFRVWHIIHFWLYHWKDQWKHHOHFWULFVWRUDJHW\SHZDWHUKHDWHUWHVWHG
HYHQZLWKDQDGGLWLRQDOLQVXODWLRQEODQNHWLQVWDOOHG«´


>$TXD6\VWHPVLVWKHSUHGHFHVVRUWRWKH6(,6&2&RQWLQXRXV:DWHU+HDWHU@




                                                                                                      
                                          SEISCO Product Guide – Appendix (Version 11.03)



                    SEISCO®
         9          Appendix
                    (21 pages – 135 KB)




A. SPEC SHEETS – WATER HEATERS

  • Models RA-28 thru RA-05

B. SPEC SHEETS – SPACE HEATERS (MICRO-BOILERS)

  • Models SH-28 thru SH-05

C. RESIDENTIAL WATER HEATER QUICK GUIDE

D. RADIANT FLOOR / SPACE HEATING QUICK GUIDE
                                                                                                      SEISCO® / Microtherm, Inc. RA-28

                                   //For Water Heating Applications//


Model RA-28                                                                                               Model RA-28

Four-Chamber Tankless Electric
Water Heater
Description: The RA-28 is the mo st popular residential model for
providing a continuous supply of hot water for as long as you need it.
Ideal for the whole house and for commercial applications such as,
specialty restaurants, convenience stores, salons, and pet-grooming shops.
This on-demand tankless water heater is a powerful replacement
for traditional tank-type heaters and is the enabling technology for use as
back-up to active renewable energy systems such as solar and geothermal
water heating systems. The temperature activated control works                                                Exterior
effectively in re-circulating systems and in combination with tank-type
heaters. A minimum of 200 AMP, whole-house electrical service is
recommended.
Features:
•   UL 499 Approval Listing for Water Heating Applications
•   Works with tubing and manifold systems                                        Interior
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   No moving parts
•   Very small & compact
•   Light weight modular construction
•   No restriction to flow                                             INSTALLATION
•   Standard 3/4 inch plumbing connections
•   Microprocessor digital control                                     Outlet (Hot)***             Inlet (Cold)
                                                                                                                         Shut-Off
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics                                                                                                       Four Breakers
•   Redundant safety devices                                                                                                240 VAC *
•   High performance polymer nylon chamber material
•   Built-in Leak detector and alarm                                                                                            30 A
•   Rust & corrosion resistant
                                                                             A            RA-28                                 30 A

Specifications:                                                                                                                 30 A
Heat Output (max.): 95,560 BTU
Power Rating (max.): 28KW                          Flow Ratings:                                                                30 A
Voltage Rating (Nominal): 240 VAC                     Rise (Deg F)
Current Rating (max.): 116 AMPS                      @ Flow (GPM)                                                    4 pairs of # 8 cu
                                                                                               B
Energy Factor: 0.99+                                 95 °F @ 2.0 GPM                                                AWG with ground
Heating Elements : 7000 watts x 4                    76 °F @ 2.5 GPM
Circuits Required: Four (4), 2-wire w/ ground*       64 °F @ 3.0 GPM                                              Mounting Holes:
Breakers Required: Four (4), double-pole*                                      Dimensions:                        “A” Mount: 14 ¼” (362 mm)
                                                     48 °F @ 4.0 GPM
Breaker Size: 30 AMPS each x 4*                                                Weight: 23 lbs (10.4 kg)           “B” Mount: 16 1/ 8” (410 mm)
Temp. Output (dial): 90F to 130F (32C - 52C)**        Rise (Deg C)             Height:   15 ¾” (400 mm)
                                                                               Width:     15 ¾” (400 mm)
                                                     @ Flow (L/Min.)                                              Approvals:
(*)Optional two (2), 60 AMP circuit supply –                                   Depth:    6 ¼” (159 mm)
                                                    50 °C @ 8 L/min            Fittings: ¾” (200 mm)              U.L. CSA NSF
Check with manufacturer for jumpers that must       40 °C @ 10 L/min                                              HUD NEC
be installed on control board for this option.
(**)Temp. output dial Factory set to 120F (49C).    33 °C @ 12 L/min
                                                                               Warranty is for Water Heating Applications only and does not cover
(***)T&P Relief Valve not required by Mfg.          25 °C @ 16 L/min           use for residential or commercial space heating applications.
                                                                                                     SEISCO® / Microtherm, Inc. RA-22

                                   //For Water Heating Applications//


Model RA-22                                                                                              Model RA-22

Four-Chamber Tankless Electric
Water Heater
Description: The RA-22 is a residential model for providing a
continuous supply of hot water for as long as you need it. Ideal for the
whole house, apartment or condominium dwelling, where incoming water
temperature rarely drops below 55 degrees F. Excellent for split systems
serving individual entities such as lavatories, shower/bath rooms and
kitchens. This on-demand tankless water heater is a powerful replacement
for traditional tank-type heaters and is the enabling technology for use as                                  Exterior
back-up to active renewable energy systems such as solar and geothermal
water heating systems. The temperature activated control works
effectively in re-circulating systems and in combination with tank-type
heaters. A minimum of 150 AMP, whole-house electrical service is
recommended.
Features:
•   UL 499 Approval Listing for Water Heating Applications                        Interior
•   Works with tubing and manifold systems
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   No moving parts
•   Very small & compact                                              INSTALLATION
•   Light weight modular construction
•   No restriction to flow                                               Outlet (Hot)**           Inlet (Cold)
•   Standard 3/4 inch plumbing connections                                                                              Shut-Off
•   Microprocessor digital control
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics                                                                                                       Two Breakers
•   Redundant safety devices                                                                                                240 VAC
•   High performance polymer nylon chamber material
•   Built-in Leak detector and alarm                                          A                                                50 A
•   Rust & corrosion resistant
                                                                                          RA-22
                                                                                                                               50 A
Specifications:
Heat Output (ma x.): 75,080 BTU                   Flow Ratings:
Power Rating (max.): 22KW                            Rise (Deg F)
Voltage Rating (Nominal): 240 VAC                   @ Flow (GPM)                                                    2 pairs of # 6 cu
Current Rating (max.): 91 AMPS                                                                B
                                                    75 °F @ 2.0 GPM                                                AWG with ground
Energy Factor: 0.99+                                60 °F @ 2.5 GPM
Heating Elements : 5500 watts x 4                   50 °F @ 3.0 GPM                                              Mounting Holes:
Circuits Required: Two (2), 2-wire w/ ground                                  Dimensions:                        “A” Mount: 14 ¼” (362 mm)
                                                    37 °F @ 4.0 GPM
Breakers Required: Two (2), double-pole                                       Weight: 23 lbs (10.4 kg)           “B” Mount: 16 1/8” (410 mm)
Breaker Size: 50 AMPS each x 2                       Rise (Deg C)             Height:   15 ¾” (400 mm)
Temp. Output (dial): 90F to 130F (32C - 52C)*                                 Width:     15 ¾” (400 mm)
                                                    @ Flow (L/Min.)                                              Approvals:
                                                                              Depth:    6 ¼” (159 mm)
                                                   39 °C @ 8 L/min            Fittings: ¾” (200 mm)              U.L. CSA NSF
(*)Temp. output dial Factory set to 120F (49C).
(**)T&P Relief Valve not required by Mfg.          31 °C @ 10 L/min                                              HUD NEC
                                                   26 °C @ 12 L/min
                                                                              Warranty is for Water Heating Applications only and does not cover
                                                   20 °C @ 16 L/min           use for residential or commercial space heating applications.
                                                                                                     SEISCO® / Microtherm, Inc. RA-18

                                   //For Water Heating Applications//


Model RA-18                                                                                              Model RA-18

Four-Chamber Tankless Electric
Water Heater
Description: The RA-18 is the perfect supplement to an existing tank-
type water heater that is unable to satisfy the user requirements. Ideal for
the whole house, apartment or condominium dwelling, where incoming
water temperature rarely drops below 65 degrees F. Excellent for split
systems serving individual entities such as lavatories, shower/bath rooms
and kitchens. This on-demand tankless water heater is a powerful
replacement for traditional tank-type heaters and is the enabling                                               Exterior
technology for use as back-up to active renewable energy systems such as
solar and geothermal water heating systems. The temperature activated
control works effectively in re-circulating systems and in combination
with tank-type heaters. A minimum of 125 AMP, whole-house electrical
service is recommended.
Features:
•   UL 499 Approval Listing for Water Heating Applications                        Interior
•   Works with tubing and manifold systems
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   No moving parts
•   Very small & compact                                              INSTALLATION
•   Light weight modular construction
•   No restriction to flow                                               Outlet (Hot)**             Inlet (Cold)
•   Standard 3/4 inch plumbing connections                                                                               Shut-Off
•   Microprocessor digital control
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics                                                                                                       Two Breakers
•   Redundant safety devices                                                                                                240 VAC
•   High performance polymer nylon chamber material
•   Built-in Leak detector and alarm                                       A                                                    40 A
•   Rust & corrosion resistant
                                                                                          RA-18
                                                                                                                                40 A
                                                  Flow Ratings:
Specifications:                                      Rise (Deg F)
Heat Output (max.): 61,430 BTU                      @ Flow (GPM)
Power Rating (max.): 18KW                           61 °F @ 2.0 GPM                                                 2 pairs of # 8 cu
Voltage Rating (Nominal): 240 VAC                                                              B
                                                    49 °F @ 2.5 GPM                                                AWG with ground
Current Rating (max.): 75 AMPS
                                                    40 °F @ 3.0 GPM
Energy Factor: 0.99+                                                                                            Mounting Holes:
Heating Elements : 4500 watts x 4                   30 °F @ 4.0 GPM            Dimensions:                      “A” Mount: 14 ¼” (362 mm)
Circuits Required: Two (2), 2-wire w/ ground                                   Weight: 23 lbs (10.4 kg)         “B” Mount: 16 1/8” (410 mm)
Breakers Required: Two (2), double-pole              Rise (Deg C)
                                                                               Height:   15 ¾” (400 mm)
Breaker Size: 40 AMPS each x 2                      @ Flow (L/Min.)            Width:     15 ¾” (400 mm)
Temp. Output (dial): 90F to 130F (32C - 52C)*      32 °C @ 8 L/min                                              Approvals:
                                                                               Depth:    6 ¼” (159 mm)
                                                   26 °C @ 10 L/min            Fittings: ¾” (200 mm)            U.L. CSA NSF
(*)Temp. output dial Factory set to 120F (49C).    21 °C @ 12 L/min                                             HUD NEC
(**)T&P Relief Valve not required by Mfg.          16 °C @ 16 L/min            Warranty is for Water Heating Applications only and does not cover
                                                                               use for residential or commercial sp ace heating applications.
                                                                                                    SEISCO® / Microtherm, Inc. RA-14

                                   //For Water Heating Applications//


Model RA-14                                                                                                Model RA-14

Two-Chamber Tankless Electric
Water Heater
Description: The RA-14 is excellent for point-of-use applications at
single showers and sinks. Ideal for supplementing existing tank-type
heaters that are unable to satisfy user requirements in beach houses, hair
salons, horse stables, hunting and fishing cabins. Great for small
apartment or condominium dwelling, where incoming water temperature
rarely drops below 75 degrees F. This on-demand tankless water heater is
the enabling technology for use as back-up to active renewable energy
systems such as solar and geothermal water heating systems. The
                                                                                                                   Exterior
temperature activated control works effectively in re-circulating systems
and in combination with tank-type heaters.

Features:
•   UL 499 Approval Listing for Water Heating Applications
•   Works with tubing and manifold systems                                               Interior
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   No moving parts
•   Very small & compact
•   Light weight modular construction
                                                                        INSTALLATION
•   No restriction to flow
•   Standard 3/4 inch plumbing connections
•   Microprocessor digital control                                        Outlet (Hot)***          Inlet (Cold)
                                                                                                                          Shut-Off
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics
•   Redundant safety devices
                                                                                                                          Two Breakers
•   High performance polymer nylon chamber material
                                                                                                                           240 VAC *
•   Rust & corrosion resistant

                                                                                   A           RA-                             30 A
Specifications:
Heat Output (max.): 47,780 BTU                                                                  14                             30 A
Power Rating (max.): 14KW                          Flow Ratings:
Voltage Rating (Nominal): 240 VAC                      Rise (Deg F)                                                2 pairs of # 8 cu
Current Rating (max.): 58 AMPS                        @ Flow (GPM)                                                AWG with ground
Energy Factor: 0.99+                                 95 °F @ 1.0 GPM                               B
Heating Elements : 7000 watts x 2                    64 °F @ 1.5 GPM
Circuits Required: Two (2), 2-wire w/ ground*        48 °F @ 2.0 GPM
Breakers Required: Two (2), double-pole*                                                                       Mounting Holes:
                                                     38 °F @ 2.5 GPM          Dimensions:
Breaker Size: 30 AMPS each x 2*                                                                                “A” Mount: 14 ¼” (362 mm)
Temp. Output (dial): 90F to 130F (32C - 52C)**                                Weight: 15 lbs (7.0 kg)          “B” Mount: 10 7/8” (276 mm)
                                                      Rise (Deg C)
                                                                              Height:   15 ¾” (400 mm)
                                                     @ Flow (L/Min.)          Width:    10 ¼” (260 mm)
(*)Optional one (1), 60 AMP circuit supply –         50 °C @ 4 L/min                                           Approvals:
                                                                              Depth:    6 ¼” (159 mm)
Check with manufacturer for jumpers that must                                                                  U.L. CSA NSF
                                                     33 °C @ 6 L/min          Fittings: ¾” (200 mm)
be installed on control board for this option.                                                                 HUD NEC
(**)Temp. output dial Factory set to 120F (49C).     25 °C @ 8 L/min
(***)T&P Relief Valve not required by Mfg.           20 °C @ 10 L/min         Warranty is for Water Heating Applications only and does not cover
                                                                              use for residential or commercial space heating applications.
                                                                                                   SEISCO® / Microtherm, Inc. RA-11

                                   //For Water Heating Applications//


Model RA-11                                                                                               Model RA-11

Two-Chamber Tankless Electric
Water Heater
Description: The RA-11 is excellent for point-of-use applications at
coffee bars, office & industrial warehouse wash sinks, single lavatory and
emergency showers; to comply with code. Perfect for RV’s and small
motor homes and supplements existing tank-type heaters. This on-demand
tankless water heater is the enabling technology for use as back-up to
active renewable energy systems such as solar and geothermal water
heating systems. The temperature activated control works effectively in                                          Exterior
re-circulating systems and in combination with tank-type heaters. Requires
only one 50 Amp, 240 VAC electric circuit.


Features:
•   UL 499 Approval Listing for Water Heating Applications
•   Works with tubing and manifold systems                                              Interior
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   No moving parts
•   Very small & compact
•   Light weight modular construction
                                                                       INSTALLATION
•   No restriction to flow
•   Standard 3/4 inch plumbing connections
•   Microprocessor digital control                                        Outlet (Hot)**          Inlet (Cold)
                                                                                                                         Shut-Off
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics
•   Redundant safety devices
•   High performance polymer nylon chamber material                                                                      One Breaker
•   Rust & corrosion resistant                                                                                            240 VAC

                                                                                  A           RA-
                                                                                                                              50 A
Specifications:                                                                                11
Heat Output (max.): 37,540 BTU                    Flow Ratings:
Power Rating (max.): 11 KW                            Rise (Deg F)                                            1 pair of # 6 cu AWG
Voltage Rating (Nominal): 240 VAC                    @ Flow (GPM)                                                 with ground
Current Rating (max.): 46 AMPS                      75 °F @ 1.0 GPM                               B
Energy Factor: 0.9 9+                               50 °F @ 1.5 GPM
Heating Elements : 5500 watts x 2                   37 °F @ 2.0 GPM
Circuits Required: One (1), 2 -wire w/ ground                                                                 Mounting Holes:
                                                    30 °F @ 2.5 GPM          Dimensions:
Breakers Required: One (1), double-pole                                                                       “A” Mount: 14 ¼” (362 mm)
Breaker Size: 50 AMPS each x 1                                               Weight: 15 lbs (7.0 kg)          “B” Mount: 10 7/8” (276 mm)
                                                     Rise (Deg C)
Temp. Output (dial): 90F to 130F (32C - 52C)*                                Height:   15 ¾” (400 mm)
                                                    @ Flow (L/Min.)          Width:    10 ¼” (260 mm)
                                                    39 °C @ 4 L/min                                           Approvals:
(*)Temp. output dial Factory set to 120F (49C).                              Depth:    6 ¼” (159 mm)
                                                    26 °C @ 6 L/min          Fittings: ¾” (200 mm)            U.L. CSA NSF
(**)T&P Relief Valve not required by Mfg.
                                                    20 °C @ 8 L/min                                           HUD NEC
                                                    16 °C @ 10 L/min         Warranty is for Water Heating Applications only and does not cover
                                                                             use for residential or commercial space heating applications.
                                                                                                   SEISCO® / Microtherm, Inc. RA-09

                                   //For Water Heating Applications//


Model RA-09                                                                                               Model RA-09

Two-Chamber Tankless Electric
Water Heater
Description: The RA-09 is excellent for point-of-use applications at
coffee bars, office & industrial warehouse wash sinks, single lavatory and
emergency showers; to comply with code. Perfect for RV’s and small
motor homes and supplements existing tank-type heaters. This on-demand
tankless water heater is the enabling technology for use as back-up to
active renewable energy systems such as solar and geothermal water
heating systems. The temperature activated control works effectively in
re-circulating systems and in combination with tank-type heaters. Requires
                                                                                                                 Exterior
only one 40 Amp, 240 VAC electric circuit.


Features:
•   UL 499 Approval Listing for Water Heating Applications
•   Works with tubing and manifold systems                                              Interior
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   No moving parts
•   Very small & compact
•   Light weight modular construction
                                                                       INSTALLATION
•   No restriction to flow
•   Standard 3/4 inch plumbing connections
•   Microprocessor digital control                                        Outlet (Hot)**          Inlet (Cold)
                                                                                                                         Shut-Off
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics
•   Redundant safety devices
•   High performance polymer nylon chamber material                                                                      One Breaker
•   Rust & corrosion resistant                                                                                            240 VAC

                                                                                  A           RA-
                                                                                                                              40 A
Specifications:                                                                                09
Heat Output (max.): 30,710 BTU                    Flow Ratings:
Power Rating (max.): 9 KW                             Rise (Deg F)                                            1 pair of # 8 cu AWG
Voltage Rating (Nominal): 240 VAC                    @ Flow (GPM)                                                 with ground
Current Rating (max.): 37.5 AMPS                    61 °F @ 1.0 GPM                               B
Energy Factor: 0.99+                                40 °F @ 1.5 GPM
Heating Elements : 4500 watts x 2                   30 °F @ 2.0 GPM
Circuits Required: One (1), 2 -wire w/ ground                                Dimensions:                      Mounting Holes:
                                                    24 °F @ 2.5 GPM
Breakers Required: One (1), double-pole                                      Weight: 15 lbs (7.0 kg)          “A” Mount: 14 ¼” (362 mm)
Breaker Size: 40 AMPS each x 1                       Rise (Deg C)            Height:   15 ¾” (400 mm)         “B” Mount: 10 7/8” (276 mm)
Temp. Output (dial): 90F to 130F (32C - 52C)*                                Width:    10 ¼” (260 mm)
                                                    @ Flow (L/Min.)
                                                                             Depth:    6 ¼” (159 mm)          Approvals:
                                                    32 °C @ 4 L/min          Fittings: ¾” (200 mm)
(*)Temp. output dial Factory set to 120F (49C).                                                               U.L. CSA NSF
(**)T&P Relief Valve not required by Mfg.           21 °C @ 6 L/min
                                                    16 °C @ 8 L/min                                           HUD NEC
                                                    13 °C @ 10 L/min         Warranty is for Water Heating Applications only and does not cover
                                                                             use for residential or commercial space heating applications.
                                                                                                    SEISCO® / Microtherm, Inc. RA-07

                                   //For Water Heating Applications//


Model RA-07                                                                                                Model RA-07

Two-Chamber Tankless Electric
Water Heater
Description: The RA-07 is excellent for point-of-use applications at
coffee bars; office & industrial warehouse wash sinks, and single lavatory
faucets; to comply with code. Perfect for RV’s and small motor homes and
supplements existing tank-type heaters. This on-demand tankless water
heater is the enabling technology for use as back-up to active renewable
energy systems such as solar and geothermal water heating systems. The
temperature activated control works effectively in re-circulating systems
and in combination with tank-type heaters. Requires only one 30 Amp,
                                                                                                               Exterior
240 VAC electric circuit.


Features:
•   UL 499 Approval Listing for Water Heating Applications
•   Works with tubing and manifold systems                                               Interior
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   No moving parts
•   Very small & compact
•   Light weight modular construction
                                                                        INSTALLATION
•   No restriction to flow
•   Standard 3/4 inch plumbing connections
•   Microprocessor digital control                                         Outlet (Hot)**          Inlet (Cold)
                                                                                                                          Shut-Off
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics
•   Redundant safety devices
•   High performance polymer nylon chamber material                                                                       One Breaker
•   Rust & corrosion resistant                                                                                             240 VAC

                                                                                   A           RA-
                                                                                                                               30 A
Specifications:                                                                                 07
Heat Output (max.): 23,890 BTU                    Flow Ratings:
Power Rating (max.): 7 KW                             Rise (Deg F)                                             1 pair of # 8 cu AWG
Voltage Rating (Nominal): 240 VAC                    @ Flow (GPM)                                                  with ground
Current Rating (max.): 29 AMPS                     64 °F @ 0.75 GPM                                B
Energy Factor: 0.99+                               48 °F @ 1.0 GPM
Heating Elements : 3500 watts x 2                  32 °F @ 1.5 GPM
Circuits Required: One (1), 2 -wire w/ ground                                 Dimensions:                      Mounting Holes:
                                                   24 °F @ 2.0 GPM
Breakers Required: One (1), double-pole                                       Weight: 15 lbs (7.0 kg)          “A” Mount: 14 ¼” (362 mm)
Breaker Size: 30 AMPS each x 1                       Rise (Deg C)             Height:   15 ¾” (400 mm)         “B” Mount: 10 7/8” (276 mm)
Temp. Output (dial): 90F to 130F (32C - 52C)*                                 Width:    10 ¼” (260 mm)
                                                    @ Flow (L/Min.)
                                                                              Depth:    6 ¼” (159 mm)          Approvals:
                                                    34 °C @ 3   L/min         Fittings: ¾” (200 mm)
(*)Temp. output dial Factory set to 120F (49C).                                                                U.L. CSA NSF
(**)T&P Relief Valve not required by Mfg.           25 °C @ 4   L/min
                                                    17 °C @ 6   L/min                                          HUD NEC
                                                    12 °C @ 8   L/min         Warranty is for Water Heating Applications only and does not cover
                                                                              use for residential or commercial space heating applications.
                                                                                                    SEISCO® / Microtherm, Inc. RA-05

                                   //For Water Heating Applications//


Model RA-05                                                                                                Model RA-05

Two-Chamber Tankless Electric
Water Heater
Description: The RA-05 is ideal for point-of-use applications at coffee
bars; office & industrial warehouse wash sinks, and single lavatory
faucets; to comply with code. Perfect for RV’s and small motor homes and
supplements existing tank-type heaters. This on-demand tankless water
heater is the enabling technology for use as back-up to active renewable
energy systems such as solar and geothermal water heating systems. The
temperature activated control works effectively in re-circulating systems
and in combination with tank-type heaters. Requires only one 30 Amp,
                                                                                                               Exterior
240 VAC electric circuit.


Features:
•   UL 499 Approval Listing for Water Heating Applications
•   Works with tubing and manifold systems                                             Interior
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   No moving parts
•   Very small & compact
•   Light weight modular construction
                                                                        INSTALLATION
•   No restriction to flow
•   Standard 3/4 inch plumbing connections
•   Microprocessor digital control                                         Outlet (Hot)**          Inlet (Cold)
                                                                                                                          Shut-Off
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics
•   Redundant safety devices
•   High performance polymer nylon chamber material                                                                       One Breaker
•   Rust & corrosion resistant                                                                                             240 VAC

                                                                                   A           RA-
                                                                                                                               30 A
                                                                                                05
Specifications:                                   Flow Ratings:
Heat Output (max.): 17,060 BTU                        Rise (Deg F)                                                 1 pair of # 10 cu
Power Rating (max.): 5 KW                            @ Flow (GPM)                                                 AWG with ground
Voltage Rating (Nominal): 240 VAC                  46 °F @ 0.75 GPM
Current Rating (max.): 21 AMPS                                                                     B
                                                   34 °F @ 1.0 GPM
Energy Factor: 0.99+
                                                   23 °F @ 1.5 GPM
Heating Ele ments : 2500 watts x 2                                                                             Mounting Holes:
Circuits Required: One (1), 2 -wire w/ ground      17 °F @ 2.0 GPM            Dimensions:                      “A” Mount: 14 ¼” (362 mm)
Breakers Required: One (1), double-pole                                       Weight: 15 lbs (7.0 kg)          “B” Mount: 10 7/8” (276 mm)
                                                     Rise (Deg C)
Breaker Size: 30 AMPS each x 1                                                Height:   15 ¾” (400 mm)
                                                    @ Flow (L/Min.)
Temp. Output (dial): 90F to 130F (32C - 52C)*                                 Width:    10 ¼” (260 mm)
                                                    24 °C @ 3   L/min                                          Approvals:
                                                                              Depth:    6 ¼” (159 mm)
                                                    18 °C @ 4   L/min         Fittings: ¾” (200 mm)            U.L. CSA NSF
(*)Temp. output dial Factory set to 120F (49C).
(**)T&P Relief Valve not required by Mfg.           12 °C @ 6   L/min                                          HUD NEC
                                                    9 °C @ 8    L/min         Warranty is for Water Heating Applications only and does not cover
                                                                              use for residential or commercial space heating applications.
                                                                                                       SEISCO® / Microtherm, Inc. SH -28

                                      For Space Heating Applications


Model SH-28                                                                                           Model SH-28

Four-Chamber Tankless Electric
Micro-Boiler
Description: The Model SH-28 four-chamber tankless electric space
heater is designed for use in residential and commercial hydronic space
heating applications such as, but not limited to, radiant floor heating,
baseboard, hydro-heat pump and snow melting systems. This new micro-
boiler is the ideal replacement for traditional boilers and tank-type heaters
and is the enabling technology for use with active renewable energy
systems such as solar and geothermal systems. The temperature activated                                      Exterior
control works effectively in low pressure and re-circulating systems. With
optional equipment, the SH-28 can be used as the single heat source in
combination systems for potable hot water and space heating. A minimum
of 200 AMP whole house electrical service is recommended.

Features:
•   UL 834 Approval Lis ting for Space Heating Applications                     Interior
•   Works with tubing and manifold systems
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   Heats fluid mixtures including ethylene glycol (antifreeze)
•   No moving parts
•   Very small & compact                                               INSTALLATION
•   Light weight modular construction                                           Outlet                     Inlet
•   No restriction to flow                                                                                                 Shut-Off
•   Standard 3/4 inch plumbing connections
•   Microprocessor digital control
•   Power sharing & variable power control technology
•   Continuous venting                                                                                                       Four Breakers
                                                                                                                              240 VAC *
•   Heats continuously only when needed, no storage
•   Self-diagnostics
•   Redundant safety devices                                                                                                      40 A
•   High performance polymer nylon chamber material                             A                                                 40 A
•   Built-in Leak detector and alarm
                                                                                            SH-28
•   Rust & corrosion resistant                                                                                                    40 A

                                                   Flow Ratings:                                                                  40 A
Specifications:                                       Ris e (Deg F)
Heat Output (max.): 95,560 BTU                       @ Flow (GPM)                                                     4 pairs of # 8 cu
Power Rating (max.): 28KW                                                                        B
                                                     95 °F @ 2.0 GPM                                                 AWG with ground
Voltage Rating (Nominal): 240 VAC
                                                     76 °F @ 2.5 GPM
Current Rating (max.): 116 AMPS                                                                                    Mounting Holes:
                                                     64 °F @ 3.0 GPM
Energy Factor: 0.99+                                                             Dimensions:                       “A” Mount: 14 ¼” (362 mm)
Heating Elements : 7000 watts x 4                    48 °F @ 4.0 GPM
                                                                                 Weight: 23 lbs (10.4 kg)          “B” Mount: 16 1/8” (410 mm)
Circuits Required: Four (4), 2-wire w/ ground*                                   Height:   15 ¾” (400 mm)
Breakers Required: Four (4), double-pole*             Rise (Deg C)
                                                                                 Width:     15 ¾” (400 mm)
Breaker Size: 40 AMPS each x 4*                      @ Flow (L/Min.)                                               Approvals:
                                                                                 Depth:    6 ¼” (159 mm)
                                                    50 °C @ 8 L/min              Fittings: ¾” (200 mm)             U.L. CSA NSF
*Optional two (2), 75 AMP circuit supply –          40 °C @ 10 L/min                                               HUD NEC
Check with manufacturer for jumpers that must be    33 °C @ 12 L/min
                                                                                 Warranty is for Space Heating Applications only and does not cover
installed on control board for this option.         25 °C @ 16 L/min             use for residential or commercial water heating applications.
                                                                                                       SEISCO® / Microtherm, Inc. SH -22

                                      For Space Heating Applications


Model SH-22                                                                                           Model SH-22

Four-Chamber Tankless Electric
Micro-Boiler
Description: The Model SH-22 four-chamber tankless electric space
heater is designed for use in residential and commercial hydronic space
heating applications such as, but not limited to, radiant floor heating,
baseboard, hydro-heat pump and snow melting systems. This new micro-
boiler is the ideal replacement for traditional boilers and tank-type heaters
and is the enabling technology for use with active renewable energy
systems such as solar and geothermal systems. The temperature activated                                      Exterior
control works effectively in low pressure and re-circulating systems. With
optional equipment, the SH-22 can be used as the single heat source in
combination systems for potable hot water and space heating. A minimum
of 150 AMP whole house electrical service is recommended.

Features:
•   UL 834 Approval Listing for Space Heating Applications                      Interior
•   Works with tubing and manifold systems
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   Heats fluid mixtures including ethylene glycol (antifreeze)
•   No moving parts
•   Very small & compact                                              INSTALLATION
•   Light weight modular construction                                           Outlet                     Inlet
•   No restriction to flow                                                                                                 Shut-Off
•   Standard 3/4 inch plumbing connections
•   Microprocessor digital control
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage                                                                           Two Breakers
•   Self-diagnostics                                                                                                           240 VAC
•   Redundant safety devices
•   High performance polymer nylon chamber material                             A                                                 60 A
•   Built-in Leak detector and alarm
                                                                                            SH-22
•   Rust & corrosion resistant                                                                                                    60 A

                                                 Flow Ratings:
Specifications:                                       Rise (Deg F)
Heat Output (max.): 75,080 BTU                       @ Flow (GPM)                                                     2 pairs of # 6 cu
Power Rating (max.): 22KW                                                                        B
                                                    75 °F @ 2.0 GPM                                                  AWG with ground
Voltage Rating (Nominal): 240 VAC
                                                    60 °F @ 2.5 GPM
Current Rating (max.): 91 AMPS                                                                                     Mounting Holes:
                                                    50 °F @ 3.0 GPM
Energy Factor: 0.99+                                                             Dimensions:                       “A” Mount: 14 ¼” (362 mm)
Heating Elements : 5500 watts x 4                   37 °F @ 4.0 GPM
                                                                                 Weight: 23 lbs (10.4 kg)          “B” Mount: 16 1/8” (410 mm)
Circuits Required: Two (2), 2-wire w/ ground                                     Height:   15 ¾” (400 mm)
Breakers Required: Two (2), double-pole              Rise (Deg C)
                                                                                 Width:     15 ¾” (400 mm)
Breaker Size: 60 AMPS each x 2                      @ Flow (L/Min.)                                                Approvals:
                                                                                 Depth:    6 ¼” (159 mm)
                                                   39 °C @ 8 L/min               Fittings: ¾” (200 mm)             U.L. CSA NSF
                                                   31 °C @ 10 L/min                                                HUD NEC
                                                   26 °C @ 12 L/min
                                                                                 Warranty is for Space Heating Applications only and does not cover
                                                   20 °C @ 16 L/min              use for residential or commercial water heating applications.
                                                                                                       SEISCO® / Microtherm, Inc. SH -18

                                      For Space Heating Applications


Model SH-18                                                                                           Model SH-18

Four-Chamber Tankless Electric
Micro-Boiler
Description: The Model SH-18 four-chamber tankless electric space
heater is designed for use in residential and commercial hydronic space
heating applications such as, but not limited to, radiant floor heating,
baseboard, hydro-heat pump and snow melting systems. This new micro-
boiler is the ideal replacement for traditional boilers and tank-type heaters
and is the enabling technology for use with active renewable energy
systems such as solar and geothermal systems. The temperature activated                                      Exterior
control works effectively in low pressure and re-circulating systems. With
optional equipment, the SH-18 can be used as the single heat source in
combination systems for potable hot water and space heating. A minimum
of 125 AMP whole house electrical service is recommended.

Features:
•   UL 834 Approval Listing for Space Heating Applications                      Interior
•   Works with tubing and manifold systems
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   Heats fluid mixtures including ethylene glycol (antifreeze)
•   No moving parts
•   Very small & compact                                              INSTALLATION
•   Light weight modular construction                                           Outlet                     Inlet
•   No restriction to flow                                                                                                 Shut-Off
•   Standard 3/4 inch plumbing connections
•   Microprocessor digital control
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage                                                                          Two Breakers
•   Self-diagnostics                                                                                                          240 VAC
•   Redundant safety devices
•   High performance polymer nylon chamber material                             A                                                 50 A
•   Built-in Leak detector and alarm
                                                                                            SH-18
•   Rust & corrosion resistant                                                                                                    50 A
                                                 Flow Ratings:
                                                      Rise (Deg F)
Specifications:                                      @ Flow (GPM)
Heat Output (max.): 61,430 BTU                                                                                        2 pairs of # 8 cu
                                                    61 °F @ 2.0 GPM                              B
Power Rating (max.): 18KW                                                                                            AWG with ground
Voltage Rating (Nominal): 240 VAC                   49 °F @ 2.5 GPM
Current Rating (max.): 75 AMPS                      40 °F @ 3.0 GPM
                                                                                                                   Mounting Holes:
Energy Factor: 0.99+                                30 °F @ 4.0 GPM              Dimensions:                       “A” Mount: 14 ¼” (362 mm)
Heating Elements : 4500 watts x 4                                                Weight: 23 lbs (10.4 kg)          “B” Mount: 16 1/8” (410 mm)
Circuits Required: Two (2), 2-wire w/ ground         Rise (Deg C)
                                                                                 Height:   15 ¾” (400 mm)
Breakers Required: Two (2), double-pole             @ Flow (L/Min.)              Width:     15 ¾” (400 mm)
Breaker Size: 50 AMPS each x 2                     32 °C @ 8 L/min                                                 Approvals:
                                                                                 Depth:    6 ¼” (159 mm)
                                                   26 °C @ 10 L/min              Fittings: ¾” (200 mm)             U.L. CSA NSF
                                                   21 °C @ 12 L/min                                                HUD NEC
                                                   16 °C @ 16 L/min              Warranty is for Space Heating Applications only and does not cover
                                                                                 use for residential or commercial water heating applications.
                                                                                                      SEISCO® / Microtherm, Inc. SH -14

                                      For Space Heating Applications


Model SH-14                                                                                              Model SH-14

Two-Chamber Tankless Electric
Micro-Boiler
Description: The Model SH-14 two-chamber tankless electric space
heater is designed for use in residential and commercial hydronic space
heating applications such as, but limited to, radiant floor heating,
baseboard, hydro-heat pump and snow melting systems. This new micro-
boiler is the ideal replacement for traditional boilers and tank-type heaters
and is the enabling technology for use with active renewable energy
systems such as solar and geothermal systems. The temperature activated
control works effectively in low pressure and re-circulating systems.
                                                                                                            Exterior
Perfect for cabins, room additions, small condos, shops, garages, etc.


Features:
•   UL 834 Approval Listing for Space Heating Applications
•   Works with tubing and manifold systems                                            Interior
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   Heats fluid mixtures including ethylene glycol (antifreeze)
•   No moving parts
•   Very small & compact
•   Light weight modular construction                                  INSTALLATION
•   No restriction to flow
•   Standard 3/4 inch plumbing connections                                         Outlet                 Inlet
                                                                                                                            Shut-Off
•   Microprocessor digital control
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics
                                                                                                                            Two Breakers
•   Redundant safety devices
                                                                                                                             240 VAC *
•   High performance polymer nylon chamber material
•   Built-in Leak detector and alarm
•   Rust & corrosion resistant                                                       A           SH-                             40 A

                                                                                                  14                             40 A
                                                 Flow Ratings:
Specifications:                                       Rise (Deg F)                                                 2 pairs of # 8 cu
Heat Output (max.): 47,780 BTU                       @ Flow (GPM)                                                 AWG with ground
Power Rating (max.): 14KW                           95 °F @ 1.0 GPM
Voltage Rating (Nominal): 240 VAC                                                                    B
                                                    64 °F @ 1.5 GPM
Current Rating (max.): 58 AMPS
                                                    48 °F @ 2.0 GPM
Energy Factor: 0.99+                                                                                              Mounting Holes:
Heating Elements : 7000 watts x 2                   38 °F @ 2.5 GPM             Dimensions:                       “A” Mount: 14 ¼” (362 mm)
Circuits Required: Two (2), 2-wire w/ ground*                                   Weight:     15 lbs (7.0 kg)       “B” Mount: 10 7/8” (276 mm)
Breakers Required: Two (2), double-pole*             Rise (Deg C)
                                                                                Height:     15 ¾” (400 mm)
Breaker Size: 40 AMPS each x 2*                     @ Flow (L/Min.)             Width:      10 ¼” (260 mm)
                                                    50 °C @ 4 L/min                                               Approvals:
                                                                                Depth:      6 ¼” (159 mm)
*Optional one (1), 75 AMP circuit supply –          33 °C @ 6 L/min             Fittings:   ¾” (200 mm)           U.L. CSA NSF
Check with manufacturer for jumpers that must       25 °C @ 8 L/min                                               HUD NEC
be installed on control board for this option.      20 °C @ 10 L/min            Warranty is for Space Heating Applications only and does not cover
                                                                                use for residential or commercial water heating applications.
                                                                                                      SEISCO® / Microtherm, Inc. SH -11

                                      For Space Heating Applications


Model SH-11                                                                                              Model SH-11

Two-Chamber Tankless Electric
Micro-Boiler
Description: The Model SH-11 two-chamber tankless electric space
heater is designed for use in residential and commercial hydronic space
heating applications such as, but limited to, radiant floor heating,
baseboard, hydro-heat pump and snow melting systems. This new micro-
boiler is the ideal replacement for traditional boilers and tank-type heaters
and is the enabling technology for use with active renewable energy
systems such as solar and geothermal systems. The temperature activated
control works effectively in low pressure and re-circulating systems.
                                                                                                            Exterior
Perfect for cabins, room additions, small condos, shops, garages, etc.


Features:
•   UL 834 Approval Listing for Space Heating Applications
•   Works with tubing and manifold systems                                            Interior
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   Heats fluid mixtures including ethylene glycol (antifreeze)
•   No moving parts
•   Very small & compact
•   Light weight modular construction                                  INSTALLATION
•   No restriction to flow
•   Standard 3/4 inch plumbing connections                                         Outlet                 Inlet
                                                                                                                            Shut-Off
•   Microprocessor digital control
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics
•   Redundant safety devices                                                                                                One Breaker
•   High performance polymer nylon chamber material                                                                          240 VAC
•   Built-in Leak detector and alarm
•   Rust & corrosion resistant                                                       A           SH-
                                                                                                                                 60 A
                                                                                                  11
                                                 Flow Ratings:
Specifications:                                       Rise (Deg F)                                                1 pair of # 6 cu AWG
Heat Output (max.): 37,540 BTU                       @ Flow (GPM)                                                     with ground
Power Rating (max.): 11 KW                          75 °F @ 1.0 GPM
Voltage Rating (Nominal): 240 VAC                                                                    B
                                                    50 °F @ 1.5 GPM
Current Rating (max.): 46 AMPS
                                                    37 °F @ 2.0 GPM
Energy Factor: 0.99+                                                                                              Mounting Holes:
Heating Elements : 5500 watts x 2                   30 °F @ 2.5 GPM             Dimensions:                       “A” Mount: 14 ¼” (362 mm)
Circuits Required: One (1), 2 -wire w/ ground                                   Weight: 15 lbs (7.0 kg)           “B” Mount: 10 7/8” (276 mm)
Breakers Required: One (1), double-pole              Rise (Deg C)
                                                                                Height:   15 ¾” (400 mm)
Breaker Size: 60 AMPS each x 1                      @ Flow (L/Min.)             Width:    10 ¼” (260 mm)
                                                    39 °C @ 4 L/min                                               Approvals:
                                                                                Depth:    6 ¼” (159 mm)
                                                    26 °C @ 6 L/min             Fittings: ¾” (200 mm)             U.L. CSA NSF
                                                    20 °C @ 8 L/min                                               HUD NEC
                                                    16 °C @ 10 L/min            Warranty is for Space Heating Applications only and does not cover
                                                                                use for residential or commercial water heating applications.
                                                                                                      SEISCO® / Microtherm, Inc. SH -09

                                      For Space Heating Applications


Model SH-09                                                                                              Model SH-09

Two-Chamber Tankless Electric
Micro-Boiler
Description: The Model SH-09 two-chamber tankless electric space
heater is designed for use in residential and commercial hydronic space
heating applications such as, but limited to, radiant floor heating,
baseboard, hydro-heat pump and snow melting systems. This new micro-
boiler is the ideal replacement for traditional boilers and tank-type heaters
and is the enabling technology for use with active renewable energy
systems such as solar and geothermal systems. The temperature activated
control works effectively in low pressure and re-circulating systems.
                                                                                                            Exterior
Perfect for driveway snow melting, room additions, small shops, garages,
etc.

Features:
•   UL 834 Approval Listing for Space Heating Applications
•   Works with tubing and manifold systems                                            Interior
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   Heats fluid mixtures including ethylene glycol (antifreeze)
•   No moving parts
•   Very small & compact
•   Light weight modular construction                                  INSTALLATION
•   No restriction to flow
•   Standard 3/4 inch plumbing connections                                         Outlet                 Inlet
                                                                                                                            Shut-Off
•   Microprocessor digital control
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics
•   Redundant safety devices                                                                                                One Breaker
•   High performance polymer nylon chamber material                                                                          240 VAC
•   Built-in Leak detector and alarm
•   Rust & corrosion resistant                                                       A           SH-
                                                                                                                                 50 A
                                                                                                  09
                                                 Flow Ratings:
Specifications:                                       Rise (Deg F)                                                1 pair of # 8 cu AWG
Heat Output (max.): 30,710 BTU                       @ Flow (GPM)                                                     with ground
Power Rating (max.): 9 KW                           61 °F @ 1.0 GPM
Voltage Rating (Nominal): 240 VAC                                                                    B
                                                    40 °F @ 1.5 GPM
Current Rating (max.): 37.5 AMPS
                                                    30 °F @ 2.0 GPM
Energy Factor: 0.99+                                                            Dimensions:                       Mounting Holes:
Heating Elements : 4500 watts x 2                   24 °F @ 2.5 GPM
                                                                                Weight: 15 lbs (7.0 kg)           “A” Mount: 14 ¼” (362 mm)
Circuits Required: One (1), 2 -wire w/ ground                                   Height:   15 ¾” (400 mm)          “B” Mount: 10 7/8” (276 mm)
Breakers Required: One (1), double-pole              Rise (Deg C)
                                                                                Width:    10 ¼” (260 mm)
Breaker Size: 50 AMPS each x 1                      @ Flow (L/Min.)
                                                                                Depth:    6 ¼” (159 mm)           Approvals:
                                                    32 °C @ 4 L/min             Fittings: ¾” (200 mm)
                                                    21 °C @ 6 L/min                                               U.L. CSA NSF
                                                    16 °C @ 8 L/min                                               HUD NEC
                                                    13 °C @ 10 L/min            Warranty is for Space Heating Applications only and does not cover
                                                                                use for residential or commercial water heating applications.
                                                                                                      SEISCO® / Microtherm, Inc. SH -07

                                      For Space Heating Applications


Model SH-07                                                                                              Model SH-07

Two-Chamber Tankless Electric
Micro-Boiler
Description: The Model SH-07 two-chamber tankless electric space
heater is designed for use in residential and commercial hydronic space
heating applications such as, but limited to, radiant floor heating,
baseboard, hydro-heat pump and snow melting systems. This new micro-
boiler is the ideal replacement for traditional boilers and tank-type heaters
and is the enabling technology for use with active renewable energy
systems such as solar and geothermal systems. The temperature activated
control works effectively in low pressure and re-circulating systems.
                                                                                                            Exterior
Perfect for driveway snow melting, room additions, small shops, garages,
etc.

Features:
•   UL 834 Approval Listing for Space Heating Applications
•   Works with tubing and manifold systems                                            Interior
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   Heats fluid mixtures including ethylene glycol (antifreeze)
•   No moving parts
•   Very small & compact
•   Light weight modular construction                                   INSTALLATION
•   No restriction to flow
•   Standard 3/4 inch plumbing connections                                         Outlet                 Inlet
                                                                                                                            Shut-Off
•   Microprocessor digital control
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics
•   Redundant safety devices                                                                                                One Breaker
•   High performance polymer nylon chamber material                                                                          240 VAC
•   Built-in Leak detector and alarm
•   Rust & corrosion resistant                                                       A           SH-
                                                                                                                                 40 A
                                                                                                  07
                                                 Flow Ratings:
Specifications:                                       Rise (Deg F)                                                1 pair of # 8 cu AWG
Heat Output (max.): 23,890 BTU                       @ Flow (GPM)                                                     with ground
Power Rating (max.): 7 KW                          64 °F @ 0.75 GPM
Voltage Rating (Nominal): 240 VAC                                                                    B
                                                   48 °F @ 1.0 GPM
Current Rating (max.): 29 AMPS
                                                   32 °F @ 1.5 GPM
Energy Factor: 0.99+                                                            Dimensions:                       Mounting Holes:
Heating Elements : 3500 watts x 2                  24 °F @ 2.0 GPM
                                                                                Weight: 15 lbs (7.0 kg)           “A” Mount: 14 ¼” (362 mm)
Circuits Required: One (1), 2 -wire w/ ground                                   Height:   15 ¾” (400 mm)          “B” Mount: 10 7/8” (276 mm)
Breakers Required: One (1), double-pole              Rise (Deg C)
                                                                                Width:    10 ¼” (260 mm)
Breaker Size: 40 AMPS each x 1                      @ Flow (L/Min.)
                                                                                Depth:    6 ¼” (159 mm)           Approvals:
                                                    34 °C @ 3   L/min           Fittings: ¾” (200 mm)
                                                    25 °C @ 4   L/min                                             U.L. CSA NSF
                                                    17 °C @ 6   L/min                                             HUD NEC
                                                    12 °C @ 8   L/min           Warranty is for Space Heating Applications only and does not cover
                                                                                use for residential or commercial water heating applications.
                                                                                                      SEISCO® / Microtherm, Inc. SH -05

                                      For Space Heating Applications


Model SH-05                                                                                              Model SH-05

Two-Chamber Tankless Electric
Micro-Boiler
Description: The Model SH-05 two-chamber tankless electric space
heater is designed for use in residential and commercial hydronic space
heating applications such as, but limited to, radiant floor heating,
baseboard, hydro-heat pump and snow melting systems. This new micro-
boiler is the ideal replacement for traditional boilers and tank-type heaters
and is the enabling technology for use with active renewable energy
systems such as solar and geothermal systems. The temperature activated
control works effectively in low pressure and re-circulating systems.
                                                                                                            Exterior
Perfect for driveway snow melting, room additions, small shops, garages,
etc.

Features:
•   UL 834 Approval Listing for Space Heating Applications
•   Works with tubing and manifold systems                                            Interior
•   No minimum flow activation required
•   Built-in DSM Utility Integration option
•   Compatible with Home Energy Management Systems
•   Heats fluid mixtures including ethylene glycol (antifreeze)
•   No moving parts
•   Very small & compact
•   Light weight modular construction                                   INSTALLATION
•   No restriction to flow
•   Standard 3/4 inch plumbing connections                                         Outlet                 Inlet
                                                                                                                            Shut-Off
•   Microprocessor digital control
•   Power sharing & variable power control technology
•   Continuous venting
•   Heats continuously only when needed, no storage
•   Self-diagnostics
•   Redundant safety devices                                                                                                One Breaker
•   High performance polymer nylon chamber material                                                                          240 VAC
•   Built-in Leak detector and alarm
•   Rust & corrosion resistant                                                       A           SH-
                                                                                                                                 30 A
                                                                                                  05
                                                 Flow Ratings:
Specifications:                                       Rise (Deg F)                                                 1 pair of # 10 cu
Heat Output (max.): 17,060 BTU                       @ Flow (GPM)                                                 AWG with ground
Power Rating (max.): 5 KW                          46 °F @ 0.75 GPM
Voltage Rating (Nominal): 240 VAC                                                                    B
                                                   34 °F @ 1.0 GPM
Current Rating (max.): 21 AMPS
                                                   23 °F @ 1.5 GPM
Energy Factor: 0.99+                                                                                              Mounting Holes:
Heating Elements : 2500 watts x 2                  17 °F @ 2.0 GPM              Dimensions:                       “A” Mount: 14 ¼” (362 mm)
Circuits Required: One (1), 2 -wire w/ ground                                   Weight: 15 lbs (7.0 kg)           “B” Mount: 10 7/8” (276 mm)
Breakers Required: One (1), double-pole              Rise (Deg C)
                                                                                Height:   15 ¾” (400 mm)
Breaker Size: 30 AMPS each x 1                      @ Flow (L/Min.)             Width:    10 ¼” (260 mm)
                                                    24 °C @ 3   L/min                                             Approvals:
                                                                                Depth:    6 ¼” (159 mm)
                                                    18 °C @ 4   L/min           Fittings: ¾” (200 mm)             U.L. CSA NSF
                                                    12 °C @ 6   L/min                                             HUD NEC
                                                    9 °C @ 8    L/min           Warranty is for Space Heating Applications only and does not cover
                                                                                use for residential or commercial water heating applications.

								
To top