Documents
Resources
Learning Center
Upload
Plans & pricing Sign in
Sign Out

Supplemental Table S1 - Exon

VIEWS: 42 PAGES: 30

									                                          Fasta
               Numb                       of
               er of                      ESTs
               seque                      and
               nces                       name
               and                        of       Numb                            Avera
               link to             Qual   larger   er of                            ge
               TSA     Lengh PolyA and    seque    seque Larger      Larger   Fram Resul
Contig link    file    t     at    link   nce      nces orf (nt)     pep        e    t
Putative secreted class
  Enzymes
    Serine proteases
clust4-11-3       1    1177          25   XWANG4      1        387             6    Cyt
                                                                     TNIIXAMYXPRYRSLXHKIVNSXASXVVVXCAS
clust4-11-4       1     934          25   A06-sc-p1   1        432             2    Cyt
                                                                     TKTPFTWSSAVAPVTLPTGGSTPTGNAILYGW
clust4-5-4        1    1151          25   F11-sc-p6   1       1113             2   SIG
                                                                     QMSPSGLKQMRCLNAVYLLVAIFSLSPVTTLAQ
clust4-19-4       1     709          25   C12-sc-p3   1        612             3    Cyt
                                                                     XDRLMAGQDNIALTSAGCVSGVKATDIEVVGG
clust4-17-3       6     890          81   B08-sc-p6   6        786             3   SIG
                                                                     NEDDNQTVMAFASFVKKQIVVFVLLWMGAESA
clust4-4-4        2     915          36   F03-sc-p1   2        792             1   SIG
                                                                     LKFQHVNMTKRVLLIFCVLYLALGHREGEAQRP
clust4-9-2        1    1032   1013   25   B7          1        234             2    Cyt
                                                                     QXTFVXVITTRAXYKXNVSXVKMXEISIAFXWY
      Nucleases
clust4-35-4       1    840           25   G02-sc-p1 1                        3   SIG
                                                               303 NPKTGIMKICGPKLSLCGLIVSVWGIIQLVLMGL
clust4-42-3       3    950           34   E05-sc-p7 3                        1   SIG
                                                               660 YKDLSLNGLGFKMTKFFIVPTWFCALAIAANAW
   Antigen 5 family
clust4-27-2       85    999    969   96   B10-sc-p7 85                       2   SIG
                                                               840 TGSPYGRGVKHWNLKELSFRMQHLSLFIFIASS
clust4-27-3       47   1083   1056   87   G9        47                       1   SIG
                                                               813 KRTVLENSLSRMEYLSLFIFIASSIAVAVYGQNT
clust4-27-4        1    890          25   F11-sc-p1 1                        1   SIG
                                                               723 NIGISRNCLSRMQHLSLFIFIASSIAGAVYGQNT
   Possible protease inhibitors
clust4-14-2     100    2136          57   H12_sc_p800
                                                   1          1041             2   SIG
                                                                     KISSDFSQDPNNRFSGGNHQFGRXIKMIMTXX
clust4-15-16     1      832          25   H09-sc-p1 1          666             1   SIG
                                                                     VPXSPLAGEQLQNEVLNCYWYFSSFGCKPAQ
clust4-17-4      1      454   429    25   E02-sc-p1 1          267             3   SIG
                                                                     SVHLFEKFENKKLLNVKMKLSMVLILMAVALSG
clust4-21-3      5      521   494    49   E12-sc-p8 5          303             1   SIG
                                                                     FSKMFSAKTFLFLTFILTIIVAINSTCPESCDDPE
   Very negative secreted proteins - large thrombostasin assemblies
clust4-15-4       31   1880          75   E07-sc-p5 31        1713             2   SIG
                                                                     RIALWPGSSCKMKFLTVIGILVLSAVSQAQNGL
clust4-15-5        1   1342          25   G04-sc-p4 1         1119             4   SIG
                                                                     GGXGXXRXPRGXGNPQGSXRGXXIPXXPXGG
clust4-15-11       2   1272   1253   32   A03-sc-p7 2          954             1   SIG
                                                                     PDSPLAGDXSCKMKFLTVIGILVLSAVSQAQNG
clust4-15-6        1   1340          25   F06-sc-p4 1         1119             5   SIG
                                                                     XFPGIPRXXQEPXGSHGXSGXPXGVFRDFXXX
   Immunity related
clust4-22-3       3    436    409    47   A09-sc-p5   3        321               2   SIG
                                                                     CRXRLMAGELIFNISKRKISSKKKMRFLLIFALIC
clust4-11-1       1    442    414    25   H05-sc-p8   1        345               3   SIG
                                                                     PXSPYGRGVXYNQEQRSIIMKFFGLYLLVACIL
clust4-43-6       1    417    392    25   G11-sc-p5   1        255               5   SIG
                                                                     IISLFLLNKICLPENLKKINFEFLHHTSASLELASS
clust4-10-4       1    391    363    25   C02-sc-p2   1        279               1   Cyt
                                                                     GPDRLMAGGFDFNKNSGSLDWSNAGGHGAN
   Secreted peptides of unknown function
clust4-22-4        6   510    484    80   E02-sc-p4 6          399               2     SIG
                                                                     GSPYGRGFGRLQETGMKMFYNKILFVGLISQIA
clust4-11-7        8   597    569    92   H12-21120028         396               6     SIG
                                                                     FFFFFFFFFANTLRNFFLFKIVAYFSNRSPSEIF
clust4-39-1       16   589    495    87   A09       16         423               2     SIG
                                                                     DRIALWPGDYVEKSDMKYFVVISLGIIALAVSSF
clust4-26-4       53   672    600    91   E12-sc-p4 53         474               4     SIG
                                                                     IMILILASSLIKIEILAEFIHSSVEGIISLIVVGIIFTDA
clust4-47-2        4   548    508    45   F07-sc-p5 4          402               6     SIG
                                                                     KKAQRSRAGPVQLVFIQFLEFNVITYLPSSFSW
clust4-39-4        1   413    389    25   A10-sc-p8 1          369               2     SIG
                                                                     DRSRNVLSPHNKFWLHLFALIDVFYKQTNKPLF
clust4-28-4        2   986    962    33   E12-sc-p3 2          813               2     SIG
                                                                     TCEMLSQKLRDQSIFVIIYVYFVLKISLTICGPQG
clust4-44-3    42      763   739    92   E09-sc-p4 42    579              2  SIG
                                                                WTGSPYGRGPFAKERLEDNFASNGEEFSAVN
clust4-9-5     63      715   601    89   A01-sc-p7 63    504              2  SIG
                                                                PDRLMAGGNSFSQSFANIWATSVLGAYHTNKV
clust4-13-4     4      668   643    44   G05-sc-p2 4     549              1  SIG
                                                                PDRLMAGDPYTSEDLSFAFTSGKMLSAKVFFL
clust4-44-5     1      932          25   F01-sc-p7 1     408              2  SIG
                                                                FVYLKKNLXMQFNNRVLLKILELVIAIVCIVLWET
Housekeeping class
  Nuclear regulation
clust4-13-1     1      976          25   A07-sc-p1 1                  1    Cyt
                                                         369 TYKMNKRNNIRLPPEVNRLLYVRNLPYKITSEE
clust4-48-3     1      624   603    25   E07-sc-p3 1                  3    Cyt
                                                         417 LVEMARTKQTARKSTGGKAPRKQLATKAARKS
   Transcription factors
clust4-5-2      1     695           25   E01-sc-p1   1   663              2    Cyt
                                                                AGIALWPGTFRMLRTLATVLSATRNSLSSYHQ
clust4-21-4     1     994           25   A01-sc-p2   1   888              2   SIG
                                                                FGLMAGELPYWHLCQNQLIAFPSFSYPICCIFIE
clust4-45-1     1    1020           25   B01-sc-p2   1   909              2   SIG
                                                                RLMAGEXIFNXVITSVPMLKSXGKNQNFLRFCS
clust4-32-3     1     999           25   H01-sc-p3   1   951              3    Cyt
                                                                TGSPYGRVSSMFSLLHKEETAHEDGIWSCSW
clust4-15-12    1    1244           25   A02-sc-p1   1   981              4   SIG
                                                                GXXXGXLTGSPGXSLKKGXGGVXXGIHXAPXW
   Transcription machinery
clust4-12-3     4    1033    1007   38   E04-sc-p7   4    837              3    Cyt
                                                                LEQRDIRDIPGNLQIMAACLSQEKVWDKSRYA
clust4-6-1      1    1123           25   D06-sc-p8   1    519              2   SIG
                                                                MSRNXXNXGARVRIDXXGTPRRKKKIVHSTPA
clust4-42-1     2     511    488    36   XWANG1      2    279              5    Cyt
                                                                FFFFFFFXXWMYFNVTSSTSYFLFFFALVAGSF
clust4-34-3     1     934           25   C09-sc-p4   1    861              1    Cyt
                                                                RMKISAVANINDISSNVLIKSEPLCTVKEVDNMV
clust4-15-14    1    1337           25   E05-sc-p1   1   1332              6    Cyt
                                                                XPKKIXXKXWPXKNGPKKALXXKPXKKGXXKG
clust4-15-10    1    1234           25   H01-sc-p7   1    933              6    Cyt
                                                                NSSSCYSXESXXXFSSCWSVGILIGGAHRGVH
clust4-7-4      1     560    533    25   B01-sc-p1   1    303              2    Cyt
                                                                QKKVKNLENECPTDIRIVFIVRGRKKDNQRIGY
clust4-43-1     1     653           25   B02-sc-p3   1    495              2    Cyt
                                                                PSIYFSAKYLCKLFKISDDMDNNAGSENREKER
clust4-15-13    1    1102    946    25   G11-sc-p4   1    777              3    Cyt
                                                                XPDSPLAGGEQPDEKLDEEPNEKFDEDPDDQ
clust4-4-1      1     787           25   F04-sc-p2   1    780              3    Cyt
                                                                GSPYGRGILAGAGFCYAWLELIPHRIFIGRILAQ
clust4-15-7     4    1106           42   E07-sc-p7   4    813              4    Cyt
                                                                RIICHHNINLLQIECPFRNQYLINNTWSSSSGVV
   Signal transduction
clust4-4-2      1    1057           25   F08-sc-p7   1   582              2    Cyt
                                                                ILPQNMGNKSSLLLRXGEIAQIQEETGFTPNQIX
clust4-29-2     1     948           25   H03-sc-p7   1   774              3    Cyt
                                                                FVHITKFSKLLKKSTKMEPDYNEDTEWNDVLR
clust4-9-1      1    1155           25   E10-sc-p8   1   528              1    Cyt
                                                                PMTTIRKKLVIVGDGACGKTCLLIVFSKDQFPE
clust4-25-1     1     956           25   E06-sc-p2   1   546              2    Cyt
                                                                IALWPGGVLVLFLLDAIREMRKYSHHDHSSDVH
clust4-33-1     1     960           25   E01-sc-p6   1   876              2    Cyt
                                                                FALWPGASCXSEGMLWKKLIERKVRTDSLWR
clust4-4-3      1     426    401    25   A02-sc-p6   1   342              3    SIG
                                                                RXRLMAGGIWPARKPSKNSAPTLSPMAPRPTN
clust4-45-3     1     861           25   B05         1   261              1    Cyt
                                                                TGIRLMAGWELPLSPLTDQHDQIGYMAHLSGA
   Protein synthesis machinery
clust4-15-2     1      950          25   C01-sc-p3   1   609               1    Cyt
                                                                NRILFQERRNSIAQRSHTLTMYNLCFRLLRAGI
clust4-44-4     1      720   703    25   F02-sc-p4   1   609               1    Cyt
                                                                XRIALWPGLFLFRFHMTAATKESGKKIKRDPAK
clust4-20-4     1      659   633    25   B12-sc-p5   1   411               6    Cyt
                                                                NLGGLLLGSSLGFGSGGLSGLLGGLGGALLILG
clust4-39-2     1      714          25   A12-sc-p5   1   420               1    Cyt
                                                                KMADVDVDVPSAAPAVGGAMDINXAXQEVLKK
clust4-10-2     2      641   622    36   C06-sc-p8   2   471               2    Cyt
                                                                NKNLTXMGRMHAPGKGISQSALPYRRTVPSW
clust4-28-1     1      752          25   D10-sc-p2   1   597               5    SIG
                                                                SVTNAAAASRPNNSTQDMVEMMNVCLQTATT
clust4-7-2      2      605   574    36   B04-sc-p4   2   519               1    SIG
                                                                TDRLMAGAFLPVLSVSKMPGVTVKDIDQHACV
clust4-44-1     1      579   559    25   F09-sc-p5   1   366               3    Cyt
                                                                LKMAAAGKDIEXPQGADSSSVHRIRITLTSRNV
clust4-36-1     1      591   564    25   A10-sc-p5   1   540               4    Cyt
                                                                NILFSIWELVFVIRIFVTRLRSWAFLLLLVQSQE
clust4-12-4     2      921   894    27   G07-sc-p7   2   669               2    SIG
                                                                DSPYGRGFPSLFLLKMGISRDSAHKRRATGGK
clust4-42-2     1      682   662    25   H11-sc-p5   1   351               3    Cyt
                                                                IKTNLNMSNKAELACVYAALVLVDDDITVTGEK
clust4-24-2     1      843          25   D09-sc-p5   1   672               1    Cyt
                                                                RIRLMAGGSPSARCYRYCKNMPYPKSRFCRG
clust4-47-4     1      771          25   E12-sc-p7   1   654               3    Cyt
                                                                RXRXMAGAVRFLNMTGLTNRAVVIDGRGHLVG
clust4-19-3     1      579   552    25   C06-sc-p1   1   426               6    Cyt
                                                                TLNIDELRSQPVLYLLGVSLSLSHLSENVGQFF
clust4-29-4     1      635   607    25   A11-sc-p3   1   330               6    Cyt
                                                                ISTFVKHIYLTSLTCKPGGRDCLIFSAFSLSCTT
clust4-30-5     3    588   562      46   A03-sc-p4 3      426             6    SIG
                                                                KNNVLFLASKKSAMDGGANNLELNHLTLAFLV
clust4-48-6     1    983            25   H03-sc-p3 1      825             1    Cyt
                                                                RXALWPGVHVFSDMAPVEKAKKATKSGKKVA
clust4-25-2     6    406   379      70   A06-sc-p7 6      219             4    Ind
                                                                SCLKRLFLYVIPRNYRIYDVVISRFTAYLDLARIF
clust4-46-2     1    651   633      25   E01-sc-p4 1      390             1    SIG
                                                                RKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQD
clust4-7-1      1    730            25   H04-sc-p5 1      498             5    SIG
                                                                SDFRLLQWNESRAVGGTNTGTTVLNGFVSQD
clust4-9-3      1    818            25   E06-sc-p4 1      759             2    Cyt
                                                                PVLCESYEIKMSLTISKKRKFVADGMFKAELNE
clust4-32-4     3    656   618      41   A11-sc-p2 3      309             2    Cyt
                                                                DSPYGRGFFLFRVSCERINMPLAKDLLHPLPAQ
clust4-31-1     1    617   591      25   F11        1     552             1    Cyt
                                                                TQTMGRYSREPETAAKACKARGPNLRVHFKN
clust4-35-3     4    522   494      53   E04-sc-p6 4      165             3    Cyt
                                                                SCRSYMLVSKIKPCMSKYTRINSETAKGSLYQL
clust4-7-3      1    806            25   G12-sc-p2 1      756             6    Cyt
                                                                STTGSNEXXLATSRGTTLDSGSLTNMLMVTTT
clust4-18-3     3    574   537      47   E02-sc-p5 3      468             2    Cyt
                                                                RIALWPGLFCLAVPDKRLEMASSSHLNWLIIRN
clust4-9-4      1    952            25   F02-sc-p5 1      459             1    SIG
                                                                IYKQAKVNKSGKYSNMSETPSTPEKLIPGHPGK
clust4-43-5     1   1036            25   F12-sc-p3 1      858             2    Cyt
                                                                XXDRLMAGAYKKFWREWKMTKPAAVHYIPKN
clust4-22-1     1    515   487      25   D7         1     303             4    Ind
                                                                FKENTPCDDTLKILARKFHNWLRNYYPRNKIRR
clust4-23-2     1    491   466      25   D11-sc-p6 1      201             3    Cyt
                                                                FVLYLMYVSVLPVEFLYALNTCICVCSSYLNLLQ
clust4-28-3     1    861            25   E07-sc-p8 1      660             2    Cyt
                                                                DRXRLMAGGKKKKKKKKALNLDDLEGALPKVE
clust4-1-4      1    637   610      25   D03-sc-p5 1      510             2    Cyt
                                                                XGSPYGRGLSLYINMADQQTEKAFQKQFGINL
clust4-37-3     1    857            25   F09-sc-p2 1      768             3    Cyt
                                                                GSPYGRDGQLEKLLPHIKGNVGFVFTKGDLAE
clust4-45-2     1    621    596     25   E09-sc-p7 1      426             6    Cyt
                                                                RLKQSWHWGHDDDQIQIRCSRNGGCIGYVSW
clust4-41-2     2    589    565     36   H09-sc-p3 2      315             6    Cyt
                                                                TTDSRANGGSSGGRVDPGTTSDNTLTALAGP
clust4-30-3    32   1677   1519     55   F09-sc-p7 32     303             3    SIG
                                                                LFRGSKSRNKVSVGEPAEGSLTCSNRKTNTHI
clust4-18-2     3    394    367     49   B06-sc-p3 3      291             4    Ind
                                                                EVKGFLNLGDQQAGTTGLLDLVFSLLGEVFCL
clust4-20-3     1    909            25   E11-sc-p3 1      783             2    Cyt
                                                                RIALWPGNTALEDLTRLRDYIDNANFSTIQALQ
clust4-47-1    13    957   904      69   D09-sc-p1 13     186             4    Ind
                                                                KTNDYATFAQLGYCGHLNNSVGRLDFKFNSKR
clust4-3-4      1    947            25   D03-sc-p3 1      723             3    Cyt
                                                                XDRLMAGGRNLDVQKLRFFYQETDGGSRLVS
clust4-18-1     1    317   292      25   F07-sc-p2 1      240             3    Cyt
                                                                XPDRLMAGGAGAVTEKRSYFLAMKWLLEAAR
clust4-24-4     1    220   167      25   E08-sc-p3 1      144             5    Ind
                                                                CLSIRHKFNNGPTNKIYSDGTSTAPMLMSSMV
clust4-15-9     1   1353            25   H06-sc-p8 1     1131             6    SIG
                                                                SXGSXGGVRDPGGSPRGXXDSPGXVRXXXX
clust4-33-4     1    160            25   G05-sc-p5 1      156             2    Ind
                                                                GFALWPGTLXRRITRLWVXEKRRQTVRHXVN
clust4-30-4     1    655   630      25   F07-sc-p6 1      276             5    Cyt
                                                                STLQHXLRYAFKMSMXMXPAXHAMTHSLXRX
   Protein modification machinery
clust4-3-1     1     748            25   B07-sc-p2   1    684              3   Cyt
                                                                IAKLITGYKLKKMSGMDNKRKLSTSGDSLYEILG
clust4-38-1    2     941            34   D01-sc-p7   2    606              4   SIG
                                                                YGQAFMLNLSEEFLELHATGPVLIPTGGNSLGI
clust4-13-3    1     773            25   H06-sc-p2   1    564              1   SIG
                                                                PDRLMAGYSPLGKVPALHLVKEEGKPALIESLV
clust4-41-4    1    1269            25   F10-sc-p8   1    948              3   SIG
                                                                IRLMAGVHEHRFFLRVFIEMERHIFILIVGLVIVN
clust4-10-5    1     931            25   F05-sc-p6   1    855              2   SIG
                                                                RXQVRGYPTLKFFRSGAPVDYTGGRQAADIVT
clust4-43-2    1    1311            25   H05-sc-p7   1    498              4   SIG
                                                                KTXXRIFXFKAXKGXFFXEIFKGGGKGGRGPR
clust4-43-3    1    1332            25   H06-sc-p7   1    438              3   SIG
                                                                XLKMPKLQKPAPQFKGTAVVKGVFKDISLEDY
clust4-38-3    1    1037            25   G01-sc-p8   1    747              3   Cyt
                                                                NCNSFSVKNWYRKKKNCKXNEEYDAIVLGTGL
clust4-5-5     1     986            25   A02-sc-p3   1    774              3   Cyt
                                                                QFPGTEVKDVYRWLEDPDAEETQKYVEEQNK
clust4-36-4    1     861            25   A05-sc-p6   1    369              2   Cyt
                                                                PDXALWPGRRITQKPLYRKGRILEGKGDTKGA
clust4-15-8    1    1311            25   C09-sc-p1   1   1095              5   SIG
                                                                FPGXKNXXGXPGSPMGVPGVPXGXXESRGXX
clust4-15-1    1     233            25   C05-sc-p1   1    231              1   Cyt
                                                                VPXSPYGRAXNGXMPXNWPXRKNXSXVKRN
   Protein export machinery
clust4-41-3    1     764            25   D06-sc-p5   1   318               3    Cyt
                                                                NQYTMPAPASSTSVGSGTHSPSKLSSPAPRSG
clust4-37-4    1    1110            25   E09-sc-p3   1   576               1    SIG
                                                                NMFKSLLISFAFLAVASVSFAEDSETSARLLVSK
clust4-2-3     1     773            25   C06-sc-p4   1   516               3    Cyt
                                                                IISIQQQXKTNFLIKMMLFMLLFSRQGKLRLQKW
clust4-24-3    1    1040   1018     25   G11-sc-p1   1   639               3    Cyt
                                                                EFHIYKKESFFIFIRKRYALRLVVKEKNTAKMGN
clust4-48-4    2     722            35   E05-sc-p4   2   408               2    SIG
                                                                TGSPYGRGILCIDVDDVFTCFNFVHCFNKFLVL
clust4-10-3    1     389   370      25   G08-sc-p3   1   174               1    Cyt
                                                                IKFKMGLSPGVKERLEVVYEIAKTTFHWGFVPM
clust4-8-5     1     963            25   A01-sc-p3   1   480               2    Cyt
                                                                EAKEAVNMDFGDDFVAPASTTAXEXAXXAAEF
clust4-20-1       1    717          25   D01-sc-p2 1                   1   SIG
                                                         426 KTTLKMDSPNDFPGASGSSGNTDNNNQQNAA
clust4-38-4       1    464    436   25   G07-sc-p1 1                   2    Cyt
                                                         378 FFPLEYIGFTTGYRLIERMTRDVSRFKDELETIK
clust4-23-1       1   1229   1206   25   C08-sc-p5 1                   1   SIG
                                                         957 IRLMAGQMAKDKKHKEAVDLLQKHASNTKDVN
   Energy metabolism
clust4-21-1       1    718   696    25   F05-sc-p4   1    597               6   SIG
                                                                LNFQFAGWLVTCVGRHQKKNLMLGFFTIMFFT
clust4-37-5       5    889   863    62   G12-sc-p4   5    342               3    Cyt
                                                                INNTQHIFAHLVPQGTPAILIPFIVCIETIRNIIRPG
clust4-31-2       1    610   585    25   G08-sc-p8   1    264               2    Cyt
                                                                KMLNLSRAVVRSFTTPGAQXXXVKGEVEKGYF
clust4-36-3       2    790   766    35   E08-sc-p1   2    426               3    Cyt
                                                                KQIKMFVSTVSRIAPVARSALLNGSKQYLRPLS
clust4-32-2       2    716          31   C01-sc-p1   2    345               5    Cyt
                                                                CGLCLFGGFAQFLQSTDFSGGTSLLLLSQFGV
clust4-43-4       2    563   542    36   A09-sc-p6   2    366               3    Cyt
                                                                LKFTIMGTTYARAVRPDVTPGPDCVPTFDPLLG
clust4-1-5        1    886          25   A05-sc-p3   1    264               2   SIG
                                                                KYIMGASFFPILFFTAIWASVGIGLPMMTPKGP
clust4-12-1       4    814          56   C12-sc-p1   4    279               3    Ind
                                                                AHHSLIENNHSQTTQGLFFTVLLGVYFTILQAY
clust4-14-3       2   1017          27   H04-sc-p4   2    654               2   SIG
                                                                RKTHPHTMAQXRTVVGKTFGWLFAAVVTVLIF
clust4-3-3        1   1020          25   F12-sc-p7   1    489               3   SIG
                                                                NTSTKMADSGSDNPIYGPFFGVMGAASAIIFSA
clust4-48-2       1   1021          25   H03-sc-p2   1   1017               2   SIG
                                                                XXGSPYGRGFVXRXGTKMLRNLVIFSLFVVTIR
clust4-3-2        1    878          25   F07-sc-p3   1    735               1    Cyt
                                                                RYRKAAKMALSDADVQKQIKHMMAFIEQEANE
clust4-2-5        1    400   375    25   E01-sc-p8   1    303               5    Ind
                                                                YKPKSKIKIKIIEVIVQVNKFENLIIKIIGRIKAISTS
clust4-47-5       1    847          25   B05-sc-p2   1    666               3    Cyt
                                                                KEAMLRSAALIWANKAPKLSGIPSTTGVFGPAL
clust4-26-2       1    447   394    25   D03-sc-p1   1    228               3    Ind
                                                                IARKRSSSLNHLEFPKEYTTKMKVPFGKKHAEI
clust4-29-3       1    710   684    25   B03-sc-p4   1    462               3    Cyt
                                                                REIQAMDAAKKQDMPPPGGYXKIPFARVPAKV
clust4-31-4       1   1131          25   F01-sc-p4   1    369               3    Ind
                                                                GGFAVDNATLTRFFTSHFILPFIVLAITIIHLLFLH
clust4-2-1        1    583   556    25   D09-sc-p4   1    375               1    Ind
                                                                FSYILFLVFLGGILVLFIYVTSLASNEIFSFSIKLIL
clust4-37-2       1    642          25   G06-sc-p2   1    636               3   SIG
                                                                TGSPYGRGSKSRTESQTSIFFWTKKKENQKSI
clust4-26-3       1    741          25   H11-sc-p2   1    738               2    Cyt
                                                                RIALWPGEEFCECSCEWFVIADLIFIPPKKVLPL
clust4-6-2        1    737          25   E03         1    234               1    Ind
                                                                IGLEINLLAFIPLIRDNKLISTEASLKYFLTQALAS
clust4-34-2       2    805   786    30   E10-sc-p6   2    198               1    Ind
                                                                SYEYSDFNNIEFDSYIIPTNELNLENFRLLDVDN
clust4-24-1       1   1101          25   C02-sc-p7   1    648               3   SIG
                                                                KMLKPMKMIFSSVARRGFATTNRALAAQQMTV
clust4-41-5       1    987          25   H02-sc-p8   1    861               3   SIG
                                                                QTMAGALVRVNILQKSQFALAVPAAVQKRLQG
clust4-28-5       2    707   684    27   A07-sc-p8   2    252               1    Cyt
                                                                TFKKSICNYIYWSKFNFFPSTFFRTCWNTSTIF
clust4-48-1       1    632   608    25   F12-sc-p1   1    372               5    Cyt
                                                                ITMGLCLNLNKFKIKLKCLLTVGVGRVGNLINLQ
clust4-21-2       1    139          25   B06-sc-p6   1    135               5    Ind
                                                                LFRNSFWFYYCTVSVIIYFLTIFMSRSVDRDLGR
   Carbohydrate metabolism
clust4-30-1       1   1074   1047   25   B12-sc-p4 1                  2    SIG
                                                         867 XXDRLMAGVVLLQNRFSSSYYCIRRNIGNNFLR
clust4-16-1       1   1079          25   F11-sc-p8 1                  1    Cyt
                                                         807 RIALWPGTRPPAVAKHFVALSTNKEKVTEFGID
   Nucleotide metabolism
clust4-42-5       1   860           25   C11-sc-p4 1                  1    Cyt
                                                         753 VDXIALWPGAILLMYPVLARSCNLFLVQSKHST
   Lipid metabolism
clust4-35-5       1   1142          25   E10-sc-p4   1   678              1    SIG
                                                                LKMPMPEHDNIFLFIPNLIGYARXXLALIAFWFM
clust4-18-4       1   1261          25   H01-sc-p6   1   936              2    Cyt
                                                                ENIMSGDIVYIVEAARTPIGXFXGTLSKLKASDL
clust4-46-1       1    737          25   D10         1   579              3    Cyt
                                                                LIKTAKKWDRXVSRTDFEWVYTEEPHASRRKI
clust4-20-2       1    737          25   G07         1   525              2    Cyt
                                                                RGLFCFPTSSIYLESENINPSVTPDIKDMSFQLR
   Detoxication metabolism
clust4-11-2       1   926           25   F11-sc-p5 1                  1   Cyt
                                                         771 IRLMAGGVTMERWHDKVAVVTGASSGIGAAIA
   Oxidant metabolism
clust4-2-4        1   697    668    25   B04-sc-p8 1                  2   SIG
                                                         504 TGXGLMAGDYMRALRFGIFGSLYVAPSLYGW
clust4-27-6       1   897           25   C02-sc-p5 1                  3   SIG
                                                         411 VATKYPHVMVSGNNQYPSDKDQINLLFTFITYI
   Transporters/storage
clust4-39-5       1    920          25   C07-sc-p2 1                  3   SIG
                                                         690 DRLMAGGLPLVMKLSEEKLKLVTVFGAGLLVG
clust4-2-2        1   1170          25   F01-sc-p6 1                  1   SIG
                                                         999 TGSPYGRGEKPEQCNYPDNFSGYDGAIRCLD
   Cytoskeletal
clust4-27-5     2    955     933   28   A04-sc-p8 2                    2   Cyt
                                                        615 TCSNHYLIMLSDKAIKLLVIGESGVGKSXLIRRF
clust4-40-1     5   1169    1142   49   C12-sc-p8 5                    3  SIG
                                                        390 IEFYSRRSIYKMKFQYKEEHVFEKRRAEGDKIR
clust4-30-2     1    560     535   25   C03-sc-p1 1                    2  SIG
                                                        306 VLLSRHNNQQKTKMSDRKAVIKNADMSEEMQ
   Hypothetical conserved
clust4-42-4     1    980           25   G10-sc-p3   1    540              3    Cyt
                                                               TKITMNTLRNIFSSRTLNYLRQNGQNALINITQP
clust4-46-4     1    459           25   B04-sc-p6   1    345              2    Cyt
                                                               DRXRLMAGGLLGSRLPLSKMLRNARSCNSLAA
clust4-1-3      2    590    565    30   C12-sc-p6   2    486              6   SIG
                                                               GIYSFVNFIKILTQYTIIRIVSLIQNTIKTFTFLEYH
clust4-47-6     1    460    432    25   B01-sc-p3   1    351              6    Cyt
                                                               LKHANTRKNLIQRLWGTEVQEDDARSFGNSN
clust4-32-1     1    480    457    25   A04-sc-p5   1    255              2    Cyt
                                                               QIPKMADKVVEKPVGNPMKFPYTFSAKIAQFPM
clust4-33-3     1    672    654    25   A08-sc-p6   1    279              3   SIG
                                                               QQQNKPAFNMSKVTFKITLTSDPKLPFKVLSVP
clust4-11-6     1    673    653    25   G12-sc-p7   1    549              1    Cyt
                                                               LDRNFYTRTNIIQNLNXAQXLSLSFAHKKFNLR
clust4-14-1     1   1008           25   F08-sc-p1   1    822              2    Cyt
                                                               VYENINMKQSTSPTPSVVSSYVASRGQSPLPP
clust4-16-3     1    378    354    25   B08-sc-p3   1    219              4    Ind
                                                               KLLKPKGSIGRAFAVPVCTEHRDQVSICPFALC
clust4-36-5     1   1047           25   B08-sc-p7   1    891              2    Cyt
                                                               KQIQINFFPRNIYFVLYFFAEFTKWVVTVVLXAR
clust4-19-2     1    637           25   D3          1    489              2    Cyt
                                                               NFNFTYSFYKMNTVKIAQALLRIRPALCSQQRL
clust4-40-4     1    882           25   C05-sc-p2   1    480              3    Cyt
                                                               GSPLAGVDGLANGCDIREKLAAKMMMPTPPPP
clust4-15-3     1   1286           25   B12-sc-p6   1    804              3    Cyt
                                                               NYLRSNCHETLXMPXKKAPAPSKKTEQKKKEK
clust4-33-2     1   1152           25   F03-sc-p2   1   1149              2    Cyt
                                                               RIALWPGTEFVGNATKQRYKVAERGLHLTHIR
clust4-15-17    1    142           25   A05-sc-p4   1    138              5    Ind
                                                               QNFEDFHIRLCPDLRNGDIPFSSLFLPLLLYHID
Transposable elements
clust4-1-2      5   1437           48   H02-sc-p5 5                  1   Cyt
                                                        756 QKEQQIKMAQMVQMTTEQLQQLIEAVRVSAAA
clust4-1-1      1    733           25   B11-sc-p2 1                  2   SIG
                                                        249 NNQPKNKKELAHGRPHVRHCCRWSAERCAQ
Unknown class
clust4-34-4     1    390    363    25   H06-sc-p3 1     288                3    SIG
                                                               AVCVLIFFSLSLSLTLRQIIVALGNVPDLFTFVFIV
clust4-46-3     1    600    573    25   E04-sc-p3 1     471                2    SIG
                                                               IDISIHTHICFTFFLVQGLIWQLLFFDMANYFKIF
clust4-8-3      1    510           25   A06-sc-p8 1     183                1     Ind
                                                               SIIXXSNFFLYKKKXKTPXNIXXNGKXFFSXFIIIX
clust4-37-1     1    197           25   A4-2112002 1    159                1     Ind
                                                               VALFTLVNVCKTFGNHFFQNNTFFLIEFQTNLIX
clust4-11-5     1    449           25   D01-sc-p5 1     174                6     Ind
                                                               AVFRNRYKSVIGNYIHSKFWSRLPPLXLVLNKQ
clust4-14-5     1     97           25   G11        1     96                1     Ind
                                                               GGXKHWXSQGTVFPEMQHLSLXIFIASSIAGA
clust4-8-2      1    179    145    25   B10        1    174                3     Ind
                                                               VCPYVSLWELLLTMSGFHFTWGYRIIVSVSLHE
clust4-38-5     1    138    114    25   D05-sc-p1 1     132                6     Ind
                                                               FFFFFFFLPYNLCCKCLSCSPQKEATLTYITINIS
clust4-29-1     1    231    147    25   F06-sc-p1 1     129                4     Ind
                                                               FFFFFFFFFFFFFFFFFFFFFFFFFFFFWFLNIYF
clust4-48-5     1    104     69    25   H9         1    102                1     Ind
                                                               GEFLIKCEVDRTCVLPHEHKTXXKKKKKKKKKT
clust4-27-1     1    662    624    25   G11-sc-p6 1     327                2    Cyt
                                                               RLMAGVRRCRMPKQKAPLASQQWSLQFVSPQ
clust4-16-2     1    234    207    25   E12-sc-p2 1     231                1    Cyt
                                                               GPDRLMAGGKFXNGATYIYIVFCVGIEGRMCN
clust4-36-2     1    672           25   A03-sc-p3 1     279                1    Cyt
                                                               NKSSNIFKIMDSPKLRNITVRVKRTYHEPLDEVR
clust4-5-3     16   1162    1136   89   D10-sc-p6 16    366                5    Cyt
                                                               WVTAAAVNNFANNLCCPKTCPCLPTNFSMVK
clust4-45-4     1    365     338   25   B12-sc-p7 1     141                2     Ind
                                                               KYRWIEKQKQNLKKLLKFCKNKKKIKFIMHXYF
clust4-23-4     1    291     263   25   E03-sc-p7 1     144                2     Ind
                                                               DRLMAGVYEISMXKIQRCINTYIELPKLTIFGFKF
clust4-3-5      5   1134    1109   44   G01-sc-p6 5     318                3     Ind
                                                               LYFYKFRSSHTIICYKQQKCKNQTNDASTGGFN
clust4-5-1      1    160     135   25   D11-sc-p8 1     102                4     Ind
                                                               FFFFFFFFFYIDYFYFLFNNIIIYHCCINHNYYL
clust4-40-2     1    346     321   25   F11-sc-p7 1     273                4    Cyt
                                                               VLNKAHLAKQKTTAAKSLFILLCIYQLTGKTQRL
clust4-28-2     1    196     125   25   A06-sc-p6 1     177                4     Ind
                                                               FFFFFFFFFFFFXFPXXXFFFFFFNYLTILINTIQF
clust4-23-3     1    225     173   25   B08-sc-p1 1     138                6     Ind
                                                               FFFFFFFXFFFFFFFFFQFLLRFLLRVSFYLLVF
clust4-25-4     1    960           25   A05-sc-p2 1     225                3    Cyt
                                                               MQFNLTLIIFIIDTIITLFTLEQEINTQHPLENHVQ
clust4-8-4      1    142           25   A11-sc-p7 1     123                5     Ind
                                                               KIFKIRGRKLSKAQRIESFYSFFFCVGKKKIAKP
clust4-38-2     1    602    576    25   D01-sc-p3 1     222                5    Cyt
                                                               FFFFFFFFLGTVSIIYFHNHIRPLSLNSQTMPVC
clust4-6-3      1    684           25   E09-sc-p8 1     264                3    Cyt
                                                               DTFSRFTLNSARISPTFKFVLTPVPEWKTQFVF
clust4-12-2     2   1056           34   C07-sc-p7 2     312                5    Cyt
                                                               EEGGLPVFRLSAGAHTAQLLFIVFIIIIMNGVYFK
clust4-7-5      1    252    224    25   D05-sc-p8 1      87                3     Ind
                                                               IPQKFVTLKHDSRNRQKKKKIPTYYLNNX
clust4-3-6      1   1285           25   C05-sc-p8 1     318                1    Cyt
                                                               SHNWILSNLIEHLYHNTIISRISXISKPECFQGFW
clust4-10-1    1    140         25   H09-sc-p5   1   105               3    Ind
                                                           IRLMAGHXKVKNILKKKYILKKIXIKIAKKLAKII
clust4-33-5    1    228   203   25   F09-sc-p1   1   201               1    Cyt
                                                           CRXRLMAGESGSSLWETGYATNRRLKSARKN
clust4-6-5     1    452   425   25   G02-sc-p6   1   351               3    Ind
                                                           GFALWPGAVNVNTNDAIILHRWHFVLTPPSPL
clust4-34-1    1    668   648   25   B04-sc-p2   1   189               1    Ind
                                                           KKPFLKQIIGQSLLRCYKCVYRPIIIVIDVVNKYK
clust4-8-1     1    316   290   25   B11-sc-p5   1   210               3    Ind
                                                           IFFLEYDECYSSHIRRRILNEKCVIFKNVYPKWL
clust4-14-4    1    292   264   25   H04-sc-p7   1   147               5    Ind
                                                           SGFLLFFYFHHRHEMMMKCWGTMCNIGTFVF
clust4-45-5    1    302         25   E05-sc-p2   1   204               2    Ind
                                                           NASRIHAIKELIKTIKETRIFIKTNTRQQKRNACQ
clust4-17-1    1    338   312   25   C04-sc-p3   1   189               3    Cyt
                                                           GPXRLMAGGAIQLNSQXRPYYQHHHHQVQVIF
clust4-35-1    1    662   638   25   D08-sc-p7   1   195               6    Cyt
                                                           SRCLVYVIDINIKSHSRLRRQGAKALKITRKKST
clust4-35-2    1    222   197   25   B08-sc-p8   1   123               3    Ind
                                                           KTLQHSNYLLLNAKLSDSXXIFLLHQLHAHKRR
clust4-15-15   2   1089         30   D07-sc-p4   2   873               3    Cyt
                                                           IAVFRSQNGRKNKRNLGDLENANTINIIGXEED
clust4-13-2    1    549   524   25   G07-sc-p3   1   306               4    Cyt
                                                           RTIVIIIISVVVGLFVLLAGRVRSGRSVIIIIIMIIGLQ
clust4-32-5    1    671         25   F06-sc-p2   1   258               6    Cyt
                                                           LGQKAHTEVEKTLRTRTSTIYRRYIIIGCSTNAS
clust4-41-1    1    344   318   25   H05-sc-p4   1   216               2    Cyt
                                                           DKTKQNINLKKSIFITHALYMYAYNYILKKIKEKN
clust4-6-4     1    657   629   25   G10-sc-p1   1   294               3    Cyt
                                                           LLYTEQSNCTNNNHHLLLNQQSVNCIFSNPLLL
clust4-19-1    2    816   798   30   F04-sc-p1   2   309               2    Cyt
                                                           IRNYLYSRQRNDDLKHFPLSMSPMDDGPPKKF
clust4-39-3    1    539         25   B06         1   162               6    Ind
                                                           TNCKVVGLXXXXGVXXNFLSXFFLIFHLIYFLIKC
clust4-31-3    1    500   471   25   F07         1   294               5    Ind
                                                           SYFSFLTPNSNFLYDPSFPFLIGRFFFLLTWLID
clust4-22-2    1    744         25   F05         1   216               2    Cyt
                                                           GTTGTKEIKYKSKMPPKHYLLGKTSSGIANIFHR
clust4-46-5    1    282   255   25   XWANG5      1   249               4    Ind
                                                           FFFFFFFFFSFISFLLNKTSRLIFYILMMVFVFFL
clust4-47-3    1    579   546   25   D11-sc-p5   1   297               3    Ind
                                                           FFLRGQWAFNNNKKKQQQFPPYIFLLFFLPHT
clust4-17-2    1    800         25   H01-sc-p2   1   447               3    Cyt
                                                           STNLPSKFEVKCLWGQRDQRRHVDQMEHLFP
clust4-40-3    1    768         25   H03-sc-p1   1   135               3    Ind
                                                           STIAYVDIINMATSTQIVPKIMQSIHQHLTRLFLR
clust4-25-3    1    493   426   25   B08-sc-p5   1   213               1    Ind
                                                           KTTEKYNKKYYRIITKQKRRXEQKSNHLRKFCV
clust4-44-2    1    870         25   G11-sc-p3   1   222               2    Cyt
                                                           VDHHHHHHLMKTLHRKQQILMITIATITFNLNLE
clust4-26-1    1   1246         25   C04-sc-p1   1   261               4    SIG
                                                           KFXXKKKQGXXXGQKTXKXKKKLTXPGXXXPX

                                             820
                                       Seem       Best match to NR
Comments                               ?    Class protein database                E value     % identity




Chymotrypsin                           y              chymotrypsin
                                              s/enz trypsin                   1E-155                 100
Chymotrypsin                           y              chymotrypsin
                                              s/enz trypsin                   1E-133                  96
serine protease                        y              GF12598 [Drosophila ananassae]
                                              s/enz trypsin                   2E-067                  44
serine protease                        y              GI11961 [Drosophila mojavensis]
                                              s/enz trypsin                   2E-039                  43
serine protease Ssp3                   y              serine
                                              s/enz trypsin protease Ssp3     1E-146                 100
serine protease Ssp3-2 precursor       y              serine                  1E-142
                                              s/enz trypsin protease Ssp3-2 precursor                 99
Trypsin                                y              trypsin
                                              s/enz trypsin                   1E-152                 100

putative ribonuclease                  y              GF13846 [Drosophila ananassae]
                                              s/enz ribonuclease              8E-045                  89
Salivary endonuclease                  y              Tsal2 form A
                                              s/enz endonuc                   3E-023                  34

                                            s/ag5 antigen 5 precursor
Defense-related protein containing SCPydomain                                     1E-156             100
                                            s/ag5 antigen 5 precursor
Defense-related protein containing SCPydomain                                     1E-151              96
                                            s/ag5 antigen 5 precursor
Defense-related protein containing SCPydomain                                     1E-131              88

Thrombostasin                                 s/tm thrombostasin precursor 1E-170                    95
thrombostasin precursor                       s/tm thrombostasin precursor 2E-019                    35
Kazal type inhibitor                   y      s/kazal protease inhibitor        4E-037             100
Kazal type inhibitor                   y                                        5E-034               76
                                              s/kazal putative 6.3 kDa secreted salivary gland protein

Very negative secreted protein                s/neg                                protein
                                                        PREDICTED: hypothetical 5E-088               34
Very negative secreted protein                s/neg                                protein
                                                        PREDICTED: hypothetical 7E-042               32
Very negative secreted protein                s/neg                                2E-042            48
                                                        hypothetical protein [Plasmodium falciparum 3D7]
Very negative secreted protein                s/neg                                7E-042
                                                        GI15578 [Drosophila mojavensis]              42

GGY peptide                            y             GH17318 [Drosophila grimshawi]
                                              s/imm ggy                      6E-016             53
diptericin A                           y      s/imm diptericin A             2E-050             97
stomoxyn 2 - has disintegrin domain    y      s/imm stomoxyn 2               4E-029            100
Sarcotoxin fragment                    y                                     2E-020             56
                                              s/imm RecName: Full=Sarcotoxin II-3; Flags: Precursor gi|217393|dbj|BAA1418

                                        y      s/pep
putative 10.9 kDa secreted salivary gland protein                                  salivary          100
                                                        putative 10.9 kDa secreted3E-064 gland protein
                                        y      s/pep
putative 11.4 kDa secreted salivary gland protein                                  salivary          100
                                                        putative 11.4 kDa secreted5E-066 gland protein
                                        y      s/pep
putative 11.5 kDa secreted salivary gland protein                                  salivary          100
                                                        putative 11.5 kDa secreted2E-068 gland protein
                                        y      s/pep
putative 13.7 kDa secreted salivary gland protein                                  salivary          100
                                                        putative 13.7 kDa secreted2E-075 gland protein
                                               s/pep
putative 7.4 kDa secreted salivary glandyprotein                                  9E-048               97
                                                        putative 7.4 kDa secreted salivary gland protein
basic tail peptide                      y      s/bt                               0.002
                                                        PREDICTED: similar to yellow-d                 39
                                        y      s/26.4
putative 26.4 kDa secreted salivary gland protein                                  salivary
                                                        putative 26.4 kDa secreted1E-153 gland protein 99
                                        y      s/15.6
putative 15.6 kDa secreted salivary gland protein                                    salivary     100
                                                        putative 15.6 kDa secreted2E-088 gland protein
conserved secreted protein                     s/uc                                6E-034
                                                        GL10591 [Drosophila persimilis]            59
                                        y      s/13
putative 13.0 kDa secreted salivary gland protein                                    salivary     100
                                                        putative 13.0 kDa secreted3E-087 gland protein
conserved secreted protein              y      s/uc                                6E-044
                                                        GJ19171 [Drosophila virilis]               69



                                     y     nr
Predicted RNA-binding protein (RRM superfamily)                                 5E-062
                                                        GI13232 [Drosophila mojavensis]           95
Histones H3 and H4                         nr                                    protein
                                                        PREDICTED: hypothetical 7E-070 isoform 1 100

Putative transcriptional regulator DJ-1 y       tf                              3E-064          71
                                                        GA12322 [Drosophila pseudoobscura pseudoobscura]
mitochondrial transcription factor A    y       tf                              8E-087
                                                        GF18333 [Drosophila ananassae]          61
Ngg1-interacting factor 3 protein NIF3L1        tf                              6E-090
                                                        GL16352 [Drosophila persimilis]         57
WD40 repeat-containing protein                  tf                              1E-134
                                                        GF17851 [Drosophila ananassae]          76
                                                tf      GI15578 [Drosophila mojavensis]
Apoptosis antagonizing transcription factor/protein transport protein           1E-032          51

Elongation factor 1 beta/delta chain    y      tm                                 1E-076
                                                      GM18026 [Drosophila sechellia]             62
                                               BTF3 and related[Drosophila virilis]
RNA polymerase II general transcription factor tm     GJ22190 proteins            5E-067         83
DNA-binding nuclear protein p8                 tm     GG10281 [Drosophila erecta] 6E-025         79
Transcriptional activator of the JUN family    tm                                 1E-072         57
                                                      GA15338 [Drosophila pseudoobscura pseudoobscura]
U3 small nucleolar ribonucleoprotein (snoRNP)tm       PREDICTED: hypothetical 1E-070
                                                subunit - Mpp10p                  protein        37
U3 small nucleolar ribonucleoprotein (snoRNP)tm       PREDICTED: hypothetical 9E-063
                                                subunit - Mpp10p                  protein        40
RNA polymerase, subunit L                      tm     GM15177p                    2E-056         94
RNA-binding protein hnRNP-M                    tm                                 3E-064
                                                      GK14301 [Drosophila willistoni]            77
                                               tm                                 9E-045         43
Transcription factor containing C2HC type Zn finger hypothetical protein [Plasmodium falciparum 3D7]
Negative regulator of transcription            tm     GG25279 [Drosophila erecta] 1E-125         84
U3 small nucleolar ribonucleoprotein (snoRNP)tm       GI15578 [Drosophila mojavensis]
                                                subunit - Mpp10p                  2E-055         57

                                        y      st      GI24225 [Drosophila mojavensis]
                                                                                9E-093           89
Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein
Conserved phosducin-like protein        y      st                               1E-103
                                                       GF24491 [Drosophila ananassae]            79
Ras-related small GTPase, Rho type             st                               4E-098
                                                       Rho1, isoform A [Drosophila melanogaster] 97
                                               st                               2E-071           80
B-cell receptor-associated protein and related proteinsGA12600 [Drosophila pseudoobscura pseudoobscura]
                                               st      GL22031 [Drosophila persimilis]
Beta-TrCP (transducin repeats containing)/Slimb proteins                        1E-159           95
G protein beta subunit-like protein            st      RACK1                    2E-023           91
Rhomboid family proteins                       st                               1E-030
                                                       GL26733 [Drosophila persimilis]           84

Mitochondrial polypeptide chain releaseyfactor   ps                               7E-045
                                                        GF13589 [Drosophila ananassae]              63
60S ribosomal protein L11              y         ps                               7E-097
                                                        GF12342 [Drosophila ananassae]              94
60s ribosomal protein L24              y         ps                               4E-074
                                                        GF21662 [Drosophila ananassae]              91
40S ribosomal protein S12              y         ps                               9E-070
                                                        GK16839 [Drosophila willistoni]             93
40S ribosomal protein S13              y         ps                               3E-080
                                                        GK13532 [Drosophila willistoni]             99
40S ribosomal protein S14              y         ps     ribosomal protein S14     7E-079          100
40S ribosomal protein S19              y         ps                               2E-077
                                                        GH12611 [Drosophila grimshawi]              89
40S ribosomal protein S20              y         ps                               6E-059
                                                        GI22154 [Drosophila mojavensis]             95
40S ribosomal protein S23              y         ps                               2E-076
                                                        similar to Drosophila melanogaster CG8415 95
40S ribosomal protein S8               y         ps                               1E-103
                                                        GF18798 [Drosophila ananassae]              89
60s acidic ribosomal protein P1        y         ps                               2E-048
                                                        GI21657 [Drosophila mojavensis]             87
60s ribosomal protein L10              y         ps                               1E-118
                                                        GI23790 [Drosophila mojavensis]             93
60S ribosomal protein L13a             y         ps                               1E-105
                                                        GK13926 [Drosophila willistoni]             92
60S ribosomal protein L36              y         ps                               4E-057            95
                                                        GA20486 [Drosophila pseudoobscura pseudoobscura]
60S ribosomal protein L38              y         ps                               1E-030            95
                                                        ribosomal protein L38 [Drosophila melanogaster]
60S ribosomal protein L44                  y      ps                                  4E-055            98
                                                          ribosomal protein L36A [Drosophila melanogaster]
60s ribosomal protein L6                   y      ps                                  1E-112            76
                                                          ribosomal protein L6, isoform B [Drosophila melanogaster]
Ribosomal protein L41                      y      ps                                  6E-006           100
                                                          ribosomal protein L41 [Drosophila melanogaster]
Ubiquitin/60s ribosomal protein L40 fusion y      ps                                  1E-068           100
                                                          ribosomal protein L40 [Drosophila melanogaster]
40S ribosomal protein S15                  y      ps                                  3E-075
                                                          GH20641 [Drosophila grimshawi]                95
40S ribosomal protein S3                   y      ps                                  1E-123
                                                          GK14111 [Drosophila willistoni]               94
40s ribosomal protein S27                  y      ps                                  2E-044            96
                                                          GA10310 [Drosophila pseudoobscura pseudoobscura]
60S ribosomal protein L22                  y      ps      GJ16610 [Drosophila virilis]8E-092            90
rRNA                                       y      ps                                  4E-016
                                                          hypothetical protein Bm1_17870 [Brugia malayi]71
60s ribosomal protein L2/L8                       ps                                  1E-133
                                                          GK12506 [Drosophila willistoni]               95
60S ribosomal protein L28                         ps                                  5E-059
                                                          GI12761 [Drosophila mojavensis]               85
                                                  ps      and invovled in translation 1E-053 processing 76
Predicted RNA-binding protein containing PIN domain GK16809 [Drosophila willistoni]   or RNA
mitochondrial ribosomal protein L28               ps                                  1E-111
                                                          GK24462 [Drosophila willistoni]               71
rRNA promoter binding protein                     ps                                  1E-015
                                                          unspecific monooxygenase [Brugia malayi] 75
rRNA                                              ps      unnamed protein product 1E-009                75
                                                  ps
Translation initiation factor 2, beta subunit (eIF-2beta) GE20110 [Drosophila yakuba] 8E-093            70
40S ribosomal protein S11                         ps      GJ21555 [Drosophila virilis]1E-074            89
60S acidic ribosomal protein P0                   ps                                  1E-123
                                                          60S acidic ribosomal protein P0               93
Ubiquitin-like/40S ribosomal S30 protein fusionps                                     1E-031
                                                          GI10603 [Drosophila mojavensis]               65
60S ribosomal protein L37                         ps                                  2E-045
                                                          GF14155 [Drosophila ananassae]                96
rRNA                                              ps      PREDICTED: similar to Ac11473E-021            59
60s ribosomal protein L15/L27                     ps                                  2E-036
                                                          similar to Drosophila melanogaster RpL27A 84
                                                  p
Translation initiation factor 3, subunit e (eIF-3e) s                                 1E-141
                                                          GK12672 [Drosophila willistoni]               97
rRNA                                              ps      hypothetical protein        4E-006            77
Amidases                                          ps                                  7E-094
                                                          GD25848 [Drosophila simulans]                 69
Ribosomal protein S7                              ps                                  3E-029
                                                          GD23690 [Drosophila simulans]                 89
ribosomal protein L12                             ps      ribosomal protein L12       0.004             82
                                                  ps                                  3E-037
Nucleolar protein involved in 40S ribosome biogenesishypothetical protein [Plasmodium falciparum 3D7]   47
rRNA                                              ps                                  31                35
                                                          Histidine kinase/response regulator hybrid protein [Xanthomonas campe
rRNA                                              ps      metal tolerance protein     0.25              32

Molecular chaperone (DnaJ superfamily)   y      pm                                   1E-109            86
                                                        cysteine string protein, isoform C [Drosophila melanogaster]
Glutathione S-transferase                       pm                                   1E-108            94
                                                        RecName: Full=Glutathione S-transferase 1-1; AltName: Full=GST class
Glutathione S-transferase                       pm                                   1E-057            60
                                                        glutathione S-transferase [Culex quinquefasciatus]
                                                pm
Oligosaccharyltransferase, alpha subunit (ribophorin I) GE26020 [Drosophila yakuba]  6E-072            48
                                                pm      GA20009                      1E-111            72
Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Drosophila pseudoobscura pseudoobscura]
                                                pm      putative thioredoxin peroxidase 1
Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes        1E-091            85
                                                pm      putative thioredoxin peroxidase 1
Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes        1E-091            85
                                                pm      (RAB escort protein)
RAB proteins geranylgeranyltransferase component A GI17638 [Drosophila mojavensis]   1E-124            94
Predicted conserved serine protease             pm                                   1E-119
                                                        GH13380 [Drosophila grimshawi]                 79
FKBP-type peptidyl-prolyl cis-trans isomerase pm                                     7E-041
                                                        GF12939 [Drosophila ananassae]                 77
Molecular chaperone (DnaJ superfamily)          pm                                   2E-040            49
                                                        hypothetical protein [Plasmodium falciparum 3D7]
heat shock cognate protein 70                   pm      heat shock cognate protein 705E-019            74

                                           y
Sec61 protein translocation complex, beta subunit pe                              1E-040
                                                        GL11450 [Drosophila persimilis]              88
Translocon-associated complex TRAP, y             pe                              9E-085             81
                                           beta subunit GA18908 [Drosophila pseudoobscura pseudoobscura]
Clathrin adaptor complex, small subunity          pe                              1E-084
                                                        AP-1sigma [Drosophila melanogaster]          98
GTP-binding ADP-ribosylation factor Arf1   y      pe                              4E-099             98
                                                        ADP ribosylation factor 79F, isoform B [Drosophila melanogaster]
Signal peptidase subunit                   y      pe                              1E-030
                                                        conserved hypothetical protein               69
                                           y
Translocase of outer mitochondrial membrane pe          outer mitochondrial       3E-018
                                                  complex, subunit TOM7 translocase subunit [Culex74  quinquefasciatus]
Vesicle coat protein clathrin, light chain y      pe    clathrin light chain      2E-068             63
Synaptobrevin/VAMP-like protein              pe                                1E-043
                                                     GI20208 [Drosophila mojavensis]         72
                                             pe
Transport protein particle (TRAPP) complex subunit                             3E-060        92
                                                     GA19431 [Drosophila pseudoobscura pseudoobscura]
Signal recognition particle, subunit Srp72   pe                                1E-125
                                                     GK22456 [Drosophila willistoni]         75

                                       y       met/energy
                                                       GF15236
NADH-ubiquinone oxidoreductase, subunit NDUFB10/PDSW [Drosophila ananassae]       8E-076           81
ATP synthase F0 subunit 6 and related yproteins        ATP                        1E-109           91
                                               met/energy synthase F0 subunit 6 [Stomoxys calcitrans]
cytochrome c oxidase subunit VI        y               GF16667 [Drosophila ananassae]
                                               met/energy                         3E-032           79
                                       y       met/energy
                                                       GA14517                    5E-065           97
Mitochondrial F1F0-ATP synthase, subunit c/ATP9/proteolipid [Drosophila pseudoobscura pseudoobscura]
                                       y
Mitochondrial F1F0-ATP synthase, subunit e met/energy                             9E-030
                                                       GK10942 [Drosophila willistoni]             87
                                       y       met/energy
NADH:ubiquinone oxidoreductase, NDUFB7/B18 subunit                                6E-044           70
                                                       GA18962 [Drosophila pseudoobscura pseudoobscura]
                                               met/energy
Vacuolar H+-ATPase V0 sector, subunityM9.7 (M9.2) GH15937 [Drosophila grimshawi]  2E-036           77
                                       y       met/energy                         1E-125
Cytochrome oxidase subunit III and related proteins cytochrome c oxidase subunit III               89
Vacuolar H+-ATPase V0 sector, subunityc''              GJ24692 [Drosophila virilis]
                                               met/energy                         1E-095           85
                                       y
Vacuolar H+-ATPase V0 sector, subunits c/c' met/energy                            1E-077
                                                       GK19648 [Drosophila willistoni]             97
                                       y
ATPase membrane sector associated protein met/energy                              3E-086
                                                       GJ10644 [Drosophila virilis]                52
Vacuolar H+-ATPase V1 sector, subunityE                GF20699 [Drosophila ananassae]
                                               met/energy                         4E-098           82
                                               met/energy
NADH dehydrogenase subunit 3 and related proteins NADH dehydrogenase subunit 3    2E-045           89
                                               met/energy
                                                       GH21035 [Drosophila grimshawi]
NADH-ubiquinone oxidoreductase, NUFS7/PSST/20 kDa subunit                         1E-106           87
ubiquinol-cytochrome-c reductase                       GK21400 [Drosophila willistoni]
                                               met/energy                         7E-018           75
                                               met/energy
                                                       GI15405 [Drosophila mojavensis]
NADH:ubiquinone oxidoreductase, B16.6 subunit/cell death-regulatory protein 5E-065                 79
Cytochrome b                                           cytochrome b
                                               met/energy                         1E-125           76
NADH dehydrogenase subunit 6                           NADH
                                               met/energy dehydrogenase subunit 6 6E-059           87
Mitochondrial F1F0-ATP synthase, subunit b/ATP4        GK10957 [Drosophila willistoni]
                                               met/energy                         3E-080           79
Cytochrome c1                                          GH16186 [Drosophila grimshawi]
                                               met/energy                         5E-097           80
                                               met/energy dehydrogenase subunit 2
NADH dehydrogenase subunits 2, 5, and related proteins NADH                       4E-095           85
                                               met/energy                         1E-108           91
Cytochrome c oxidase, subunit II, and related proteins cytochrome oxidase subunit 2 [Stomoxys calcitrans]
Pyruvate dehydrogenase E1, beta subunit                similar                    7E-051
                                               met/energy to Drosophila melanogaster CG11876 80
                                               met/energy
NADH:ubiquinone oxidoreductase, NDUFV1/51kDa subunit                              1E-144
                                                       GI13499 [Drosophila mojavensis]             91
cytochrome c oxidase subunit I                         cytochrome c oxidase subunit I
                                               met/energy                         1E-103           93
Mitochondrial ADP/ATP carrier proteins                 GI11098 [Drosophila mojavensis]
                                               met/energy                         2E-043           97
Citrate synthase                                       GI15188 [Drosophila mojavensis]
                                               met/energy                         0.085            85

Phosphoglycerate mutase               y             G                           1E-125
                                             met/carb J14508 [Drosophila virilis]               84
Glucose-6-phosphate isomerase                       G                           1E-129
                                             met/carb K21948 [Drosophila willistoni]            74

Uridylate kinase/adenylate kinase            met/nuc                          2E-089
                                                    GK12802 [Drosophila willistoni]             85

Phosphatidylinositol synthase                        GH17635 [Drosophila grimshawi]
                                             met/lipid                          6E-097          80
Acetyl-CoA acetyltransferase                         GJ12146 [Drosophila virilis]
                                             met/lipid                          1E-118          72
Fatty acid desaturase                                GJ15437 [Drosophila virilis]
                                             met/lipid                          5E-078          81
predicted lipase                                     GM13497 [Drosophila sechellia]
                                             met/lipid                          5E-032          47

Predicted dehydrogenase               y             GD23342 [Drosophila simulans]
                                             met/detox                     1E-073               56

                                         met proteins                       1E-051
Peroxisomal membrane protein MPV17 and relatedox GJ15554 [Drosophila virilis]           64
Selenoprotein T                   y                                         2E-004      29
                                         met ox AGAP009202-PA [Anopheles gambiae str. PEST]

ZIP-like zinc transporter proteins           tr                                 4E-091
                                                     GJ16326 [Drosophila virilis]                73
Transferrin                                  tr                                 1E-154           71
                                                     RecName: Full=Transferrin; Flags: Precursor gi|984653|dbj|BAA06067.1
                                       y
GTPase Rab18, small G protein superfamily cs         GG18481 [Drosophila erecta]1E-080              76
                                       y       in    GM11288 membrane trafficking
                                                                                2E-060
Microtubule-associated anchor protein involvedcs autophagy and[Drosophila sechellia]                96
Dynein light chain type 1                     cs                                3E-046
                                                     cytoplasmic dynein light chain [Aedes aegypti] 90

Uncharacterized conserved protein     y        uc                             3E-049        57
                                                    GA20897 [Drosophila pseudoobscura pseudoobscura]
hypothetical conserved protein        y        uc                             3E-025
                                                    GL14849 [Drosophila persimilis]         60
Fb12 conserved protein                y        uc   Fb12                      3E-035        97
hypothetical conserved protein        y        uc   hypothetical protein      3E-044       100
hypothetical conserved protein        y        uc                             1E-033
                                                    GF11854 [Drosophila ananassae]          81
ubiquitin-fold modifier               y        uc                             4E-039
                                                    GL11573 [Drosophila persimilis]         97
hypothetical conserved protein        y        uc                             8E-049        62
                                                    GA17252 [Drosophila pseudoobscura pseudoobscura]
Uncharacterized conserved protein     y        uc                             1E-127
                                                    GK11280 [Drosophila willistoni]         82
hypothetical conserved protein                 uc                             5E-042
                                                    CG41536 [Drosophila melanogaster]       84
Uncharacterized conserved protein              uc                             1E-107        68
                                                    GA19597 [Drosophila pseudoobscura pseudoobscura]
hypothetical conserved protein                 uc                             5E-046
                                                    GD10179 [Drosophila simulans]           73
hypothetical conserved protein                 uc                             1E-039
                                                    GI23121 [Drosophila mojavensis]         63
                                               uc   GI20775 [Drosophila mojavensis]
Uncharacterized conserved protein, contains CCCH-type Zn-finger               1E-124        82
hypothetical conserved protein                 uc                             7E-080
                                                    GK10210 [Drosophila willistoni]         53
                                               uc   GK19000 [Drosophila willistoni]
Uncharacterized conserved protein related to ribosomal protein S8E            5E-010        90

Pol polyprotein                               te                             5E-090
                                                     Arc1 [Drosophila melanogaster]                66
Possible TE                                   te     reverse transcriptase   0.10                  51

unknown                                       uk                               0.11                 34
                                                     Protein kinase domain containing protein [Tetrahymena thermophila SB2
unknown                                       uk                               0.004                 homolog [Entamoeba hist
                                                     mannose-P-dolichol utilization defect 1 protein25
unknown                                       uk                               2.4
                                                     ymf16 [Phytophthora ramorum]                   28
unknown                                       uk                                 type2 beta subunit 26
                                                     geranylgeranyl transferase6.2                  [Plasmodium falciparum 3
unknown                                       uk                               6.2                  29
                                                     hypothetical protein PM8797T_05650 [Planctomyces maris DSM 8797]
unknown                                       uk     antigen 5 precursor       10                   94
unknown                                       uk                               52                   40
                                                     radical SAM domain-containing protein [Alkaliphilus metalliredigens QYM
unknown                                       uk                               88                   47
                                                     hypothetical protein BRAFLDRAFT_105396 [Branchiostoma floridae]
unknown                                       uk
unknown                                       uk
unknown                                       uk     PREDICTED: hypothetical 8.2 protein             40
unknown                                       uk     predicted protein           8.1                 41
unknown                                       uk                                 0.77
                                                     PREDICTED: similar to AAT1-alpha                25
unknown                                       uk                                 4.4
                                                     GH10559 [Drosophila grimshawi]                  30
unknown                                       uk                                 6.1
                                                     unnamed protein product [Kluyveromyces lactis]  31
unknown                                       uk                                 14                  32
                                                     Putative transcriptional regulator YrzC [Methylokorus infernorum V4]
unknown                                       uk     Protein DEK, putative       14                  34
unknown                                       uk     PREDICTED: hypothetical 31  protein             52
unknown                                       uk     PREDICTED: hypothetical 14                      30
                                                                                 protein [Rattus norvegicus]
unknown                                       uk                                 90                  46
                                                     hypothetical protein AYWB_pIII03 [Aster yellows witches'-broom phytopla
unknown                                       uk     hypothetical protein        2.8                 36
unknown                                       uk                                 2.5
                                                     hypothetical protein [Dictyostelium discoideum30 AX4]
unknown                                       uk     unnamed protein product 67                      41
unknown                                       uk                                 5.0                 44
                                                     predicted protein [Coprinopsis cinerea okayama7#130]
unknown                                       uk                                 6.7                 29
                                                     cytochrome P450, family 2, subfamily V, polypeptide 1 [Danio rerio]
unknown                                       uk                                 2.9                 32
                                                     hypothetical protein [Paramecium tetraurelia strain d4-2]
unknown                                       uk                                 39
                                                     GA16901 [Drosophila pseudoobscura pseudoobscura]54
unknown                                       uk                                 1.3
                                                     GK25484 [Drosophila willistoni]                 45
unknown                     uk                               4.7
                                 hypothetical protein [Dictyostelium discoideum46AX4]
unknown                     uk                               6.2
                                 pyruvate synthase [Fusobacterium nucleatum 40  subsp. polymorphum ATC
unknown                     uk                               0.33               TU502]
                                 hypothetical protein [Cryptosporidium hominis 38
unknown                     uk   AgrC                        19                 30
unknown                     uk                               4.8
                                 hypothetical protein [Dictyostelium discoideum30AX4]
unknown                     uk                               14
                                 hypothetical protein [Monosiga brevicollis MX1]36
unknown                     uk                               2.8                42
                                 hypothetical protein MAE_57680 [Microcystis aeruginosa NIES-843]
unknown                     uk                               0.94               37
                                 spore germination protein GerKA [Bacillus cereus AH1134]
unknown                     uk   conditioned medium factor0.96                  22
                                                              [Xanthomonas axonopodis pv. citri str. 306]
unknown                     uk                               0.57
                                 CG3800 [Drosophila melanogaster]               82
Low complexity transcript   uk                               protein
                                 PREDICTED: hypothetical 2E-040                 29
Low complexity transcript   uk                               8E-012
                                 ATPase [Mycobacterium sp. MCS]                 55
unknown                     uk                               4E-011             85
                                 GA25789 [Drosophila pseudoobscura pseudoobscura]
unknown                     uk                               8E-005             31
                                 conserved hypothetical protein [Culex quinquefasciatus]
unknown                     uk                               2E-004
                                 GD10822 [Drosophila simulans]                  46
unknown                     uk                               6E-004             38
                                 hypothetical protein SSAG_03970 [Streptomyces sp. Mg1]
unknown                     uk                               0.001              31
                                 hypothetical protein Y50E8A.i - Caenorhabditis elegans
unknown                     uk                               0.004              29
                                 hypothetical protein, conserved [Eimeria tenella]
unknown                     uk                               0.006
                                 hypothetical protein [Entamoeba dispar SAW760] 22
unknown                     uk                               0.006              28
                                 hypothetical protein Y50E8A.i - Caenorhabditis elegans
unknown                     uk                               protein,           41
                                 PREDICTED: hypothetical 0.028 partial [Strongylocentrotus purpuratus
unknown                     uk                               0.097              44
                                 hypothetical protein [Paramecium tetraurelia strain d4-2]
unknown                     uk                               0.11
                                 PREDICTED: similar to F-box and leucine-rich36  repeat protein 4
unknown                     uk                               0.12               25
                                 hypothetical protein [Plasmodium falciparum 3D7]
unknown                     uk                               0.18
                                 unnamed protein product [Podospora anserina]   40
unknown                     uk                               18                 30
                                 PREDICTED: similar to predicted protein, partial
                     Alphanu                                                      Alphanu
% Match              meric      Text       Best match to               General    meric      Text
length     Species   Index      index      KOG database E value        class      Index      index




     100              32395297 CHYMOTRYPSIN
                                         Trypsin         2E-047    Amino acid transport and metabolism 194861330 X
                                                                               194191206 EDX04782.1
                                                                                         TRYPSIN RELEASING GU
           Stomoxys calcitrans AAO92745.1 195578691 XP_002079197.1 GD2381938833 KOG3627 . 38835 KOG3629FAC
      89              32395297 CHYMOTRYPSIN
                                         Trypsin         4E-047    Amino acid transport and metabolism 195578691 X
                                                                               190661627 EDV58819.1
                                                                                         TRYPSIN RELEASING GU
           Stomoxys calcitrans AAO92745.1 194861330 XP_001969760.1 GG2376938833 KOG3627 . 38835 KOG3629FAC
      74              194753119          Trypsin         2E-023    Amino acid 38833 KOG3627 . 39493 IP10961P 667
                                                                              transport and metabolismKOG4292 360
                                                                                          AAY55479.1
           Drosophila ananassae XP_001958865.1 GF12598 190620163 EDV35687.1 66772335TRYPSIN CUBILIN MULTILI
      72              195127451          Trypsin         1E-022    Amino acid 38833 KOG3627 . 39113 KOG3910 TRA
                                                                              transport and metabolism LOOP 363
                                                                                         TRYPSIN HELIX
           Drosophila mojavensis XP_002008182.1 GI11961 193919791 EDW18658.1 194866012 XP_001971715.1 GG1427
     100              15554312 SERINE PROTEASE PRECURSOR
                                          SSP3           AAY98012.1 SSP3-2 195567170and metabolismKOG4803 356
           Stomoxys calcitrans AAK98781.1Trypsin68500400 1E-041               transport XP_002107143.1 GD15730 1
                                                                                         TRYPSIN UNCHARACTERI
                                                                   Amino acid 38833 KOG3627 . 40000
      97              68500400 SERINE PROTEASE PRECURSOR
                                          SSP3-2         8E-045    Amino acid 38833 KOG3627 . 39124
                                                                              transport XP_002107143.1 GD15730 1
                                                                                         TRYPSIN UNCHARACTERI
           Stomoxys calcitrans AAY98012.1Trypsin 15554312 AAK98781.1 SSP3 195567170and metabolismKOG3921 400
     100              32395299 TRYPSIN Trypsin           2E-047    Amino acid 194150694TRYPSIN CARNITINE CPTI
                                                                              transport and metabolism 195048091 X
                                                                                          EDW66378.1
           Stomoxys calcitrans AAO92746.1 195399323 XP_002058270.1 GJ15994 38833 KOG3627 . 38920 KOG3716 O-A

                    194758280 XP_001961390.1 GF13846 190622688 EDV38212.1 116007474 NP_001036433.1 CG4012
                                          Nuclear helicase MOP-3/SNO (DEAD-box superfamily) RNKB_CERCA ALTNAM
                                                            0.89       Transcription, Signal transduction HELICASE SNO
                                                                                   36726 KOG1513 MOP-3 DEAD-BOX
                                                                                                K
     100 Drosophila ananassae RNK_DROME FULL RIBONUCLEASE KAPPA SHORT RNASENUCLEAR mechanisms . 3
                    125901748 FORM
                              ABN58709.1 TSAL2 125901756 ABN58710.1 8927466 AAF82098.1 -SPECIFIC . 8927464
                                          PRECURSOR SIMILAR TO DEOXYRIBONUCLEASE I KDA repair
                                                            0.29       Replication, recombination and EXORIBONUCLEA
                                                                                               POLY A SALIVARY
      46 Glossina morsitans morsitans A B Poly(A)-specific exoribonuclease PARN 37201 KOG1990 AF259959_1 37241 KO

                   32395295 ANTIGEN PRECURSOR protein containing SCP domainKOG3017 DEFENSE-RELATED
                                       Defense-related 2E-037  Function unknown
                                                                          38227   CONTAINING SCP GL2041
     100 Stomoxys calcitrans AAO72734.1 5 125981615 XP_001354811.1 GA21866 195165386 XP_002023520.1DOMAIN
                   32395295 ANTIGEN PRECURSOR protein containing SCP domainKOG3017 DEFENSE-RELATED
                                       Defense-related 5E-037  Function unknown
                                                                          38227   CONTAINING SCP DOMAIN
     100 Stomoxys calcitrans AAO72734.1 5 195478635 XP_002100589.1 GE16103 194188113 EDX01697.1 125981615
                   32395295 ANTIGEN PRECURSOR protein containing SCP domainKOG3017 DEFENSE-RELATED
                                       Defense-related 1E-023  Function unknown
                                                                          38227   CONTAINING SCP DOMAIN
     100 Stomoxys calcitrans AAO72734.1 5 195478635 XP_002100589.1 GE16103 194188113 EDX01697.1 194894995

      95             37778968 THROMBOSTASIN PRECURSOR PSEUDOURIDINE SYNTHASE RSU RIBOSOMAL CON
                                         Uncharacterized conserved protein
                                                           8E-005        Function 73541573 YP_296093.1 72118986 AAZ61
                                                                                    39456     UNCHARACTERIZED LARG
           Stomoxys calcitrans AAO72731.1 14325798 AAK60013.1 AF299078_1 unknownKOG4255 . 36267 KOG1049 FIP
      57             37778968 THROMBOSTASIN PRECURSOR HYPOTHETICAL KILAmodification, protein turnover, cha
                                         Predicted peptidyl2E-006
                                                            prolyl cis-trans isomerase DOMAIN DNA BINDING 38023 O
                                                                         Posttranslational KOG0415 CIS-TRANS . DNAJ K
                                                                                    35636     PEPTIDYL PROLYL ISOME
           Stomoxys calcitrans AAO72731.1 124512324 XP_001349295.1 23499064 CAD51144.1 124514066 XP_0013503
     100             68500439 PROTEASE 194765937 XP_001965081.1 GF21605 metabolitesORGANIC ANION TRANSP
                                          INHIBITOR        1E-007
           Stomoxys calcitrans AAY98015.1Organic anion transporter                   190617691 biosynthesis, transport and
                                                                                               EDV33215.1 KOG4578 387
                                                                         Secondary 38832 KOG3626 . 39778 195053045 XP
     129             63148854 KDA SECRETED SALIVARY0.23
                                          6.3 68500470 AAY98017.1 4.8 195349115 DOMAIN CONTAINING FOLLISTAT
                                                           GLAND MAC PERFORIN
                                                                         Function unknownKOG4002 . 39207 KOG4004 BM
                                                                                    39205     UNCHARACTERIZED INTE
           Stomoxys calcitrans AAY34549.1Uncharacterized integral membrane protein XP_002041092.1 GM15230 194122

      81   Rattus norvegicus
                      109509437 HYPOTHETICAL NUCLEOTIDASE
                                 XP_001077753.1 126143295 ABN80093.1 5' 149269767 XP_001478231.1 109480113 XP_
                                         Transcription regulator XNP/ATRX, DEAD-box superfamily
                                                           2E-024     Transcription
                                                                                  36233 KOG1015 DEAD-BOX .REGULA
                                                                                            TRANSCRIPTION 37811 K
      76   Rattus norvegicus
                      109472820 HYPOTHETICAL NUCLEOTIDASE CONSERVED ORF and modification
                                 XP_001076490.1 149264191 XP_001472642.1 124514066 XP_001350389.1 23615806 CA
                                         U3 small nucleolar ribonucleoprotein (snoRNP) KOG2600 U3 MPP10P . 35612 K
                                                           4E-016     RNA processing subunit - Mpp10p
                                                                                  37811     SMALL NUCLEOLAR RIBON
      15              124514066 HYPOTHETICAL 23615806 CAD52798.1SIMILAR TO XP_002009828.1NUCLEOLAR RIBON
                                  3D7
           Plasmodium falciparumXP_001350389.1 ORF NUCLEOTIDASERNA processing and modification
                                         U3 small nucleolar ribonucleoprotein (snoRNP) KOG2600 U3GI15578 19390827
                                                           7E-016       195130779 37811 subunit - Mpp10p
                                                                                            SMALL MPP10P . 39924 K
      14              195130779 XP_002009828.1 GI15578 193908278 RNA processing and modification
                                         U3 small nucleolar ribonucleoprotein (snoRNP) KOG2600 U3 MPP10P . 35936 K
                                                           2E-015                 37811 subunit - Mpp10p
                                                                                            SMALL NUCLEOLAR RIBON
           Drosophila mojavensis HYPOTHETICAL ORF CONSERVED EDW07145.1 124514066 XP_001350389.1 2361580

      90              195055332 XP_001994573.1 GH17318 193892336component GAR1 KOG3262 GAR1 . biogenesis
                                         H/ACA small nucleolar RNP Translation,38472
                                                          2E-007     EDV91202.1ribosomal structure and 36139GI10281
                                                                                   195111958 ACA SALIVARY GLAND
                                                                                           H XP_002000543.1 KOG09
           Drosophila grimshawi HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN SECRETED SMALL NUCLEOLAR
     100              68500452 DIPTERICIN17027169 AAL34111.1 118640 P18684.1 FULL FLAGS PRECURSOR DIPA_P
                                           A ANTIMICROBIAL complex, subunit 36139 KOG0921 39797 KOG4597
                                                          0.24       Transcription
                                                                                 MLE       DOSAGE COMPENSATION
           Stomoxys calcitrans AAY98016.1Dosage compensationDIPA DIPD_PROTE DIPTERICIN-D.6015598 CAB57822.1
     100              68500429 STOMOXYN STMX_STOCA 0.56 18652306 AAL77057.1 prediction only
                                          2 47117252 Q8T9R8
                                                          PRECURSOR  General A CHAINKOG3832 . 159163695 1ZRX HY
                                                                                 39036 SOLUTION ACID KOG0304 399
                                                                                           AMINO STRUCTURE IN H2
           Stomoxys calcitrans AAY98014.1Predicted amino acid transporter PDBfunction AF467987_1 35525 TRANSPORTE
      28              134866 P24490.1 SRX23_SARPE II-3 217393 antiporterUNIT 37610 P14667.1metabolism
                                         K+-dependent Na+:Ca2+
                                                          PRECURSOR II
                                                                     Inorganic 134868 KOG2399 SRX2A_SARPE SARC
                                                                                 ALTNAME andATTACIN
                                                                                           IIA K+-DEPENDENT NA+
           Sarcophaga peregrina FULL SARCOTOXIN FLAGS0.79 BAA14185.1 3 ion transport ANTIPORTER

     100              63148856 KDA SECRETED SALIVARY ABG77112.1 2-ISOPROPYLMALATE 93204879 NP_071398.3
                                          10.9 repeat-containing SYNTHASEunknownKOG0270POLYMERASE EPSILO
                                                            GLAND Function PR DOMAINDNA WD40 REPEAT-CONT
           Stomoxys calcitrans AAY34550.1WD40110589206 0.21 protein               35491       CONTAINING ISOFORM F
     100              63148852 KDA SECRETED156548418and polyadenylation factor IICONSERVED CLEAVAGE POLYAD
                                          11.4 cleavage XP_001604583.1 194767324 KOG1896 CFT1 . GF20010 1906
           Stomoxys calcitrans AAY34548.1mRNASALIVARY0.69             RNA processing and modification
                                                                                  37107 XP_001965768.1
                                                                                             MRNA
                                                            GLAND HYPOTHETICAL complex, subunit CFT1 (CPSF sub
     100              63148850 KDA SECRETED47226842 CAG06684.1TranscriptionYP_001290653.1 148716060FACTOR
                                          11.5 SALIVARY0.65 GLAND      148825900  36300 KOG1084 TCF20 .
                                                                                             TRANSCRIPTION ABQ982
           Stomoxys calcitrans AAY34547.1Transcription factor TCF20UNNAMED PRODUCT GLYCOGEN SYNTHASE GLU
     100              63148846 KDA SECRETED63148848 AAY34546.1Energy production KOG3877 NDUFA10 42KDA . 37
                                          13.7 SALIVARY GLAND HYPOTHETICAL CONSERVED UBIQUINONE OXIDO
           Stomoxys calcitrans AAY34545.1NADH:ubiquinone0.11           15.6 NDUFA10/42kDaconversion
                                                                                  39080 and NADH ANTENNAL CARRIE
                                                                                              subunit
                                                            oxidoreductase, 157126205 XP_001660848.1 AAEL_AAEL010
     100              68500386 KDA SECRETED SALIVARY0.009 HYPOTHETICAL GENERAL SECRETION RAT1 . 391
                                          7.4 exonuclease HKE1/RAT1
                                                            GLAND Replication,37255 KOG204412.2 39943016 process
                                                                                   recombination 5'-3' HKE1 UNCHARA
                                                                                             EXONUCLEASE PATHWAY
           Stomoxys calcitrans AAY98011.15'-3' 68500337 AAY98009.1 13.0 68500357 AAY98010.1and repair, RNA XP_361
       9              91088169 SIMILAR TO ribosomal protein L35A/L37
                                         60S               0.14       Translation,36105 KOG0887 60S L35A L37 .
                                                                                   ribosomal structure and EDX08359.1 1
                                                                                             RIBOSOMAL
           Tribolium castaneum XP_972084.1 YELLOW-D 195586016 XP_002082774.1 GD11758 194194783biogenesis
     100              68500416 KDA SECRETED195045442 0.56
                                          26.4 SALIVARY XP_001991977.1 GH24509 193892818 O-ACYLTRANSFERA
                                                            GLAND HYPOTHETICAL BASAL CARNITINE CPTI
                                                                      Lipid       38920 metabolism
                                                                                             BODY
           Stomoxys calcitrans AAY98013.1Carnitine O-acyltransferase CPTI transport andKOG3716 EDV91684.1 6680785
100              63148848 KDA SECRETED63148846 AAY34545.1General functionBAB43815.1 METAL-BINDING . 39
                                     15.6 SALIVARY0.15GLAND POTENTIAL POLYAMINE TRANSPORTER CONSER
                                                                  13.7 13702155 prediction only
      Stomoxys calcitrans AAY34546.1Predicted metal-binding protein                   UNCHARACTERIZED CON
                                                                            38159 KOG2948 CANAG4 13702161 B
 98              195150635          Uncharacterized membrane EDW32146.1 125808210 XP_001360670.1 GA1220
                                                     0.57        Function 39846       UNCHARACTERIZED MEM
      Drosophila persimilis XP_002016256.1 GL10591 194110103 protein unknownKOG4647 . 38869 KOG3665 ZYG
100              68500337 KDA SECRETED68500357 conserved glycine-rich STRUCTURAL TRANSMEMBRANE3775
                                     13.0 SALIVARY1E-007 CELL WALL proteinYP_001327359.1 GLYCINE-RICH
                                                      GLAND       12.2 150396892
                                                                            39176     UNCHARACTERIZED TRI
      Stomoxys calcitrans AAY98009.1Uncharacterized AAY98010.1Function unknownKOG3973 GLYCINE-RICH .CON
101              195392850 XP_002055067.1 GJ19171 194149577 EDW65268.1 194769316 XP_001966751.1 GF1911
      Drosophila virilis



              195127001 XP_002007957.1 GI13232 193919566 EDW18433.1 195015240 XP_001984164.1 GH1628
                                 Predicted SIMILAR TO DROSOPHILA MELANOGASTERRNA-BINDING 39407
                                                 7E-056     General function prediction only
                                                                       35337 KOG0114 SPLICING FACTOR C
99 Drosophila mojavensis FULL BRANCH SITE RNA-binding protein (RRM superfamily) RRM SUPERFAMILY.SPLIC
              156548621 HYPOTHETICAL ISOFORM H4
95 Nasonia vitripennis           Histones H3 and 9E-069
                                                 NP_002098.1 H3 A 4885385 NP_005315.1 3B 38930 KOG37
                                                            Chromatin structure and dynamics TO TYPE FULL
                                                                        C CLUSTER SIMILAR . 6680159 NP_
                                                                                   HISTONES
                         XP_001608164.1 1 4504279HISTONE FAMILY3A B36956 KOG1745 H3 H4UNCHARACTER

99               125772586 XP_001357594.1 GA12322 195159116 XP_002020428.1prediction only, Defense mechanis
      Drosophila persimilis BETA                       4E-063       General     37975 KOG2764 DJ-1 . 35743 KOG052
                                                                                             TRANSCRIPTIONAL REGU
                                     Putative transcriptional regulator DJ-1 function GL13517 54637326 EAL26728.1
98               194744166 XP_001954566.1 GF18333 190627603 EDV43127.1 195569433 XP_002102714.1 GD2005
                                     HMG box-containing protein General function prediction only
                                                       6E-011                   35602 KOG0381 BOX-CONTAINING . 3
      Drosophila ananassae MITOCHONDRIAL TRANSCRIPTION FACTOR A ISOFORM HMG SWI REGULATOR CH
93               195160100 XP_002020914.1
                                     Ngg1-interacting factor 3 protein NIF3L1 39334 KOG4131 NGG1-INTERACTING
                                                       2E-081       General function prediction only
                                                                                             FACTOR
      Drosophila persimilis FULL ALTNAME GL16352 194117864 EDW39907.1 198475710 XP_001357124.2 GA1807
89               194742241           WD40 repeat-containing protein
                                                       2E-037       General function prediction only
                                                                                35487 KOG0266 WD40 REPEAT-CONT
                                                                                             TRANSCRIPTION GI23133
      Drosophila ananassae XP_001953614.1 GF17851 190626651 EDV42175.1 195109502 XP_001999323.1INITIATIO
 8               195130779 XP_002009828.1 GI15578 193908278 EDW07145.1 124514066 XP_001350389.1 2361580
                                     Apoptosis antagonizing transcription factor/protein transport proteinsecretion, KER
                                                       2E-010       Transcription, Intracellular trafficking, KOG4726 and
                                                                                             APOPTOSIS
      Drosophila mojavensis HYPOTHETICAL CONSERVED NUCLEOTIDASE 37984 KOG2773 . 39924 ANTAGONIZIN

100              195339693 XP_002036451.1 GM18026 194130331 EDW52374.1 DELTA ISOFORM B FULL GD236
                                     Elongation factor 1 ELONGATION FACTOR KOG1668 1 . 36195FACTOR BE
                                                       4E-064        chain      36881     ELONGATION KOG0977 36
      Drosophila sechellia EUKARYOTIC TRANSLATIONbeta/deltaTranscription 195578077 XP_002078892.1 PROBA
 94   Drosophila virilis
                 195383580 BIC BICAUDAL ISOFORM A II generalNAC HOMOLOG BTF3RNA related.proteinsGH2176
                            XP_002050504.1 GJ22190 194145301transcription factor KOG2240POLYMERASE II GEN
                                     RNA polymerase 3E-048
                                                        B BETA EDW61697.1 195028590 XP_001987159.1 KOG166
                                                                                37451
                                                                    Transcription          and BTF3 36881
 91              194861406 NUCLEAR DNA-binding nuclear protein p8
      Drosophila erecta                                5E-016       EDV58836.1  39520 KOG4319 DNA-BINDING P8 . 39
                                                                                          NUCLEAR PEROXISOMAL
                            XP_001969777.1 GG10281 190661644 Transcription 195115030 XP_002002070.1 GI17181
 91   Drosophila pseudoobscura pseudoobscura A B JRA_DROME EAL25677.2 195154683 XP_002018251.1 GL17608
                 198458599 ANTIGEN ISOFORM
                            XP_001361101.2 GA15338 198136398 Transcription
                                     Transcriptional activator of the JUN TRANSCRIPTION FACTOR ALTNAME DJRA
                                                       8E-043       FULL family 36055 KOG0837 . 39067 KOG3863 NR
                                                                                          TRANSCRIPTIONAL ACTIV
 70   Mus musculus
                 149264191 HYPOTHETICAL NUCLEOTIDASE MIDASIN processing and modification 195130779 XP_
                            XP_001472642.1 126143295 ABN80093.1 5' 109498316 XP_001074496.1
                                     U3 small nucleolar ribonucleoprotein (snoRNP) KOG2600 U3 MPP10P . 39007 K
                                                       2E-022       RNA         37811 subunit - Mpp10p
                                                                                          SMALL NUCLEOLAR RIBON
 57              149264191 HYPOTHETICAL NUCLEOTIDASE CONSERVED MIDASINXP_001076490.1 126143295 A
      Mus musculus                   U3 small nucleolar ribonucleoprotein (snoRNP) KOG2600 U3 MPP10P . 39007 K
                                                       3E-022       RNA processing and SMALL NUCLEOLAR RIBON
                                                                                37811 subunit - Mpp10p
                            XP_001472642.1 109480113 XP_001063529.1 109472820 modification
 54              25012186 AAN71209.1POLYMERASE II 7E-026 L SHORT ALTNAMEKOG4392POLYMERASE SUBUN
                            FULL RNA RNA polymerase, SUBUNIT Transcription
      Drosophila melanogaster                           subunit                 39593 J KDA POLYPEPTIDE SIMILAR
                                                                                          RNA . 38648 KOG3438 DN
                                      GM15177P 19921456 NP_609836.1 RPB11 194758938 XP_001961713.1 GF1
 24              195453463 XP_002073799.1 GK14301 194169884 EDW84785.1 198454024 XP_001359437.2POLYAD
      Drosophila willistoni                            3E-048
                                     RNA-binding protein hnRNP-M                39413 KOG4212 RNA-BINDINGGA2173
                                                                                          MRNA CLEAVAGE HNRN
                                                                    RNA processing and modification
 20              124514066 HYPOTHETICAL 23615806 CAD52798.1 C2HC type Zn KOG3803 C2HC . 37811 KOG26
                             3D7     Transcription factor containing 126143295 ABN80093.1 5' 149264191 FACTOR
                                                       3E-018       Transcription
                                                                                39007
      Plasmodium falciparumXP_001350389.1 NUCLEOTIDASE CONSERVED ORF finger TRANSCRIPTIONXP_00147
 11   Drosophila erecta
                 194858469 ISOFORM E D C GG25279 190661052 Transcription 161076464 NP_001097244.1 NOT1T
                            XP_001969185.1 regulator of transcription
                                     Negative          1E-104       EDV58244.1            NEGATIVE REGULATOR 1
                                                                                37042 KOG1831 . 38209 KOG2999 RAC
 10              195130779 XP_002009828.1 GI15578 193908278 EDW07145.1 124514066 XP_001350389.1 2361580
                                     U3 small nucleolar ribonucleoprotein (snoRNP) KOG2600 U3 MPP10P . 39924 K
                                                       1E-020        CONSERVED subunit - Mpp10p
                                                                                37811
      Drosophila mojavensis HYPOTHETICAL NUCLEOTIDASE ORFRNA processing and modification  SMALL NUCLEOLAR RIBON

100               195108663 XP_001998912.1 GI24225 6E-054
                                     Ca2+/calmodulin-dependent protein transduction mechanisms subunit B), EF-Han
                                                               Signal phosphatase (calcineurin CALMODULIN-D
                                                                            35257 KOG0034 CA2+ LD19356P 213
                                                                                       AAL39610.2
      Drosophila mojavensis CALCINEURIN SUBUNIT B193915506 EDW14373.1 27819980PHOSPHATASE CALCINEU
 97               194748395 XP_001956631.1 GF24491 190623913 EDV39437.1 195379106 XP_002048322.1 BINDING
                                     Conserved HOMOLOG1E-079   Signal       38380 KOG3170 PHOSDUCIN-LIKE . 3
                                                                                      CONSERVED ATP GJ1390
      Drosophila ananassae VIRAL FACTOR FULL phosducin-like protein transduction mechanisms
 91               17137100 NP_477098.1 B C D G Fsmall 8E-082 Rho type function prediction only SIMILAR TO. GTPA
      synthetic construct            Ras-related E FULL FLAGS General
                                                       GTPase, PRECURSOR NP_599136.1RAS-RELATED TYPE
                                                                            35614 KOG0393 GTPASE RHO 3530
                                                                                      GTPASE
                            ISOFORM A RHO1 19549710 NP_599135.1 19549712 SMALL SMALL24654021 NP_72552
 76               125979715 ISOFORM B C receptor-associated protein and mechanisms RELATED PROTEINS STRU
                             XP_001353890.1 GA12600 54640874 EAL29625.1 37173 KOG1962 B-CELL RECEPTOR-A
                                     B-cell
      Drosophila pseudoobscura pseudoobscura          1E-036                194747267 XP_001956074.1 GF24779
                                                               Defense related proteins
 55   Drosophila pseudoobscura pseudoobscura LIMBS 198453445 XP_002137670.1 GA27349 194111998 EDW34041
                  195152029 SUPERNUMERARY (transducin repeats containing)/Slimb proteins BETA-TRCP . 35495C
                             XP_002016941.1 GL22031 SLIMB
                                     Beta-TrCP        1E-154                35502
                                                               Function unknownKOG0281TRANSDUCIN REPEATS K
 18   Drosophila melanogaster
                  2290597 AAB72148.1 RACK1 171373967E-019 GBLP_DROME FULL GUANINE SUBUNIT ALTNAME
                            RECEPTOR ACTIVATED subunit-like protein 194765659 XP_001964944.1 GF22837 .19533
                                     G protein beta KINASE C
                                                       NP_477269.1 1 transduction mechanisms
                                                               Signal                 G BETA REPEAT ANAPHAS
                                                                            35500 KOG0279 SUBUNIT-LIKE 3662
 17               195168689 XP_002025163.1
                                     Rhomboid family proteins
                                                      8E-006   Signal transduction mechanisms
                                                                            37500 KOG2289 . 36049 KOG0831 ACY
                                                                                      RHOMBOID FAMILY PROT
      Drosophila persimilis ISOFORM C B A GL26733 194108608 EDW30651.1 125983574 XP_001355552.1 GA1424

102              194757281            Mitochondrial polypeptide chain release factor KOG2726 . 39005 KOG3801
                                                        3E-021     Translation,37937
                                                                                 195488245 XP_002092233.1 POLYPE
                                                                                          MITOCHONDRIAL GE1177
      Drosophila ananassae XP_001960893.1 GF13589 190622191 EDV37715.1ribosomal structure and biogenesis BCN
101              194753153 XP_001958882.1 GF12342 190620180 Translation,35618 KOG0397 60S L11MITOCHONDR
                                      60S ribosomal 2E-095                       195382446 XP_002049941.1 GJ2186
                                                                                          RIBOSOMAL . 35619 KOG
      Drosophila ananassae RIBOSOMAL FULL PRF protein L11 EDV35704.1ribosomal structure and biogenesis
101              194765833 XP_001965030.1 GF21662 190617640 EDV33164.1ribosomal structure and biogenesis
                                      60s ribosomal protein L24 Translation,36933 KOG1722 60S L24ISOLOG KOG
      Drosophila ananassae RIBOSOMAL FULL               1E-063                            RIBOSOMAL . 36934 ACTI
                                                                                 195031259 XP_001988318.1 GH1109
100              195428046 XP_002062086.1 GK16839 195428049 Translation,38616 KOG3406 40S S12 . EDW73072
                                      40S ribosomal C 5E-054
                                                        FULL SIMILAR TO DROSOPHILARIBOSOMAL biogenesis S
                                                                                ribosomal structure and BOX H ACA
                                                                                           MELANOGASTER
      Drosophila willistoni RIBOSOMAL ISOFORM Bprotein S12 XP_002062087.1 GK16837 194158171 38377 KOG
100              195451007 XP_002072728.1 GK13532 194168813 Translation,35621 KOG0400 40S S13 . 37622 KOG
                                      40S ribosomal B 4E-080
                                                        FULL SIMILAR TO DROSOPHILAstructure and biogenesis
                                                                                ribosomal RIBOSOMAL SYNTHETASE
                                                                                           MELANOGASTER
      Drosophila willistoni RIBOSOMAL ISOFORM Aprotein S13 EDW83714.1 195107527 XP_001998360.1 GI2367
100              4588920 RIBOSOMAL ISOFORM Bprotein S14 Translation,35628 KOG0407 40S S14 . 35629 KOG
                                      40S ribosomal XP_002025532.1TO DROSOPHILAstructure and biogenesis
                                                        FULL SIMILAR GL15135 198470570 XP_002133506.1 GA227
      Stomoxys calcitrans AAD26263.1 S14 195169445 A 2E-074                                MELANOGASTER
                                                                                ribosomal RIBOSOMAL MITOCHONDR
100              195042086 XP_001991362.1 GH12611 193901120 Translation,38621 KOG3411 40S S19 . 35789
                                      40S ribosomal B 9E-067
                                                        C FULL     EDV99986.1ribosomal structure and biogenesis M
                                                                                 396531 CAA51677.1 S19 195399183
                                                                                          RIBOSOMAL PERMEASE
      Drosophila grimshawi RIBOSOMAL ISOFORM Aprotein S19SIMILAR TO DROSOPHILA MELANOGASTER KOG
100              195113089 XP_002001102.1 GI22154 193917696 EDW16563.1ribosomal structure and biogenesis
                                      40S ribosomal protein S20 Translation,36118 KOG0900
                                                        2E-048                   194742782 XP_001953880.1TRANSG
                                                                                          RIBOSOMAL TGC GF1798
      Drosophila mojavensis SIMILAR TO DROSOPHILA MELANOGASTER RIBOSOMAL FULL 40S S20 . 39775 KOG
100              38048731 AAR10268.1 CG8415 22024141 NP_610939.2 S23 125811142FULL 40S S23 . 36961 KOG
      Drosophila yakuba               40S ribosomal protein S23 Translation,36960 KOG1749
                                                        1E-074                  ribosomal structure and biogenesis
                                                                                          RIBOSOMAL MITOCHONDR
                            SIMILAR TO DROSOPHILA MELANOGASTER RIBOSOMAL XP_001361764.1 GA21060 1
100              194746037 XP_001955491.1 GF18798 190628528 EDV44052.1ribosomal structure and biogenesis REP
                                      40S ribosomal protein DROSOPHILA MELANOGASTER 40S S8 ANKYRIN
      Drosophila ananassae RIBOSOMAL FULL SIMILAR2E-086  TO S8                   125772762 XP_001357651.1 GA2060
                                                                                          RIBOSOMAL . 37716 KOG2
                                                                   Translation,38493 KOG3283
100              195118268 XP_002003662.1 GI21657 193914237 SIMILAR TO DROSOPHILA MELANOGASTER
                                      60s acidic FULL ALTNAME P1
                                                        1E-039     Translation,36973 KOG1762 60S P1 60S P1 19538
                                                                                 18253043ACIDIC RIBOSOMAL KOG3
                                                                                           AAL62466.1 . 38659 THYR
      Drosophila mojavensis ACIDIC RIBOSOMAL ribosomal protein EDW13104.1ribosomal structure and biogenesis
100              195107102 XP_001998155.1 GI23790 193914749 EDW13616.1ribosomal structure and biogenesis ALT
                                      60s ribosomal protein L10 Translation, ISOFORM RIBOSOMAL . 38632 KOG
                                                        3E-088                   195446418 XP_002070771.1 GK1084
                                                                                          C D FULL RIBOSOMAL
      Drosophila mojavensis QM SIMILAR TO DROSOPHILA MELANOGASTER 36075 KOG0857 60S L10MITOCHONDR
100              195451719 XP_002073047.1 GK13926 194169132 EDW84033.1 21357053 NP_649560.1 L13A 19489
                                      60S ribosomal protein DROSOPHILA MELANOGASTER 60S L13A . 38413 KOG
      Drosophila willistoni RIBOSOMAL FULL SIMILAR1E-069                        ribosomal structure and biogenesis
                                                         TO L13a Translation,38414 KOG3204RIBOSOMAL MITOCHONDR
100              125982680 XP_001355137.1 GA20486 MELANOGASTER RIBOSOMAL ISOFORMand biogenesis ALT
                                      60S ribosomal protein L36 Translation,38662 KOG3452 60SA B STRUCTURAL
                                                        2E-040                  ribosomal structure L36C D FULL
                                                                                          RIBOSOMAL . XP_002022
      Drosophila persimilis SIMILAR TO DROSOPHILA 194763819 XP_001964030.1 GF21342 19516364636182 KOG
100              116007488 NP_001036440.1 L38 195430916L38 Translation,38709 KOG3499 60SQ6XIM7.1 RL38_D
                                      60S ribosomal protein DROSOPHILA MELANOGASTER HYPOTHETICAL CONS
      Drosophila willistoni RIBOSOMAL FULL SIMILAR1E-031                        ribosomal structure L38 .
                                                                                          RIBOSOMAL
                                                         TO XP_002063494.1 GK21940 74917238and biogenesis
100               24582672 NP_609179.2 L36A 194759862 XP_001962166.1 GF15330 KOG3464 60S L44ISOLOG KOG
      Drosophila yakuba               60S ribosomal DROSOPHILA MELANOGASTER structure and biogenesis
                                                          6E-050                    ribosomal RIBOSOMAL . 36934 RRN
                            RIBOSOMAL SIMILAR TOprotein L44 Translation,38674 194863010 XP_001970232.1 GG
100               21357161 NP_651876.1 L6ribosomalB A 1E-030 17945112 AAL48616.1 RE08669P L6 biogenesis
      synthetic construct             60s 7302066 protein L6                        ribosomal structure and .MLX INTERAC
                                                                                              RIBOSOMAL 38789 ACL8
                            RIBOSOMAL ISOFORM AAF57167.1 Translation,36907 KOG1694 60S 220947836KOG3
100   Culex tarsalis
                  62471795 NP_001014551.1 L41 109627676 NP_001035914.1 209571497 structure and biogenesis
                            RIBOSOMAL UNNAMED PRODUCT HYPOTHETICAL COMPONENT CYTOSOLIC RIBOS
                                      Ribosomal protein L41
                                                          9E-010                    ribosomal RIBOSOMAL UNCHARACT
                                                                                              NP_001129379.1 KOG2357
                                                                       Translation,39949 KOG4752 L41 . 37568 20957149
100               17136570 NP_476776.1 L40 58390190 STEPHENSI UBIQUITINribosomal UNNAMEDL40 . 35228 KOG
      synthetic construct             Ubiquitin/60s ribosomal protein L40 fusion FUSION structure and biogenesis FU
                                                          1E-066       Translation,35227 KOG0003 60S PRODUCT EXTE
                                                                                              UBIQUITIN RIBOSOMAL
                            RIBOSOMAL ANOPHELES XP_317555.2 AGAP007927-PA 125986696 XP_001357111.1 G
 98               195026314 RIBOSOMAL ISOFORM Bprotein S15 TO DROSOPHILA MELANOGASTER biogenesis
      Drosophila virilis              40S ribosomal A 3E-077
                                                          SIMILAR XP_002005557.1 KOG0898 40S S15 36117 KOG
                                                                                    ribosomal structure and MITOCHONDR
                                                                                              RIBOSOMAL RIBSOMAL
                             XP_001986229.1 GH20641 195122114 Translation,36116 GI19004 195384301. XP_002050
 98               195452576 XP_002073414.1 GK14111 194169499 EDW84400.1 195113493 XP_002001302.1 GI2204
                                      40S
      Drosophila willistoni RIBOSOMAL ribosomal protein S31E-120                    ribosomal structure and GLYCINAMIDE
                                                                                              RIBOSOMAL . 35458 KOG0
                                                                       Translation,38391 KOG3181 40S S3 biogenesis
 97               198462092 RIBOSOMAL SIMILAR TO DROSOPHILA MELANOGASTER CYTOSOLIC SMALL1947410
                             XP_001352335.2 GA10310 198142795 EAL29373.2 ribosomal structure and biogenesis
                                      40s ribosomal protein S27 Translation,36990 KOG1779 40S S27 S27 SUBUN
      Drosophila pseudoobscura pseudoobscura              3E-042                               NP_651359.1 . 36810 KOG
                                                                                     24649976RIBOSOMAL TRANSCRIPT
 97               195396671 RIBOSOMAL ISOFORM Dprotein FULL SIMILAR TO ribosomal structure and biogenesis
      Drosophila virilis              60S ribosomal 194146721 EDW62440.1DROSOPHILA MELANOGASTER
                                                          B C L22 Translation,38563 KOG3353 60S L22MITOCHONDR
                             XP_002056954.1 GJ16610A 2E-071                                   RIBOSOMAL . 36923 KOG
                                                                                      195438590 XP_002067217.1 GK1630
 97   Brugia malayi
                  170579899 HYPOTHETICAL TUMOR DIFFERENTIALLY EXPRESSED SECRETED .
                             XP_001895031.1 BM1_17870 158598170 EDP36122.1 116833117 ABK29471.1 CHK1 CHE
                                      Aminopeptidase I 0.22 metalloprotease (M18) KOG2596 M18
                                                          zinc         Amino acid 37807
                                                                                   transport and metabolism
                                                                                              AMINOPEPTIDASE I ZINC M
 95               195439984 XP_002067839.1 GK12506 1E-124
                                      60s ribosomal protein L2/L8 Translation,37520 KOG2309 60S L2 biogenesis KO
                                                          FULL SIMILAR TO           ribosomal structure and L8 . 35659
                                                                                              RIBOSOMAL MITOCHONDR
      Drosophila willistoni RIBOSOMAL ISOFORM A B194163924 EDW78825.1 125980540 XP_001354294.1 GA1172
 94               195125314 XP_002007124.1 GI12761 B 2E-049 EDW17600.1ribosomal structure and biogenesis
                                      60S ribosomal 193918733 Translation,38622 KOG3412 60S L28RAN GJ1552
                                                          D FULL                     195402986 MELANOGASTER KOG
                                                                                              RIBOSOMAL . 39399
      Drosophila mojavensis RIBOSOMAL ISOFORM Aprotein L28SIMILAR TO DROSOPHILAXP_002060078.1RELATE
 94               195428158 XP_002062141.1 GK16809 194158226 EDW73127.1 195014627andRNA-BINDINGGH162
                                      Predicted RNA-binding protein containing ribosomal structure and biogenesis
      Drosophila willistoni ISOFORM A B                   4E-020                    PIN domain XP_001984048.1 . 37773
                                                                                              CONTAINING in translation
                                                                       Translation,38280 KOG3070 invovledPIN DOMAIN
 90               195437414 XP_002066635.1 GK24462 conserved SHORT FLAGS PRECURSOR
                                      Uncharacterized 194162720 EDW77621.1 195161266 XP_002021489.1 GL2653
                                                          6E-087       Function unknown antigen P15)
                                                                                   38489      UNCHARACTERIZED CON
      Drosophila willistoni MITOCHONDRIAL RIBOSOMAL FULL protein (melanoma KOG3279 P15 . 38488 KOG3278
 86               170576227 UNSPECIFIC MONOOXYGENASE NICOTINIC ACETYL CHOLINE RECEPTOR UNNAMED
      Brugia malayi                   Predicted transcription factor Transcription
                                                          0.023                    39010 KOG3806 . 37042 KOG1831 381
                                                                                              TRANSCRIPTION FACTOR
                             XP_001893546.1 158600379 EDP37618.1 170571523 XP_001891759.1 ALPHA-L1 170573
 85               90080596 UNNAMED 84579145 HYPOTHETICAL UNKNOWN CONSERVED ACTIN GAMMA
      Macaca fascicularis BAE89779.1 PRODUCTBAE73006.1 219887055 ACL53902.1 165924242 ZP_02220074.1 16
 83   Drosophila yakuba
                  195493878 EUKARYOTIC INITIATION FACTOR FULL TRANSLATION SUBUNIT ALTNAME BETA SH
                             XP_002094602.1 GE20110 194180703 EDW94314.1(eIF-2beta) XP_002048167.1. GJ1381
                                      Translation initiation factor 2, Translation,37979 KOG2768 2 EIF-2BETA 37978
                                                          1E-078       beta subunitribosomal structure and biogenesis
                                                                                      195378795
                                                                                              TRANSLATION INITIATION
 78               195381291 FULL RIBOSOMAL ISOFORM A C SIMILAR TO DROSOPHILARIBOSOMAL biogenesis
      Drosophila virilis              40S ribosomal protein S11 Translation,36939 KOG1728 40S S11 . 36951 KOG
                                                          5E-076                    ribosomal structure and MITOCHONDR
                                                                                                MELANOGASTER
                             XP_002049387.1 GJ21555 194144184 EDW60580.1 195122331 XP_002005665.1 GI1894
 78   Sarcophaga crassipalpis
                  6911249 AAF31449.1 AF220939_1 60SALTNAME APURINIC OR APYRIMIDINICP19889.1 RLA0_DRO
                            ACIDIC RIBOSOMAL FULL 3E-077
                                      60S acidic ribosomal 17737731 NP_524211.1 LP0 11398760S P0LYASE ENDON
                                                          P0 protein P0Translation,36033 KOG0815 SITE biogenesis
                                                                                    ribosomal structure and . 36973 KOG1
                                                                                              ACIDIC RIBOSOMAL INVOL
 76               195113107 XP_002001110.1 GI10603 193917704 EDW16571.1ribosomal structure A B RH08962P Po
                                      Ubiquitin-like/40S 1E-017
                                                           ribosomal S30 protein 35233 KOG0009 UBIQUITIN-LIKENUC
                                                                       Translation,fusion
                                                                                     21406650RIBOSOMAL FUSION 40S
                                                                                               AAL49305.2
      Drosophila mojavensis SIMILAR TO DROSOPHILA MELANOGASTER RIBOSOMAL ISOFORMand biogenesis, 195
 70               194761564 XP_001962999.1 GF14155 190616696 Translation,35623 KOG0402 60S L37TRANSCRIPT
                                      60S ribosomal B 8E-047
                                                          FULL SIMILAR TO            17864394RIBOSOMAL . 37163 KOG
                                                                                               NP_524781.1 L37A 245818
      Drosophila ananassae RIBOSOMAL ISOFORM Aprotein L37 EDV32220.1ribosomal structure and biogenesis
 61               118083774 SIMILAR TO HYPOTHETICAL CONSERVED ZGC UNNAMED EPIDERMAL GROWTH FAC
      Gallus gallus                   Epidermal growth 0.55 receptor kinase substrate PRODUCT
                                                           factor      Signal transduction mechanisms
                                                                                   38765 KOG3557 .
                             XP_001231536.1 AC1147 68226711 NP_001020173.1 LOC310926 32264609 AAP78751.1
 60   Drosophila yakuba
                  38047829 AAR09817.1 RPL27A 38048401 AAR10103.1 17136880 NP_476963.160S L15MITOCHONDR
                            SIMILAR TO DROSOPHILA MELANOGASTER RIBOSOMAL FULL L27A 194766215 XP_
                                      60s ribosomal protein L15/L27
                                                          2E-031                    ribosomal structure and biogenesis K
                                                                                              RIBOSOMAL L27 . 36064
                                                                       Translation,36953 KOG1742
 59               195440032 XP_002067863.1 GK12672 194163948 EDW78849.1 195376479 XP_002047024.1 GJ1215
                                      Translation initiation factor 3, Translation,37969 KOG2758 3 EIF-3E . INITIATION
                                                          1E-126       subunit (eIF-3e)
                                                                                    ribosomal structure and biogenesis
                                                                                              TRANSLATION 36711 KOG
      Drosophila willistoni HOMOLOGUE FULL PROBABLE EUKARYOTICeTRANSLATION INITIATION FACTOR SU
 58               domestica CAM36311.1 116792173 ABK26259.1 116779928 ABK21482.1 148616181 HYBRID HISTID
      Thermobia 133916482 HYPOTHETICAL UNKNOWN GOLDFISH MITOCHONDRION SIMILAR TO ABQ96857.1 34
 44               195582687 XP_002081157.1 GD25848 194193166 Translation,36426 KOG1212 . 36425 biogenesis,397
                                      Amidases
      Drosophila simulans ISOFORM A C D E                 2E-044                     19922090 NP_610764.1 CG8839 Lip
                                                                                              AMIDASES UNCHARACTER
                                                                       EDX06742.1ribosomal structure and KOG1211 246
 31               195578177 XP_002078942.1 GD23690 194190951 Translation,38501 FLAGS PRECURSOR GE1893
                                      Ribosomal protein S71E-017       EDX04527.1ribosomal structure .
                                                                                     195473645 XP_002089103.1
      Drosophila simulans MITOCHONDRIAL RIBOSOMAL FULL SHORT ALTNAMEKOG3291 S7 and biogenesis RIBOSOMAL
 26   Anopheles dirus B
                  64330507 AAY41405.140S ribosomal protein S2
                            RIBOSOMAL 170059827 XP_001865531.1 60S 167878476 EDS41859.1 58392254 XP_3
                                       L12                8E-005                    ribosomal structure and .
                                                                                              RIBOSOMAL
                                                                       Translation,36104 KOG0886 40S S2 biogenesis
 14               124514066 HYPOTHETICAL 23615806 CAD52798.1 195130779 biogenesis
                              3D7     Nucleolar protein involved Translation,37358 KOG2147 40S . 37811 KOG2600
                                                          6E-014                    ribosomal structure and biogenesis IN
                                                                                              NUCLEOLAR INVOLVED
      Plasmodium falciparumXP_001350389.1 CONSERVED ORF in 40S ribosome XP_002009828.1 GI15578 19390827
 11   Xanthomonas campestris pv. campestris 167733515 CAP51719.1 21231502 NP_637419.1 66768443turnover, cha
                  188991755 HISTIDINE 26S proteasome regulatory complex, HYBRIDPSMD9
                             YP_001903765.1 RESPONSE REGULATOR subunit UNNAMED 26S PSMD9 . 35696 K
                                      KINASE              0.52                     38339 KOG3129 PRODUCT
                                                                                              PROTEASOME REGULATO
                                                                       Posttranslational modification, protein YP_243205.
 10               222836824 EEE75217.1 156340834 XP_001620570.1 NEMVEDRAFT_V1G147740 156205654 EDO28
      Populus trichocarpa METAL TOLERANCE HYPOTHETICAL

96               28574723 NP_730714.2 3047004 AAD09430.1 2 28380625 AAN12195.2 17737735 NP_524213.1 1571
                            CYSTEINE MolecularISOFORM C A B CSP_DROME FULLKOG0716 . 35932 KOG0713 cha
      Drosophila melanogaster                          9E-068      Posttranslational       MOLECULAR turnover, 359
                                     STRING chaperone (DnaJ superfamily)35935modification, protein CHAPERONE
90                          FULL GLUTATHIONE ALTNAME GST TRANSFERASE I modification, protein turnover, cha
                                     Glutathione S-transferase
                                                       3E-049      Posttranslational S
                                                                               36085 KOG0867 S-TRANSFERASE . 3
                                                                                           GLUTATHIONE UNCHARAC
                 1346214 P42860.2 GSTT1_LUCCU S-TRANSFERASE 1-1 CLASS-THETA 121696 P28338.1 GSTT1_
72               170027632 XP_001841701.1 S-TRANSFERASE 167862271 EDS25654.1 94469254 ABF18476.1 1947
                                     Glutathione S-transferase
                                                       3E-039      Posttranslational modification, protein turnover, cha
                                                                               35627 KOG0406 S-TRANSFERASE . 3
      Culex quinquefasciatusGLUTATHIONE TRANSFERASE OMEGA CLASS ISOFORM BGLUTATHIONE INTRACELL
70               195473635 XP_002089098.1 GE26020 194175199 EDW88810.1 195050668 XP_001992941.1 GH133
      Drosophila yakuba                                4E-067      Posttranslational KOG2291 . protein turnover, SEC
                                                                                (ribophorinOLIGOSACCHARYLTRANS
                                                                                            I)
                                     Oligosaccharyltransferase, alpha subunit37502modification, 38949 KOG3745 cha
56    Drosophila pseudoobscura pseudoobscura
                 125978277 DISULFIDEProteinGA20009 isomerase (prolyl 4-hydroxylase SHORT PDI DPDI turnover, cha
                            XP_001353171.1 disulfide 54641924 EAL30673.1 35411modification, protein FLAGS P543
                                      ISOMERASE ISOFORM A PDI_DROME FULLKOG0190 4-HYDROXYLASE . PR
                                                       4E-069      Posttranslational beta subunit) ISOMERASE 3
                                                                               17647799 NP_524079.1 1709616 PREC
                                                                                           DISULFIDE
55    Glossina morsitans morsitans
                 50897523 AAT85824.1Alkyl PEROXIDASE reductase, thiol FULL PEROXIREDOXIN ALTNAME CYTOSR
                            THIOREDOXIN hydroperoxide ISOFORM AGK25196 194167394 EDW82295.1 194768002
                                      1 195447650 XP_002071309.1 B specific antioxidant and36072 KOG0854 cha
                                                       2E-049      Posttranslational modification, HYDROPEROXIDE
                                                                               36070 KOG0852 . protein turnover, 360
                                                                                           ALKYL related enzymes
55    Glossina morsitans morsitans
                 50897523 AAT85824.1Alkyl PEROXIDASE reductase, thiol FULL PEROXIREDOXIN ALTNAME CYTOSR
                            THIOREDOXIN hydroperoxide ISOFORM AGK25196 194167394 EDW82295.1 194768002
                                      1 195447650 XP_002071309.1 B specific antioxidant and36072 KOG0854 cha
                                                       2E-049      Posttranslational modification, HYDROPEROXIDE
                                                                               36070 KOG0852 . protein turnover, 360
                                                                                           ALKYL related enzymes
49               195116763 XP_002002921.1 GI17638 193913496 EDW12363.1 195473299 XP_002088933.1 GE1050
                                     RAB proteins geranylgeranyltransferase component RAB PROTEINS GERANYL
      Drosophila mojavensis GDP DISSOCIATION INHIBITOR 4E-092                  36652 KOG1439 . protein protein) 396
                                                                                           A (RAB escort turnover,
                                                                   Posttranslational modification, 39606 KOG4405 cha
34               195050557           Predicted serine 193899978 Posttranslational modification, 36256 KOG1038 cha
                                                       2E-080
      Drosophila grimshawi XP_001992919.1 GH13380 protease                     37448 KOG2237 . protein turnover, DN
                                                                                           SERINE PROTEASE MITOC
                                                                   EDV98844.1 194761818 XP_001963120.1 GF1409
28               194754577           FKBP-type peptidyl-prolyl cis-trans isomerase modification, protein turnover, cha
                                                       5E-021      Posttranslational KOG0543 FKBP-TYPE GE1390
                                                                               35763       ISOMERASE CYCLOPHILIN
      Drosophila ananassae XP_001959571.1 GF12939 190620869 EDV36393.1 195487395 XP_002091890.1PEPTIDY
16               124514066 HYPOTHETICAL 23615806 CAD52798.1 149264191 XP_001472642.1 109472820 XP_001
                             3D7     Molecular chaperone (DnaJ superfamily)35936 KOG0717 . protein CHAPERONE
                                                       1E-015      Posttranslational       MOLECULAR turnover, U3
      Plasmodium falciparumXP_001350389.1 ORF CONSERVED NUCLEOTIDASE modification, 37811 KOG2600 cha
 7               74271761 BAE44308.1RhoA GTPase effector DIA/Diaphanous 37135 KOG1924 . GTPASE EFFECTOR
      Chilo suppressalis              70 4336885 AAD17996.1 SHORT HSC HSP
                                                       6E-006      Signal transduction XP_001359891.1 GA18066 19
                                                                                           RHOA 35324 KOG0101
                            HEAT SHOCK COGNATE KDA FULL SCHSC70 125778264mechanisms, Cytoskeleton HSP

103               195150464 SIMILAR TO DROSOPHILA 198457263complex,HYPOTHETICAL TRANSLOCATIONKOG0
                            XP_002016174.1 GL11450 MELANOGASTER beta subunit TRANSLOCATION COMPLE
                                     Sec61 protein translocation XP_001360608.2 modification, protein 35384 COMP
      Drosophila pseudoobscura pseudoobscura          2E-025                    38667 KOG3457 SEC61 . turnover, cha
                                                                   Posttranslational GA10096 194110021 EDW32064
101               125976998 SIGNAL SEQUENCE
                            XP_001352532.1 GA18908 54641279 EAL30029.1 38527 KOG3317 TRANSLOCON-ASSO
                                     Translocon-associated BETA
                                                      1E-040       Intracellular195168305 secretion, TRAP BETA SUB
                                                                                 trafficking, XP_002024972.1 GL17832
      Drosophila pseudoobscura pseudoobscura RECEPTOR complex TRAP, beta subunit COMPLEXand vesicular tran
100               21355569 NP_651198.1 AP-1SIGMA 195144988 small subunitCOAT ASSEMBLY. SIMILAR TO ADAPTI
      synthetic construct            COMPLEX SMALL CHAIN CLATHRIN 36152 KOG0934 36153 XP_00135878
                                                      4E-071       Intracellular trafficking, CLATHRIN ADAPTOR COM
                                                                                              secretion, and vesicular 361
                            ADAPTOR Clathrin adaptor complex, XP_002013478.1 GL23383 198452468 KOG0935 tran
100               17136866 NP_476955.1 79F 24668762 NP_730757.1factor C H 35293 KOG0070 ALTNAME SIMILAR TO
      synthetic construct            GTP-binding ADP-ribosylation B A Arf1ENP_730758.1 GTP-BINDING ADP-R
                                                      9E-093       Intracellular F I ARF FACTOR VESICLE COAT C
                                                                                              secretion, and NP_730759.1
                            ADP RIBOSYLATION FACTOR ISOFORM24668769trafficking,FULL24668773 vesicular tran
100   Pediculus humanus corporis
                  212512152 CONSERVED HYPOTHETICAL SPASE Intracellular39315 KOG4112 COMPLEX SUBUNITX
                            EEB14979.1 195109562 XP_001999353.1 GI24466 193915947secretion, andKOG0254 tran
                                     Signal peptidase subunit
                                                      7E-025                     trafficking, SIGNAL PEPTIDASE SUBU
                                                                                               EDW14814.1 195394399 A
                                                                    FULL SIGNAL PEPTIDASE . 35475 vesicular
100               170060494 XP_001865828.1 167878942 EDS42325.1 125806670 complex, subunit TOM7
                                     Translocase of outer mitochondrial membrane KOG4449 TOM7 . vesicular tran
                                                      2E-012       Intracellular39650
                                                                                 trafficking, TRANSLOCASE OUTER MI
                                                                                              secretion, and
      Culex quinquefasciatusOUTER MITOCHONDRIAL TRANSLOCASE SUBUNIT XP_001360112.1 GA20911 1951490
100               3065729 AAC14276.1 195495985 XP_002095502.1light chain 195591777 XP_002085615.1CLATHRIN1
                            CLATHRIN Vesicle CHAIN CLC_DROME GE19653 39234 KOG4031 . 36359 KOG1144 tran
      Drosophila melanogaster                         2E-042         FULL ALTNAME DCLC        secretion, and vesicular 5B
                                      LIGHT coat protein clathrin, Intracellular trafficking, VESICLE COAT GD14863
               195120896 XP_002004957.1 GI20208 193910025 EDW08892.1trafficking, SYNAPTOBREVIN SNARE
                                   Synaptobrevin/VAMP-like protein
                                                     7E-038     Intracellular36078 KOG0860 VAMP-LIKE . 36077 K
                                                                               195383616 XP_002050522.1 GJ2015
                                                                                           secretion, and vesicular SY
 93 Drosophila mojavensis SYNAPTOBREVIN ISOFORM A SIMILAR TO DROSOPHILA MELANOGASTER SYB Ctran
               125773319 XP_001357918.1 GA19431 195158266 XP_002020013.1 KOG3316 . 38525 KOG3315 tran
                                   Transport protein 4E-056 (TRAPP) complex subunit TRANSPORT vesicular 354
                                                     particle   Intracellular trafficking, secretion, and EAL27054.1
 80 Drosophila persimilis TRAFFICKING PARTICLE COMPLEX SUBUNIT 38526 GL13756 54637652PARTICLE TR
               195449705 XP_002072188.1 recognition5E-074 subunit Srp7237587 KOG2376 SRP72 . 37213GI1058
 44 Drosophila willistoni                             particle, Intracellular trafficking, SIGNAL RECOGNITIONtran
                                                                                           secretion, and vesicular PA
                                   Signal GK22456 194168273 EDW83174.1 195113033 XP_002001074.1 KOG2

103              194759466 XP_001961968.1 A B
                                     NADH-ubiquinone2E-061
                                                       oxidoreductase, subunit NDUFB10/PDSW
                                                                 Energy production KOG4009 NADH-UBIQUINONE
                                                                             39212 and OXIDOREDUCTASE SUBU
                                                                                         conversion
      Drosophila ananassae PDSW ISOFORM GF15236 190615665 EDV31189.1 195433264 XP_002064635.1 GK2372
100              95105403 ATP SYNTHASE 186694624 5E-064
                                      F0 SUBUNIT ACC86236.1 related proteinsKOG4665SYNTHASE SUBUNIT
                                                      subunit    Energy production and ATP F0 6 . 36492 KOG127
                                                                             39864       conversion
      Stomoxys calcitrans ABF51676.1ATP6synthase F0ATPASE6 and67009995 YP_245501.1 66796427 AAY56475.1 1
100              194744215 XP_001954590.1 CYTOCHROME C OXIDASE POLYPEPTIDE XP_001980974.1 SHORT
                                     Predicted membrane protein Function unknownKOG2704 . 35266UNCHARACTE
                                                      0.21                   37915       MEMBRANE KOG0043 DM
      Drosophila ananassae FULL PROBABLE GF16667 190627627 EDV43151.1 194903960MITOCHONDRIALGG1745
100              125772503 XP_001357564.1 GA14517 194744513 XP_001954738.1 GF16589 195062153 XP_001996
                                     Mitochondrial F1F0-ATP ATP SYNTHASE LIPID BINDING PRECURSOR SUBU
                                                      5E-056     Energy production KOG3025 F1F0-ATP ATP9 . 354
                                                                             38235 and MITOCHONDRIAL SYNTHA
                                                                                         conversion
      Drosophila persimilis ISOFORM A B C MITOCHONDRIALsynthase, subunit c/ATP9/proteolipid
100              195446058 XP_002070608.1 GK10942 MELANOGASTER ISOFORM KOG4326 F1F0-ATP . 35804 KO
                                     Mitochondrial F1F0-ATP synthase, subunit e
                                                      5E-028     Energy production and MITOCHONDRIAL SYNTHA
                                                                             39527 A B KD BASIC
                                                                                         conversion
      Drosophila willistoni SIMILAR TO DROSOPHILA 194166693 EDW81594.1 195055949 XP_001994875.1 GH174
100   Drosophila pseudoobscura pseudoobscura
                 125983690 SIMILAR TO DROSOPHILA 54643926 EAL32669.1 38678 KOG3468 NDUFB7 B18 . 37163
                             XP_001355610.1 GA18962 MELANOGASTER production and NADH UBIQUINONE OXIDO
                                     NADH:ubiquinone4E-043
                                                       oxidoreductase, NDUFB7/B18 subunit
                                                                 Energy                   XP_002025068.1 GL26782
                                                                             195168498 conversion
100              195012185 XP_001983517.1 H+-ATPase V0 sector, subunit M9.7 (M9.2)conversion SECTOR SUBU
                                     Vacuolar         1E-032     EDV95865.1 195375094 XP_002046338.1 GJ1284
                                                                             38710 and VACUOLAR
      Drosophila grimshawi ISOFORM A B C GH15937 193896999 Energy production KOG3500 H+-ATPASE V0 M9.7
 99              95105404 CYTOCHROME C OXIDASE1E-106
                                      186694625 oxidase subunit III and related proteins CYTOCHROME OXIDASE S
                                                       SUBUNIT Energy production KOG4664 . 35729 KOG0509 DH
                                                                             39863 and conversion
      Stomoxys calcitrans ABF51677.1Cytochrome ACC86237.1 186694617 ACC86230.1 67009996 YP_245502.1 667
 99              195392475 XP_002054883.1 GJ24692 194152969 EDW68403.1 195038539 XP_001990714.1 GH1951
      Drosophila virilis                              1E-083     Energy production KOG0233 H+-ATPASE V0 C'' . 3
                                                                             35454 and VACUOLAR SECTOR SUBU
                                     Vacuolar H+-ATPase V0 sector, subunit c''           conversion
 99              195429515 XP_002062804.1 GK19648 194158889 EDW73790.1 194758142 XP_001961321.1 GF1380
                                     Vacuolar H+-ATPase V0 sector, subunits D VATL_DROME FULLSECTOR SUBU
                                                      6E-069     Energy B C35453 and VACUOLAR PROTON KDA
                                                                              c/c'       conversion
      Drosophila willistoni VACUOLAR H ATPASE SUBUNIT ISOFORM A production KOG0232 H+-ATPASE V0 C' . 35
 97              195394547 XP_002055904.1 GJ10644 194142613 EDW59016.1 195062135 XP_001996140.1 GH1433
      Drosophila virilis                              5E-054     Energy production and ATPASE MEMBRANE SECT
                                                                             39934       conversion
                                     ATPase membrane sector associated protein KOG4737 . 37576 KOG2365 382
 97              194770890 XP_001967516.1 GF20699 190618526 Energy production KOG1664 H+-ATPASE V1 .SUBU
                                     Vacuolar H+-ATPase V1 sector,VATE_DROME and conversion SECTOR 3621
                                                      2E-090     A subunit E 36877 FULL PROTON -ATPASE 26K
                                                                                          NP_524237.1
      Drosophila ananassae VACUOLAR H E SUBUNIT ISOFORM BEDV34050.1 17737775VACUOLAR ATPASE SHOR
 96              186694618 ACC86231.1 3 95105405 ABF51678.1 Energy production KOG4662 3DEHYDROGENASE
                                     NADH dehydrogenase subunit 3 and related proteinsconversion
                                                      7E-031                 39861 and NADH . 38851 KOG3645 6
      Stomoxys calcitrans NADH DEHYDROGENASE SUBUNIT 186694626 ACC86238.1 186694634 ACC86245.1 36
 96              195024283 XP_001985843.1 GH21035 193901843 Energy production KOG1687 subunit
                                     NADH-ubiquinone8E-096
      Drosophila grimshawi ISOFORM A B                           EDW00710.1 195123641 XP_002006312.1 PSST
                                                                             36900 and conversion
                                                                                          kDa NADH-UBIQUINONE
                                                       oxidoreductase, NUFS7/PSST/20OXIDOREDUCTASEGI1863
 95              195430788 XP_002063430.1 GK21400 MELANOGASTER C REDUCTASE HYPOTHETICAL
      Drosophila willistoni SIMILAR TO DROSOPHILA 194159515 EDW74416.1 195380838 XP_002049168.1 GJ2089
 94              195130173 XP_002009527.1 GI15405 193907977 EDW06844.1subunit/cell death-regulatory protein
                                     NADH:ubiquinone8E-049
                                                       oxidoreductase, B16.638510 and NADH UBIQUINONE contro
                                                                 Energy        195168520 XP_002025079.1 GL2677
                                                                                         conversion, DEATH-REGUL
      Drosophila mojavensis SIMILAR TO DROSOPHILA MELANOGASTER production KOG3300 B16.6 Cell cycleOXIDO
 83              95105409 CYTOCHROME B158344522 b     3E-077     Energy YP_245508.1 66796434 AAY56482.1 1546
                                                                             39862 and CYTOCHROME B
      Stomoxys calcitrans ABF51682.1Cytochrome ABW36041.1 67010002 production KOG4663 .  conversion
 77              95105411 NADH DEHYDROGENASE conserved 66796433 AAY56481.1 158344521 ABW36040.1 134
                                      6 67010001 YP_245507.1 protein
                                                      0.001      Function unknown
                                                                             39021       UNCHARACTERIZED CON
      Stomoxys calcitrans ABF51684.1Uncharacterized SUBUNIT TPG TPA TPA_EXPKOG3817 . 39864 KOG4665 F0
 76              195440316 XP_002067988.1 GK10957 194164073 EDW78974.1 125979699 XP_001353882.1 GA2088
                                     Mitochondrial F1F0-ATP synthase, subunit b/ATP4 MITOCHONDRIAL SYNTHA
                                                      1E-056      A FULL MITOCHONDRIAL F1F0-ATP FLAGS PR
                                                                             39179 and conversion
      Drosophila willistoni ATP SYNTHASE SUBUNIT B ISOFORMEnergy production KOG3976 ALTNAME ATP4 . 362
 67              195014170           Cytochrome c1 6E-087        EDV96320.1 194750263 XP_001957547.1 GF2397
                                                                             38262 and CYTOCHROME KOG3946
                                                                                         conversion
      Drosophila grimshawi XP_001983972.1 GH16186 193897454 Energy production KOG3052 C1 . 39149GLUTAMIN
 66              95105399 NADH DEHYDROGENASE SUBUNIT 66796423 AAY56471.1 13435201 . 40042 KOG4845
                                      2 67009991 YP_245497.1 Energy and39867 and NADH 5 NP_085082.1 ND2
                                                      2E-029                  related proteins
                                                                                         conversion
      Stomoxys calcitrans ABF51672.1NADH dehydrogenase subunits 2, 5, production KOG4668 2DEHYDROGENASE
 65              222533821 BAH20881.1 2 222533824 SUBUNIT C Energy production KOG4767 . 37335 KOG2124 365
                                     Cytochrome c oxidase, subunit
                                                      3E-060     18669462239964 and CYTOCHROME C OXIDASE
                                                                              ACC86234.1 conversion
      Stomoxys calcitrans CYTOCHROME OXIDASE BAH20883.1 II II, and related proteins 95105401 ABF51674.1 15
 64   Drosophila yakuba
                 38048439 AAR10122.1 CG11876 24650943 NP_733266.1 24650945 NP_733267.1 23172530 AAN141
                            SIMILAR TO DROSOPHILA MELANOGASTER ISOFORM KOG0524 E1 . 35745 KOG0525
                                     Pyruvate dehydrogenase E1, Energy production and PYRUVATE DEHYDROGEN
                                                      2E-050     beta subunit35744 B C conversion
                                                                                         DA
 56              195115497           NADH:ubiquinone1E-138
                                                       oxidoreductase, NDUFV1/51kDa subunitUBIQUINONE OXIDO
                                                                 Energy production KOG2658 NDUFV1 51KDA . 390
                                                                             37869 and NADH
                                                                                         conversion
      Drosophila mojavensis XP_002002293.1 GI13499 193912868 EDW11735.1 195385529 XP_002051457.1 GJ1214
 41              46518829 CYTOCHROME C repeat protein
                                      95105400 ABF51673.1
                                                       SUBUNIT IGeneral function prediction only REPEAT TRANSP
                                                                             35730 KOG0510 . 35475 KOG0254 186
                                                                                         ANKYRIN
      Stomoxys calcitrans AAS99750.1Ankyrin OXIDASE0.050 222533820 BAH20880.1 1 222533823 BAH20882.1 377
 30              195134278 XP_002011564.1 GI11098 193906687 EDW05554.1 6942136 AAF32322.1 AF218587_1 19
                                     Mitochondrial ADP/ATP ISOFORM C D ADT_DROME FULL CARRIERADP 359
                                                      3E-036     Energy production and MITOCHONDRIAL ALTNAM
                                                                                         conversion
      Drosophila mojavensis ADP ATP TRANSLOCASE SESB Bcarrier proteins 35968 KOG0749 . 35971 KOG0752 ATP
  5              195130171 XP_002009526.1 GI15188 193907976 EDW06843.1 122092322 Q0QHL3.1 FLAGS PRECU
                                     Citrate synthase 0.081      Energy production KOG2617 .
                                                                             37828 and CITRATE SYNTHASE
                                                                                         conversion
      Drosophila mojavensis CISY_GLOMM FULL PROBABLE CITRATE SYNTHASE MITOCHONDRIAL 110611270 AB

               195399960 PHOSPHOGLYCEROMUTASE ISOFORM A C B 35456 KOG0235metabolism
100 Drosophila virilis            Phosphoglycerate6E-069
                                                   mutase Carbohydrate transportPHOSPHOGLYCERATE399
                                                                                   and . 39809 KOG4609 MU
                          XP_002058587.1 GJ14508 194142147 EDW58555.1 195109266 XP_001999208.1 GI2319
               195430948 XP_002063510.1 GK21948 194159595 EDW74496.1 125810502 XP_001361508.1 ALTNA
                                  Glucose-6-phosphate isomerase
                                                  1E-118    Carbohydrate transportISOMERASE
                                                                      37657 KOG2446metabolism
                                                                                   and GLUCOSE-6-PHOSPH
 55 Drosophila willistoni GLUCOSEPHOSPHATE ISOMERASE PHOSPHOGLUCONATE FULL SHORT GPI GA2093

               195454119 XP_002074095.1 GK12802 194170180 EDW85081.1 195389644metabolism KOG3078 385
                                  Uridylate kinase/adenylate kinase
 96 Drosophila willistoni ISOFORM A B KINASE        2E-073                38289 KOG3079 . 38288KINASE ADEN
                                                                                      URIDYLATE
                                                               Nucleotide transport and XP_002053486.1 GJ2331

 96              195059633          Phosphatidylinositol synthaseEDV95326.1 195398833 XP_002058025.1 GJ1571
                                                      1E-084                 38450 metabolism
                                                                                       PHOSPHATIDYLINOSITOL
      Drosophila grimshawi XP_001995674.1 GH17635 193896460 Lipid transport andKOG3240 . 36830 KOG1617 CD
 77              195376513 XP_002047041.1 GJ12146 194154199 EDW69383.1 24655093 NP_612094.2 CG9149 230
      Drosophila virilis                              1E-106                 36604 metabolism
                                                                                       ACETYLTRANSFERASE CO
                                    Acetyl-CoA acetyltransferase Lipid transport andKOG1390 ACETYL-COA . 36605
 53   Drosophila virilis
                 195385380 INFERTILEFatty acid desaturase
                            XP_002051384.1 GJ15437 194147841 EDW63539.1 195576882 IFC . 36140 DESATURASE
                                     CRESCENT SPHINGOLIPID DELTA DESATURASE XP_002078302.1 GD2337
                                                      2E-077     Lipid transport andKOG2987 ACID KOG0922 DEA
                                                                             38198 metabolism
                                                                                       FATTY
 38              195351682          Predicted membrane protein EDW46244.1 19528557 AAL90393.1KOG2407 GP
                                                      0.73                   37916     MEMBRANE RH13728P 24
      Drosophila sechellia XP_002042358.1 GM13497 194124201 Function unknownKOG2705 . 37618GPI TRANSAM

               195556574 XP_002077204.1 GD23342 194202696 Secondary metabolitesDEHYDROGENASEGK1984
101 Drosophila simulans ISOFORM B                 5E-063
                                 Predicted dehydrogenase            36419 KOG1205 . 36415 transport and
                                                                               biosynthesis, KOG1201 17-
                                                          EDX16272.1 195432338 XP_002064180.1 HYDRO

               195399440 EG
 72 Drosophila virilis            Peroxisomal membrane protein MPV17 and related proteins
                                                  3E-037    General function prediction only
                                                                       37155 KOG1944 MPV17 . 37850 KOG2
                                                                                   PEROXISOMAL MEMBRAN
                          XP_002058328.1 GJ15554 194150752 EDW66436.1 195133864 XP_002011359.1 GI1604
               158299972 SIMILAR TO CONSERVED HYPOTHETICAL SELENOPROTEIN T only
                           PEST   Selenoprotein T 3E-006    General function 156544189 .XP_001606559.1 170
                                                                       38496 KOG3286 37779 KOG2568 357
                                                                                   SELENOPROTEIN FULL SH
 62 Anopheles gambiae str.XP_319979.4 AGAP009202-PA 157013776 EAA14722.4 prediction SELT_XENTR T MEMB

               195402319 HYPOTHETICAL CONSERVED ISOFORM A C
 68 Drosophila virilis            ZIP-like zinc transporter proteins
                                                     3E-071      Intracellular39110 KOG3907 TRANSPORTER PRO
                                                                               trafficking, ZINC ZIP-LIKEvesicularKOG
                                                                                            secretion, and . 36771 tran
                         XP_002059754.1 GJ16326 194155968 EDW71152.1 170068211 XP_001868780.1 SLC39A
               34924891 TRF_SARPE FULL TRANSFERRIN FLAGS PRECURSORKOG0252195447384
                                  Inorganic phosphate transporter
                                                     0.004       Inorganic ion transport INORGANIC PHOSPHATE T
                                                                              35473         and . 36506 KOG1292 378
 60 Sarcophaga peregrinaQ26643.1 984653 BAA06067.1 83745530 AAM46784.3 AF368908_1metabolism XP_002071
               194888898 XP_001976989.1 GG18481small G protein superfamily prediction only SMALL G SUPERF
100 Drosophila erecta                              3E-071   EDV45916.1 195470132 XP_002099987.1 GE1679
                                                                       35303     GTPASE
                                 GTPase Rab18, 190648638 General function KOG0080 RAB18 . 35301 KOG0
               195350740 XP_002041896.1 GM11288 195481978 Cytoskeleton
                                 Microtubule-associated anchor protein 36867 KOG1654 MICROTUBULE-ASSO
                                                   6E-055    XP_002101858.1 in autophagy and membrane traf
                                                                                 ANCHOR INVOLVED IN AU
 98 Drosophila simulans GENE CONSERVED HYPOTHETICAL GABA A involved GE15373 195566095 XP_002106
               157129438 CYTOPLASMIC DYNEIN LIGHT CHAIN Cytoskeleton B SIMILAR TO 1 . LIGHT KOG2762 35
 79 Aedes aegypti                Dynein light chain1E-039
                                                    XP_001655387.1 108872207 EAT36432.137973 CHAIN TYP
                         XP_001655386.1 157129440type 1      ISOFORM A           DYNEIN 108872208 EAT36
                                                                       88626 KOG3430 KDA FULL ALTNAME

102              125981801 XP_001354904.1 GA20897 conserved EAL31960.1 38487 KOG3277 . 36279 KOG1061 AP-
                                     Uncharacterized 54643216 protein
      Drosophila pseudoobscura pseudoobscura          8E-031                194767864UNCHARACTERIZED CON
                                                               Function unknown           XP_001966034.1 GF19477
101              195167074           Amphiphysin      0.12     Intracellular38975 KOG3771 . 37185 KOG1974 tran
                                                                             trafficking, AMPHIPHYSINvesicular I-IN
                                                                                          secretion, and DNA TOPOI
      Drosophila persimilis XP_002024359.1 GL14849 194107732 EDW29775.1 198469006 XP_001354884.2 GA1117
100              18201673 AAL65405.1Focal adhesion protein PINCH-1, contains LIM domains PINCH-1 . 39328 KOG
      Glossina morsitans morsitans                    0.076    Signal transduction mechanisms, Cytoskeleton
                                                                            37483 KOG2272 ADHESION CONTA
                                                                                          FOCAL
                                      AF368915_1 FB12 194750727 XP_001957681.1 GF10536 190624963 EDV404
100              68500496 HYPOTHETICAL
      Stomoxys calcitrans AAY98019.1 195125752 XP_002007340.1 GI12436 193918949 EDW17816.1 195435552 XP
100              194755046 XP_001959803.1 GF11854 190621101 EDV36625.1 24659379 NP_726318.1 CG30415 246
      Drosophila ananassae ISOFORM A B HYPOTHETICAL CONSERVED
100   Drosophila pseudoobscura pseudoobscura
                 195150983 SIMILAR TO MODIFIER PRECURSORproteinFLAGS
                             XP_002016429.1 GL11573 198457765 FULL
                                     Uncharacterized conserved XP_002138444.1 GA24773 194110276 EDW32319
                                                      5E-041   Function unknownKOG3483 . 38649 KOG3439 378
                                                                            38693         UNCHARACTERIZED CON
 97              198466620 ISOFORM A HYPOTHETICAL CONSERVED
                             XP_001354065.2 GA17252 198150685 EAL29802.2proteins and XP_002062133.1 GK1737
                                     Hismacro         0.047    Chromatin structure HISMACRO Transcription
                                                                              195428142 dynamics, DOMAIN-CON
      Drosophila pseudoobscura pseudoobscura and SEC14 domain-containing37844 KOG2633 SEC14PROTEINS CO
 97              195444679 XP_002069978.1 ALTNAME1E-108
                                     Uncharacterized 194166063 EDW80964.1 195392076 XP_002054685.1 GJ2458
                                                       HYPOTHETICAL unknownKOG3012 . 39182 KOG3979 1 36
                                                               Function 38222
      Drosophila willistoni FULL HOMOLOG GK11280 conserved protein CONSERVED UNCHARACTERIZED CON
 95              160717596 SIMILAR TO PARTIAL protein BR140/LIN-49
      Drosophila melanogaster        PHD finger HYPOTHETICALEDP27884.1 189242281 XP_001810382.1 CG4153
                                                      0.11                  36173 KOG0955FINGERLIN-49 . 36527
                                                                                          PHD BR140 PROTEINS
                             NP_001104139.1 CG41536 158528493 General function prediction only
 89              125984586 XP_001356057.1 GA19597 conserved EAL33116.1 38323 KOG3113 . 38249 KOG3039 363
                                     Uncharacterized 54644375 protein
      Drosophila pseudoobscura pseudoobscura          4E-080                195161615UNCHARACTERIZED CON
                                                               Function unknown           XP_002021658.1 GL26629
 78              195581484           Endosomal membrane proteins, EMP70 trafficking, ENDOSOMAL vesicular tran
                                                      0.90     EDX06149.1 195332385 XP_002032879.1 GM2071
                                                                                          secretion, and
      Drosophila simulans XP_002080564.1 GD10179 194192573 Intracellular36492 KOG1278 EMP70 . MEMBRANE
 76              195117580 XP_002003325.1 GI23121 193913900 EDW12767.1 195434845 XP_002065412.1 GK1543
                                     Nucleolar GTPase 0.27     General      37634 KOG2423 . 37039 KOG1828CON
      Drosophila mojavensis ISOFORM B A HYPOTHETICAL CONSERVED function prediction only   NUCLEOLAR GTPASE IRF
 63              195122952 XP_002005974.1 GI20775 HOMOLOG General function prediction Zn-finger
                                      FINGER CCCH conserved EDW09909.1 125810532 XP_001361518.1 ZN-FING
                                                      2E-093   SHORT DRG FAMILY UNCHARACTERIZED CON
                                                                            36974 KOG1763 CCCH-TYPE GA2122
                                                                                          REGULATORY
      Drosophila mojavensis FULL ZINCUncharacterized193911042 protein, contains CCCH-typeonly
 53              195448879 XP_002071853.1 GK10210 194167938 EDW82839.1 195401789 XP_002059493.1 GJ1479
      Drosophila willistoni
 13              195457478 XP_002075582.1 GK19000 194171667 EDW86568.1 195387455 protein .HYPOTHETICAL
                                     Uncharacterized MELANOGASTER INTRONICKOG3163 S8E S8E
                                                      2E-012   General function prediction only
                                                                            38373 CONSERVED
                                                                                          UNCHARACTERIZED CON
      Drosophila willistoni SIMILAR TO DROSOPHILA conserved protein related to ribosomalXP_002052411.1 GJ2183

               24653618 NP_610955.1 PROTEASE REVERSE TRANSCRIPTASE RIBONUCLEASE H 24653622 NP_
                         SIMILAR TO ARC1 7303193 0.55
 98 Drosophila melanogaster                         AAF58256.1 16769586 AAL29012.1 LD41905P INTEGRASE P
                                                               General function KOG2133 ATROPHIN-1 . CORE
                                                                          37344     TRANSCRIPTIONAL
                                  Transcriptional corepressor Atrophin-1/DRPLAprediction only
               40457592 AAR86938.1 40457594 AAR86939.1 16152118 AAL14979.1 AF418571_1 15559194 AAA921
                         REVERSE TRANSCRIPTASE UNKNOWN ZINC FINGER DOMAIN CONTAINING FULL CA
  4 Drosophila melanogaster

  1                118401178 KINASE DOMAIN 89287255 EAR85247.1 145553124 XP_001462237.1 124430075 CAK948
                                XP_001032910.1 CONTAINING HYPOTHETICALion channels (STRPC family) Signal tran
                                                         0.003      Inorganic UNNAMED CATION CHANNELS NADH
                                                                                38815 KOG3609 RECEPTOR-ACTIVAT
                                                                                            and metabolism,
      Tetrahymena thermophila SB210 Receptor-activated Ca2+-permeable cationtransport PRODUCT ANTIGEN STRP
 75                 histolytica HM-1:IMSS Cl- DEFECTCLC-7 and related proteinsion transport CHANNELCLC-7 . 37782 KO
                                UTILIZATION channel HOMOLOG HYPOTHETICAL CONSERVED CL- RELATED PROT
                                                         0.017      Inorganic (CLC superfamily)
                                                                                EAL43545.1 195028624 XP_00198717
                                                                                            and metabolism
      Entamoeba67465497 XP_648933.1 MANNOSE-P-DOLICHOL 1 56465242 35695 KOG0474 PRESENILIN FAMILY
 31                183013847 ACC38443.1 YMF16 183013851 ACC38445.1 188038011 ACD46629.1 SEC-INDEPENDEN
      Phytophthora ramorumTRANSPORTER TRANSPORT SYSTEMS INNER MEMBRANE COMPONENT HYPOTHET
 11                124805826 GERANYLGERANYL TRANSFERASE BETA SUBUNIT HYPOTHETICAL Cytoskeleton
                                 3D7      Rac1 GTPase effector FHOSSignal transduction mechanisms, KINASE UNNAM
                                                         0.10                   37136 KOG1925 RAC1 37386 KOG21
                                                                                            GTPASE EFFECTOR FHOS
      Plasmodium falciparumXP_001350548.1 TYPE2 23496672 AAN36228.1 AE014846_27 146181824. XP_001023454
 24                149173897 HYPOTHETICALPM8797T_05650 148847427 EDL61761.1 66817382 XP_642544.1 427339
                                ZP_01852526.1 SIMILAR TO PLASMODIUM
      Planctomyces maris DSM 8797
  7                32395295 ANTIGEN PRECURSOR
      Stomoxys calcitrans AAO72734.1 5
 11                metalliredigens QYMF
                                YP_001319992.1 DOMAIN-CONTAINING 149949805 ABR48333.1 118586665 ZP_015441
      Alkaliphilus 150389943 RADICAL SAM DOMAIN CYSTEINE BIOSYNTHESIS SERINE ACETYLTRANSFERASE
  2                219492670 XP_002243098.1
      Branchiostoma floridaeHYPOTHETICAL BRAFLDRAFT_105396 210089054 EEA37371.1


  7                126323410 HYPOTHETICAL 15597958ATPase MSH6 PA2762 35438 KOG0217 MSH6 REPAIR ATPAS
                                       Mismatch repair NP_251452.1 (MutS family)
                                                        0.76      Replication,107102301 MISMATCH .
                                                                                recombination and repair
                                                                                              DOMAIN CONTAINING AS
      Monodelphis domesticaXP_001364611.1 CONSERVED ASPARAGINE SYNTHASE PHZP_01366219.1 PAERPA_0
  7                190347611 TYROSINE RECOMBINASE 0.62 HYPOTHETICAL IYP_002560239.1 222120208 EXOD
                              EDK39916.2 146414630 XP_001483285.1 222151085 complex, subunit RNA14 POLYAD
                                                        XERC      RNA processing and modification
                                                                               37125 KOG1914 RNA14 .
                                                                                             MRNA CLEAVAGE
      Pichia guilliermondii ATCC 6260 mRNA cleavage and polyadenylation factorHYDROGENASE PEPTIDASE BAH17
 15                109033260 SIMILAR TO HYPOTHETICAL UNNAMED HEC1 control, cell division, chromosome partitio
      Macaca mulatta                   Centromere-associated protein PRODUCT ISOFORM CRA_A CRA_B CHROMO
                                                        0.92      Cell cycle 36213 15451444 BAB64526.1 2194108
                              XP_001110255.1 AAT1-ALPHA 114588699 XP_516670.2 KOG0995 CENTROMERE-ASSO
  7                195032270 XP_001988468.1 GH10559 193904468 General function prediction HOMOLOG TRANSCR
                                       Homeobox protein 0.15      EDW03335.1 195470917 XP_002087753.1 GE181
                                                                               36361 KOG1146 . 39421 MUSCARINIC
      Drosophila grimshawi HYPOTHETICAL RECEPTOR KINASE HEME ACTIVATOR YEAST only            HOMEOBOX KOG4220 366
  3                50305889 UNNAMEDCell membrane glycoprotein General function prediction only CHECKPOINT MIT
                                        PRODUCT Q6CT34.1 THREONINE-PROTEIN MEC1 DNA-DAMAGE GLYCOP
                                                        0.99                   KINASE ALTNAMECELL
      Kluyveromyces lactis XP_452905.1 74636890 ATR_KLULA FULL SERINE 38247 KOG3037 .MEMBRANE1 496420
 49                189220122 TRANSCRIPTIONAL REGULATOR YRZC HYPOTHETICAL BADM FAMILY
                              YP_001940762.1 189186980 ACD84165.1 221078231 RWD domain
                                                        0.14      Function unknownKOG4018 .
                                                                               39221         UNCHARACTERIZED CON
      Methylacidiphilum infernorum V4 Uncharacterized conserved protein, containsZP_03549462.1 BLAHAN_03262 22
 10                223550252 DEK LIKELY VESICULAR TRANSPORT FACTOR EUKARYOTIC TRANSLATIONXP_0013
      Ricinus communis        EEF51739.1 68492200 XP_710120.1 USO1P 46431250 EAK90848.1 124805565 INITIATI
  3                126305175 HYPOTHETICAL 145532501 XP_001452006.1 124419683 CAK84609.1 DOMAIN CONTA
      Monodelphis domesticaXP_001375930.1 UNNAMED PRODUCT FTSJ METHYLTRANSFERASE114329894 YP_74
 45                109488674 HYPOTHETICAL BRO DOMAIN DNA POLYMERASE III SUBUNITS GAMMA 187723728 A
      Rattus norvegicus                Programmed cell 0.45 8 (apoptosis-inducing factor)PROGRAMMED CELL DEA
                                                        death     Signal 187935575 mechanisms
                                                                               36560 KOG1346 8 APOPTOSIS-INDUC
                              XP_001068650.1 109491500 XP_001081043.1transduction YP_001886948.1 TAU SIMILAR
 19                85057966 YP_456879.1 AYWB_PIII03
                              HYPOTHETICAL
      Aster yellows witches'-broom phytoplasma AYWB 84790115 ABC65800.1
 11                9801275 HYPOTHETICAL BINDING TRANSLATION XP_675101.1 KOG3726 .
                                       Uncharacterized conserved protein
                                                        0.82      Function unknown PB-RETICULOCYTE 56494084
                                                                               38930         UNCHARACTERIZED CON
      Plasmodium berghei CAC03578.1 9801274 CAC03577.1 68066239 INITIATION FACTOR FULL SIMILAR TO LIGA
  8                66803555 XP_635618.1 60463954 EAL62117.1 DDBDRAFT_0188922 219873066 YP_002477210.1 M
                              HYPOTHETICAL TRANSPORTER HAEM LYASE LONG UNLIKELY MEMBRANE
      Dictyostelium discoideum AX4
 36   Homo sapiens            BAG62742.1 66357632 XP_625994.1 46227231 EAK88181.1 160893853 ZP_02074636.1 C
                   194375259 UNNAMED PRODUCT CARBOXYLESTERASE LYSOPHOSPHOLIPASE SIGNAL HYPOTH
  6   Coprinopsis169860080 HYPOTHETICAL GTPase-activating protein,85092066 XP_959210.1 NCU04667 28920612IN
                    cinerea okayama7#130
                              XP_001836676.1 TRANSCRIPTIONAL REGULATOR ARAC FAMILYRAB3 GTPASE-ACTIV
                                       Rab3 116502193 EAU85088.1 non-catalytic subunit
                                                        0.85      Intracellular37938 KOG2727 PROTEASE THEIR E
                                                                                trafficking, SUBUNIT and vesicular tran
                                                                                             secretion,
 16                           CYTOCHROME P450 2 SUBFAMILY V General 188590415 YP_001920723.1 DOLICHYL-P
                                       Predicted DHHC-type Zn-finger protein 36529 KOG1315 DHHC-TYPE ZN-FING
                                                        0.23       POLYPEPTIDE prediction only
      Danio rerio 49227572 NP_001001835.1 FAMILY1 7212788 BAA92374.1 function MANNOSYLTRANSFERASE HYP
 16                145526322 HYPOTHETICAL 124416538 CAK81575.1 145498704 SURFACE
      Paramecium tetraureliaXP_001448972.1 UNNAMED PRODUCT MEROZOITE XP_001435339.1 124402470 CAK67
  1                198466663 HYPOTHETICAL GA16901 198150703 EAL29823.2 71894329 YP_278437.1 MS53_0313
                              XP_001354084.2
      Drosophila pseudoobscura pseudoobscura
 17                195446673 XP_002070874.1GTPase effector DIA/Diaphanous 37135 KOG1924 . GTPASE EFFECTOR
                                       RhoA GK25484 194166959 EDW81860.1 195446675 XP_002070875.1 GK2543
                                                        0.26      Signal transduction        RHOA 38104 KOG2893
      Drosophila willistoni SIMILAR TO CONSERVED HYPOTHETICAL TRANSPORT mechanisms, Cytoskeleton
48   Dictyostelium discoideum AX4
                 66819551 XP_643435.1 60471711BINDING SUBUNIT B
                            HYPOTHETICAL DNA EAL69667.1 DDBDRAFT_0217678 19775734835967 KOG0748 375
                                      Uncharacterized conserved protein
                                                         0.078       Function unknownKOG4838 . YP_002180621.1 SS
                                                                                  40035         UNCHARACTERIZED CON
 5               197737501 PYRUVATE SYNTHASE HYPOTHETICAL TRANSMEMBRANE GUSTATORY29341637 AA
                            YP_002166279.1 148324582 EDK89832.1 29349727 NP_813230.1 BT_4319 RECEPTOR
     Fusobacterium nucleatum subsp. polymorphum ATCC 10953
13               67591924 XP_665603.1 54656366 EAL35371.1 CHRO.60246 116329433 YP_799153.1 HEAVYPROTE
     Cryptosporidium hominis          Predicted membrane protein Function unknownKOG2568 . 36529 116329963DH
                                                         0.25                     37779
                            HYPOTHETICAL SERINE PHOSPHATASE RSBU REGULATOR SIGMA SUBUNIT META   MEMBRANE KOG1315 YP
24               78058194 ABB17515.1Multidrug/pheromone exporter, ABC superfamily
                                       21672403 PRIA_BUCAP FULL ALTNAME HELICASE PRIA REPLICATION FA
                                                         0.87        Secondary metabolitesMULTIDRUG PHEROMONE
                                                                                  35278 KOG0055 .
                                                                                                biosynthesis, transport and
     Staphylococcus aureusAGRC PRIMOSOMAL NP_660470.1 N' 25008948 Q8KA15.1 ATP-DEPENDENT 21623011
 3               111226979 HYPOTHETICAL SIMILAR TO PLASMODIUM FALCIPARUM ISOLATE RIBONUCLEOSIDE
                            XP_001134623.1 28829636 AAO52153.1 3D7 . 90971297 EAS66957.1 DDB_0232398 161
     Dictyostelium discoideum AX4
11   Monosiga brevicollis MX1
                 167537312 HYPOTHETICAL CONSERVED UNNAMED160881132Replication, recombination and repair
                            XP_001750325.1 163771153 EDQ84824.1 PRODUCTYP_001560100.1 CPHY_3004 1604
                                      Transcription-coupled repair protein CSA, contains WD40 domain CONTAINS D
                                                         0.081       Transcription, FATTYREPAIR CSA
                                                                                  39484 KOG4283 TRANSCRIPTION-CO
                                                                                                 ACID ELONGASE MAJOR
17               aeruginosa YP_001660782.1 MAE_57680 166090882 BAG05590.1 166363882 YP_001656155.138805
                            NIES-843 Acetyl-CoA hydrolase
     Microcystis 166368509 HYPOTHETICAL UNNAMED0.033                 Energy production KOG2828 ACETYL-COA . MAE_
                                                                                  38039 and HYDROLASE NONSELECT
                                                          PRODUCT MALATE SYMPORTER CONSERVED    conversion
13               206968572 SPORE GERMINATION GERKA HYPOTHETICAL GERA CELL and metabolism EAR8949
     Bacillus cereus AH1134           Monocarboxylate 0.057
                                                         transporter Carbohydrate transportMONOCARBOXYLATE TRA
                                                                                  37715 KOG2504 . 37726 KOG2515 375
                            ZP_03229528.1 206737492 EDZ54639.1 118352939 XP_001009740.1 89291507 CYCLE KA
21   Xanthomonas axonopodis pv. citri E3 ubiquitin ligase
                 21241104 NP_640686.1 21106403 AAM35222.1 188989732 YP_001901742.1 167731492turnover, cha
                            CONDITIONED MEDIUM FACTOR FULL TAT ALTNAMEmodification, protein CAP49667.1
                                      str. 306           0.59                     36020 KOG0802 E3 . LIGASE
                                                                                                UBIQUITIN
                                                                     Posttranslational TRANSACTIVATING REGULATO
10               24658883 NP_611739.1 CG3800 18447272 AAL68216.1 GM14667P 21428610 AAM49965.1 LD48005
     synthetic construct    UNNAMED PRODUCT ZINC FINGER SIMILAR TO HYPOTHETICAL NOVEL GAG CELLUL
33   Mus musculus           XP_001472642.1 89095761 ZP_01168655.1 B14911_03489 89089507 EAR68614.1 10947
                                      Ultrahigh sulfur keratin-associated protein structuresULTRAHIGH SULFUR SMA
                                                         4E-010
                 149264191 HYPOTHETICAL ORF MIDASIN CONSERVED        Extracellular39924 KOG4726 KERATIN-ASSOCIAT
14   Mycobacterium sp. MCS
                 108801632 ATPASE AAA CONTAINING 6E-007
                            YP_641829.1 108772051 ABG10773.1 DOMAIN-LIKE 126735027metabolismKOG2236 383
                                      Global transcriptional regulator, cell division controland A VWA HYPOTHETICAL
                                                         VON WILLEBRAND FACTOR TYPE ZP_01750773.1 RCCS2_
                                                                     Amino acid 36403 KOG1189 . 37447
                                                                                   transport protein
                                                                                                GLOBAL TRANSCRIPTION
17   Drosophila pseudoobscura pseudoobscura I
                 198474099 BUNCHED Uncharacterized protein CLU1/cluA/TIF31 195472383mitochondrial morphology/d
                            XP_002132626.1 GA25789 198138247 EDY70028.1 involved in XP_002088480.1 GE1225
                                      ISOFORM            0.92                     37050 KOG1839 CLU1 TIF31 EIF-3 .
                                                                                                UNCHARACTERIZED CLUA
                                                                     General function prediction only
17               170044681 XP_001849967.1 167867732 EDS31115.1 170046836 andKOG0059 ABCA1 . 37763 EDS32
                                      Lipid exporter ABCA1 and related proteins, XP_001850953.1 167869459 KOG2
                                                         0.019       Lipid transport
                                                                                  35282 superfamily
                                                                                                LIPID EXPORTER RELATE
     Culex quinquefasciatusCONSERVED HYPOTHETICAL PUGILISTDOMINANTABC metabolism, General function pr
90               195582557 XP_002081093.1 GD10822 194193102 EDX06678.1 66815511 XP_641772.1 60469860 EA
     Drosophila simulans HYPOTHETICAL PEPTIDASE FAMILY PHD ZN SIMILAR TO DICTYOSTELIUM DISCOIDE
86               197757348 YP_002180621.1 SSAG_03970 FULL ATP EDX24093.1 71755693 ALTNAME UNNAMED
                                      Apoptotic ATPase0.038          Signal transduction mechanisms
                                                                                  39857 KOG4658 . 37992 ATPASE SMA
     Streptomyces sp. Mg1 HYPOTHETICAL CONSERVED 194343127SYNTHASE SUBUNIT AXP_828761.1 7083414 APOPTOTIC KOG2781 U3
10                          HYPOTHETICAL CAENORHABDITIS ELEGANS 11467606 NP_050068.1 LETAOMP15 DH
                                      Amino acid transporter protein
                                                         0.065        MURF1 TERMINUS and metabolismKOG1311 896
                                                                                   transport UNCERTAIN CONSERVED M
                                                                                                AMINO ACID
                 7510076 T31613 Y50E8A.I 213492207 ACJ47212.1Amino acid 36519 KOG1305 . 36525 TRANSPORTE
 9   Eimeria tenella
                 118490648 HYPOTHETICAL CONSERVED SEQUENCE ORPHANXP_001349158.1 23498926 CAD510
                            XP_001238633.1 109238416superfamily (Breast cancerFULL UNCHARACTERIZED MEMB
                                      Transporter, ABC 7E-004
                                                           CAK51380.1 124512050 resistance protein) transportSUPE
                                                                                  35284 KOG0061 . 36349 KOG1134 352
                                                                                                biosynthesis,
                                                                     Secondary metabolitesTRANSPORTER ABC and
53                dispar SAW760
     Entamoeba167378269 HYPOTHETICAL CONSERVED GROUP II4
                            XP_001734741.1 165903628 EDR29091.1 INTRON40042 KOG4845 SIGNAL TRANSPORT
                                      NADH dehydrogenase, subunit 34763330 ZP_00144285.1DEHYDROGENASE
                                                         0.001       Energy production and NADH4 27887000 EAA24117
                                                                                    DOMAIN WITH . 35475 KOG0254 38
                                                                                                conversion
 9                          HYPOTHETICAL CAENORHABDITIS ELEGANS UNNAMED PRODUCT UNKNOWN CAT3
                                      1,3-beta-glucan ZP_02735402.1 synthase catalytic subunit biogenesis
                                                         0.003       Cell wall/membrane/envelope 3-BETA-GLUCAN
                                                                                  36134 KOG0916 1
                                                                                                SYNTHASE CALLOSE
                 7510076 T31613 Y50E8A.I 168703125 synthase/callose GOBSU_26581 195125912 XP_002007418.1. G
27               115745847 HYPOTHETICAL chromatid SIMILAR TOChromatin structure and dynamics, NIPPED-Bcontro
                            XP_001179516.1 PARTIAL cohesion protein221129349 RELATED HOMOLOG B2 1248060
     Strongylocentrotus purpuratus                       0.029        AUTOPHAGY XP_002161741.1 ATG2 cycle . 356
                                                                                  36238 KOG1020 SCC2 Cell CONSERV
                                      Sister 115916375 XP_783003.2 SCC2/Nipped-B SISTER CHROMATID COH
 7               145548523 HYPOTHETICAL 124427769 PRODUCT CONSERVED REPEAT RECEPTOR MEMBRANE
                                      G protein-coupled receptor Signal transduction mechanisms
     Paramecium tetraureliaXP_001459942.1 UNNAMED0.15                             39420 KOG4219 PROTEIN-COUPLED
                                                                                                G CONTAINING UREAPLA
                                                           CAK92545.1 52421267 YP_087178.1 HS_P05 52220882 AAU
12               91088501 SIMILAR TO F-BOX LEUCINE-RICH 4 84998832 XP_954137.1 65305135 CAI73460.1 1961
     Tribolium castaneum XP_971231.1 REPEAT INTEGRAL MEMBRANE APICAL MEROZOITE ANTIGEN CELLULO
12               124511968 HYPOTHETICAL 23498885 CAD50963.1 124802651 XP_001347549.1 23495131 AAN3546
                             3D7      Multitransmembrane protein B FAMILY TAGB_DICDI FULL
                                                         0.31                     36836 KOG1623 .
                                                                                                MULTITRANSMEMBRANE
     Plasmodium falciparumXP_001349117.1 ABC TRANSPORTER General function prediction onlyTAGB FLAGS PRE
 7               anserina XP_001909845.1 170944867 CAP70979.1 EMP70 36492 KOG1278 EMP70 . vesicular tran
                                      PRODUCT HYPOTHETICAL CONSERVED SIMILAR TO MEMBRANE RESPO
                                                         0.41        Intracellular trafficking, ENDOSOMAL 37554 KOG2
                                                                                                secretion, and EAL66251.1
     Podospora 171689810 UNNAMEDEndosomal membrane proteins, 66811886 XP_640122.1 60468241MEMBRANE
27               221091242 XP_002164197.1 44829171 DAA04499.1 4718340538864 KOG3660 SODIUM-NEUROTRA
                                      Sodium-neurotransmitter symporter transduction mechanisms
                                                         0.36        Signal         CAG14665.1 195115513 XP_0020023
     Hydra magnipapillata SIMILAR TO PARTIAL TPG TPA TPA_EXP POL POLYPROTEIN UNNAMED PRODUCT R  SYMPORTER
                             Best                                             Best
                             match to                  Alphanu                match to
Best match to                PFAM                      meric      Text        SMART
GO database      E value     database     E value      Index      index       database     E value




                        0 Trypsin       7E-049        109157 PFAM00089 TRYPSIN.UNKNOWN
                                                                 TRYPSIN DOMAIN 117884 PFAM09342 DUF1986 . BOND
                                                                             activity
CG16996 - Drosophila melanogaster - proteolysis - serine-type endopeptidase Tryp_SPc 2E-056 FUNCTION THIS IS FOUN
                        0 Trypsin       1E-049        109157 PFAM00089 TRYPSIN.UNKNOWN
                                                                 TRYPSIN DOMAIN 117884 PFAM09342 DUF1986 . BOND
                                                                             activity
CG16996 - Drosophila melanogaster - proteolysis - serine-type endopeptidase Tryp_SPc 2E-056 FUNCTION THIS IS FOUN
                     melanogaster       4E-018        109157 PFAM00089 TRYPSIN. 109487 HYDROLASEDOMAIN. 111088
                                                                 TRYPSIN CUB GLYCOSYL PFAM00431 FAMILY
                                                                             activity
CG30371 - Drosophila2E-67 Trypsin - proteolysis - serine-type endopeptidase Tryp_SPc 3E-025
                     melanogaster       3E-023        109157 PFAM00089 TRYPSIN. 118679 PFAM10151 DUF2359 . IS H
                                                                 TRYPSIN UNCHARACTERISED
                                                                             activity
CG32271 - Drosophila1E-37 Trypsin - proteolysis - serine-type endopeptidase Tryp_SPc 8E-028 CONSERVED THIS450A A
                    8E-55 Trypsin       5E-043        109157 PFAM00089 DOMAIN 112568 PFAM03761 DUF316 . ELEGA
                                                                 TRYPSIN activity
                                                                             Tryp_SPc 1E-049
CG9676 - Drosophila melanogaster - proteolysis - serine-type endopeptidaseTRYPSIN.UNKNOWN FUNCTION FAMILY UNCH
                    4E-53 Trypsin       2E-049        109157 PFAM00089 DOMAIN 112568 PFAM03761 DUF316 . ELEGA
                                                                 TRYPSIN activity
                                                                             Tryp_SPc 9E-051
CG9676 - Drosophila melanogaster - proteolysis - serine-type endopeptidaseTRYPSIN.UNKNOWN FUNCTION FAMILY UNCH
                    1E-76 Trypsin       2E-041        109157 PFAM00089 TRYPSIN.UNKNOWN FUNCTION FAMILY UNCH
                                                                 TRYPSIN DOMAIN 112568 PFAM03761
                                                                             Tryp_SPc 4E-052
CG8952 - Drosophila melanogaster - serine-type endopeptidase activity - proteolysis - endopeptidase activity DUF316 . ELEGA

                        5E-44 DUF1976        0.15          117861 PFAM09319 DUF1976 . FUNCTION MEMBERS THIS PFAM
                                                                      rRNA transcription
                                                                                MYSc          0.66
Ceratitis capitata - endoribonuclease activity - cellular_component -DOMAIN UNKNOWNPROTEINS. DEFINED. 118051FAMILY
                         0.12 Endonuclease_NS0.001         110240 PFAM01223 NON-SPECIFIC ENDONUCLEASE. 114261 PFAM
                                                                     ENDONUCLEASE_NS DNA RNAthatA POLYTOPIC INTEG
                                                                                IL7           proteins IS form complexes with
Protein required for function of the Sit4p protein phosphatase, member of a family of similar 0.022

                       1E-74 SCP         1E-030        109254 PFAM00188 SCP-LIKE PROTEIN.
                                                                            SCP      THIS DOMAIN IS ALSO CA++ PR
Antigen 5-related 2 - Drosophila melanogaster - extracellular regionSCP EXTRACELLULAR1E-029 PROKARYOTES. FOUND I
                       3E-75 SCP         7E-031        109254 PFAM00188 SCP-LIKE PROTEIN.
                                                                            SCP      THIS DOMAIN IS ALSO CA++ PR
Antigen 5-related 2 - Drosophila melanogaster - extracellular regionSCP EXTRACELLULAR2E-029 PROKARYOTES. FOUND I
                       2E-56 SCP         2E-020        109254 PFAM00188 SCP-LIKE PROTEIN.
                                                                            SCP      THIS DOMAIN IS ALSO CA++ PR
Antigen 5-related 2 - Drosophila melanogaster - extracellular regionSCP EXTRACELLULAR8E-019 PROKARYOTES. FOUND I

                       4E-08 7TMR-DISM_7TM  2E-004        116309 PFAM07695 7TMR-DISM_7TM THIS ENTRY REPRESENTS
                                                                      DIVERSE INTRACELLULAR
                                                                                  PSN          0.003
trichohyalin - Rattus norvegicus - protein binding, bridging - intermediate filament organization 7TM SIGNALLING. 7TM-DISM
                        melanogaster - biological_process - molecular_functionLYZ2
CG14073 - Drosophila8E-07 BPD_transp_2      1E-005                    AMINO ACID spindle microtubule
                                                                                   - TRANSPORT SYSTEM PERMEASE THIS IS
                                                                                               0.049
                                                          111540 PFAM02653 BPD_TRANSP_2 BRANCHED-CHAIN COMPONE
                        melanogaster        2E-009        109119 PFAM00050PROTEASE INHIBITOR DOMAIN. INDICATIVE K
                                                                      SERINE KAZAL_1 activity
                                                                                  inhibitor    8E-010
CG31704 - Drosophila4E-08 Kazal_1 - proteolysis - serine-type endopeptidase KAZAL KAZAL-TYPE USUALLY INHIBITORS.H
                              MIF4G         0.055                     IS NAMED KAZAL MIDDLE DOMAIN . NMD2P CBP80. AL
                                                                                  AFTER        2E-004
                                                          111716 PFAM02854 MIF4G DOMAIN. 4G EIF4G EUKARYOTIC INITIA

                     1E-66 MFS_1         1E-026       116304 PFAM07690 MFS_1 SUPERFAMILY. matrix -PFAM07263 CO
                                                                  MAJOR FACILITATOR DENTIN MATRIX odontogenesis o
                                                                                OSTEO         5E-012
dentin sialophosphoprotein - Rattus norvegicus - molecular_function - cell differentiation - extracellular115889THIS FAMILYDM
                     2E-29 Mpp10         4E-015       112805 PFAM04006 MPP10 PROTEIN. 10 . U3 18S - odontogenesis
                                                                  THIS FAMILY INCLUDES PROTEINS RELATED TO SNO
                                                                                PSN           6E-008
dentin sialophosphoprotein - Rattus norvegicus - molecular_function - cell differentiation - extracellular matrixPRE-RRNA.M PHo
                     4E-27 CTP_transf_1  2E-015
zgc:100957 - Danio rerio - cellular_component                     CYTIDYLYLTRANSFERASE MEMBERS THIS FAMILY ARE
                                                                                PSN           5E-010
                                                      110170 PFAM01148 CTP_TRANSF_1 FAMILY. CYTIDYLYLTRANSFE
                     9E-28 CTP_transf_1  2E-014
zgc:100957 - Danio rerio - cellular_component                     CYTIDYLYLTRANSFERASE MEMBERS THIS FAMILY ARE
                                                                                PSN           1E-007
                                                      110170 PFAM01148 CTP_TRANSF_1 FAMILY. CYTIDYLYLTRANSFE

                       melanogaster       6E-011         115802 PFAM07172 FAMILY. 16 24. STRESSES. 115804 PFAM07174
                                                                               TLC          0.002
Nopp140 - Drosophila 3E-10 GRP - nucleologenesis - nucleolus GRP GLYCINE RICH THIS FAMILY PROTEINS INCLUDES
                       6E-19 Attacin_C 6E-017            112576 PFAM03769 C-TERMINALTHIS FAMILY INCLUDES SARCOT
                                                                   ATTACIN_C ATTACIN REGION. DIPTERICIN. MICROOR
                                                                               PIPKc        0.37
Diptericin B - Drosophila melanogaster - antibacterial humoral response - extracellular space
                       2E-26 Metallothio extracellular 109198-PFAM00131 METALLOTHIONEIN. 109974 PFAM00939 REGI
Stomoxys calcitrans - molecular_function -0.13                     METALLOTHIO NA_SULPH_SYMP response to fungus
                                                                               DISIN        0.068
                                                         region xenobiotic metabolic process - defense SODIUM SULFATE SY
                       melanogaster - antibacterial      112576 PFAM03769 C-TERMINALTHIS
                                                                   ATTACIN_C ATTACIN REGION. DIPTERICIN. MICROOR
                                                                               DM            bacterium - INCLUDES SARCOT
Attacin-B - Drosophila 3E-15 Attacin_C 4E-023 humoral response - defense response to0.51 FAMILYdefense response - ex

                       protein 15 - Homo sapiens - DNA bindingPFAM03326 ofRUN TRANSCRIPTION ACTIVATION FACTOR
PR domain zinc finger 0.068 Herpes_TAF50   0.61                     HERPESVIRUS    transcription, DNA-dependent - nucleus
                                                                                                0.23
                                                        112154 - regulation HERPES_TAF50 . BRLF1 50 HERPESVIRUSES.
                      0.0001 SPX           0.20         111945 PFAM03105 HAVE
                                                                    SPX WE DOMAIN. SYG1 PHO81 XPR1 . 180 PROTEINS.
                                                                                   - cellular_component
                                                                                                 THIS
CG31789 - Drosophila melanogaster - biological_process - molecular_functionDM9NAMED 0.60 REGION DOMAIN AFTER R
                         0.59 Herpes_ori_bp0.33         111306 PFAM02399 transport ORIGIN REPLICATION BINDING THIS
                                                                    HERPES_ORI_BP ZnMc          0.31
transporter, EamA family - Bacillus anthracis str. Ames - transporter activity - PROTEIN. REPLICATION. 114257 PFAM05525 B
                         0.34 ABC-3        0.027        109985 PFAM00950 ABC-3 3 FAMILY. 112427 PFAM03609 EII-SOR S
                                                                    ABC TRANSPORT PTS 0.003
                                                                                  LU             SYSTEM IIC AA_PERMEASE
Candida albicans - protein binding - protein homodimerization activity - retrograde vesicle-mediated transport, Golgi to ER AMI
                      0.0002 DUF1430       4E-005       115870 symbiosis, encompassing mutualism through parasitism IMMU
                                                                    UNKNOWN FUNCTION 0.063 FAMILY FUNCTION.
                                                                                  PRP            THIS
Plasmodium falciparum 3D7 - molecular_function - membrane -PFAM07242 DUF1430 . C-TERMINUS 120REPRESENTS APP
                      melanogaster - biological_process - molecular_function1-EPIMERASE. 110261 PFAM01247 RIBOSOMA
yellow-d - Drosophila 0.0001 Aldose_epim0.26                        ALDOSE_EPIM ALDOSE RIBOSOMAL SRG FAMILY
                                                        110276 PFAM01263 -TyrKc                 0.32
                                                                                  cellular_component
                         whose overexpression
                                           0.064        117827 PFAM09283 CDC13-DNA-BIND CDC13 BINDING. DNA-BINDI
                                                                    SSDNA MEMBERS THIS FAMILY FUNGAL SINGLE STRA
                                                                                  FGF           0.72
Glc7-interacting protein 0.28 CDC13-DNA-bindrelocalizes Glc7p from the nucleus and prevents chromosome segregation - Sa
                      0.002 to drug - integral to
                                          2E-004       110088 PFAM01061 ABC2_MEMBRANE ABC-2 TRANSPORTER. 111
                                                                   TYPE COLICIN_V
                                                                               transmembrane V PRODUCTION - REQUIRE
                                                                                             0.088
Candida albicans - response ABC2_membrane membrane - monosaccharideBHL COLICIN transporter activityISmonosacc
                       melanogaster - biological_process - molecular_functionWR1
CG31789 - Drosophila6E-17 OPT             0.066                    OPT OLIGOPEPTIDE TRANSPORTER FAMILY TRANSPO
                                                                                - cellular_component
                                                                                             0.17
                                                       112004 PFAM03169 PROTEIN. PFAM00005 PFAM00854 FAMILIES. T
                      1E-19 Protamine_P1E-011
                                          2            109322 PFAM00260 collagen THIScuticulin-based PFAM07174 FIBRO
                                                                   PROTAMINE FAP and 4E-006 CONTAINS development
                                                                               PRP           FAMILY
Caenorhabditis elegans - molting cycle, collagen and cuticulin-based cuticle -PROTAMINE_P1 P1. 115804 cuticleBACTERIAL P
                            Cation_efflux0.026                     CATION_EFFLUX COBALT. CELLS. 114887 PFAM06195 D
                                                                               SAM_PNT 0.38
                                                       110542 PFAM01545 FAMILY. CATION EFFLUX MEMBERS THIS FAM



                        melanogaster     2E-013  mitotic PFAM00076 RRM_1
                                                           RNA RECOGNITION RRM RBD . PROTEIN. SNRNPS. PR
                                                                      RRM        9E-016
CG13298 - Drosophila2E-62 RRM_1 - mRNA binding - 109144spindle organization MOTIF. A.K.A. OR RNP DOMAIN MOTIF
                        Mus Histone      2E-029
H3 histone, family 3A -8E-71musculus - Barr body           HISTONE CORE HERPESVIRUS PFAM06070 HERPES_
                                                                      H3         2E-050
                                                 109192 PFAM00125 H2A H2B H3 H4. 114772LARGE STRUCTURAL P

                       1E-65 DJ-1_PfpI 9E-034           110918 PFAM01965 DJ-1_PFPI DJ-1 FAMILY. PFPI. REGULATORS.
                                                                     adult locomotory behavior
                                                                                L27           0.32
dj-1beta - Drosophila melanogaster - response to oxidative stress - PFPI FAMILY INCLUDES PROTEASE THIS DOMAIN IS AL
                       1E-85 HMG_box 5E-014             109556 transcription factor activity PFAM02463 DOMAIN. PROTEINS.
                                                                    HMG_BOX HMG HIGH 5E-014
                                                                                 HMG           mitochondrion - regulation RECF
mitochondrial transcription factor A - Drosophila melanogaster - PFAM00505 BOX. 111369 -MOBILITY GROUP SMC_Nof trans
                       9E-85 NIF3           9E-062      110759 PFAM01784 NIF3 FACTOR HOMOLOGUES. UNKNOWN. 1
                                                                    INTERACTING  cellular_component
                                                                                              0.093
CG4278 - Drosophila melanogaster - biological_process - molecular_function -KR NGG1P 3 .THIS FAMILY CONTAINS SEVER
                            0 WD40          4E-010      109458 - nucleus
                                                                    WD DOMAIN EUKARYOTIC TRANSLATION INITIATION F
                                                                                WD40          2E-010
CG3909 - Drosophila melanogaster - transcription factor activityPFAM00400 WD40 G-BETA REPEAT. 117235 PFAM08662 EI
                       3E-19 UPF0118        2E-010      110588 PFAM01594 UNKNOWN extracellular matrixCAUTION. 111560
                                                                    DOMAIN UPF0118 DUF20. FUNCTION. - odontogenesis o
                                                                                PSN           5E-006
dentin sialophosphoprotein - Rattus norvegicus - molecular_function - cell differentiation - FUNCTION THIS TRANSMEMBRAN

                       1E-75 EF1_GNE 3E-034             109780 translation EF1_GNE EF-1 EXCHANGE THIS translation elo
                                                                    GUANINE NUCLEOTIDE DOMAIN. CHAINS. 119107 PFAM
                                                                                IL1           0.083
eEF1delta - Drosophila melanogaster - translational elongation -PFAM00736elongation factor activity - eukaryotic FAMILY IS DO
                       3E-65 NAC            2E-020      110817 - nascent polypeptide-associated complexHAS THREEof pole
                                                                    NAC BUNYAVIRUS GLYCOPROTEIN - regulation GENO
                                                                                AMOP          0.16
bicaudal - Drosophila melanogaster - transcription factor activityPFAM01849 DOMAIN. 112384 PFAM03563 BUNYA_G2 G2. M
                       5E-26 Phospho_p8 1E-025          118722 PFAM10195 PHOSPHO_P8 DNA-BINDING P8. P8 80-82 HUM
                                                                                PSN           0.13
CG6770 - Drosophila melanogaster - response to oxidative stress NUCLEAR PHOSPHOPROTEIN IS A SHORT AMINO ACID
                       4E-69 bZIP_1         6E-019       fate commitmentTRANSCRIPTION 1E-016 INCLUDES BASIC REGIO
                                                                    BZIP - JNK cascade - RNA polymerase II transcription fact
                                                                                BRLZ           ENTRY
Jun-related antigen - Drosophila melanogaster - R7 cell109236 PFAM00170 BZIP_1 FACTOR. REGION. 112756 PFAM03957
                       2E-53 UPF0118        6E-026      110588 PFAM01594 UNKNOWN extracellular matrixCAUTION. 116304
                                                                    DOMAIN UPF0118 DUF20. FUNCTION. - odontogenesis o
                                                                                OSTEO         1E-010
dentin sialophosphoprotein - Rattus norvegicus - molecular_function - cell differentiation - FUNCTION THIS TRANSMEMBRAN
                       5E-42 Competence2E-022           112579 PFAM03772 PROTEIN. - HELICES. DNA. MEMBRANE. SITE.
                                                                    COMPETENCE MEMBERS THIS FAMILY odontogenesis o
                                                                                PSN           5E-011
dentin sialophosphoprotein - Rattus norvegicus - molecular_function - cell differentiation 6 extracellular matrix -ARE INTEGRAL
                       6E-58 RNA_pol_L 1E-008           110211 PFAM01193 RPB3 - DNA-directed RNA polymerase activity - E
                                                                    RNA_POL_L RNA POLYMERASE ALPHA-ALPHA TWO D
                                                                                RPOLD         0.011
Rpb11 - Drosophila melanogaster - transcription from RNA polymerase II promoter RPB11 DOMAIN. . DIMERISATION DIMER.
                       1E-26 RRM_1          5E-019      109144 PFAM00076 RRM_1 MOTIF. A.K.A. OR RNP DOMAIN MOTIF
                                                                    RNA RECOGNITION RRM RBD . PROTEIN. SNRNPS. PR
                                                                                RRM
myelin expression factor 2 - Danio rerio - cellular_component - biological_process            2E-018
                       7E-33 Mpp10          2E-017
zgc:100957 - Danio rerio - cellular_component                       THIS FAMILY INCLUDES PROTEINS RELATED TO SNO
                                                                                OSTEO         2E-008
                                                        112805 PFAM04006 MPP10 PROTEIN. 10 . U3 18S PRE-RRNA.M PH
                           0 Not1            regulator  112852 PFAM04054 NOT1 CCR4-NOT A GLOBAL-REGULATOR TR
                                                                    COMPLEX S_TKc
                                                                                COMPONENT IS   morphogenesis 116247 PFAM07
Not1 - Drosophila melanogaster - negative1E-112 of basal transcription activity - dendrite 0.66NOT1. TFIID.muscle developm
                       3E-31 Homo sapiens - extracellular matrix structural constituent - calcium ion binding - collagen binding
Dentin sialophosphoprotein - MFS_1          7E-018                  MAJOR FACILITATOR CYTIDYLYLTRANSFERASE MEMB
                                                                                PSN           1E-009
                                                        116304 PFAM07690 MFS_1 SUPERFAMILY. 110170 PFAM01148 CTP

                       3E-94 efhand        3E-004
CG2185 - Drosophila melanogaster - calcium ion binding              EFHAND EF CAN BE DIVIDED INTO TWO CLASSES SIGN
                                                                                EFh           5E-005
                                                        109105 PFAM00036 HAND. EF-HANDS PROTEINS. WELL-KNOWN S
                            0 Phosducin 3E-017          regulation of caspase activity - protein bindingMEMBRANE THIS IS A C
                                                                    PHOSDUCIN YFHO BACTERIAL - cytoplasm
                                                                                B561          0.10
viral IAP-associated factor - Drosophila melanogaster - 65862 PFAM02114 PHOSDUCIN. 118122 PFAM09586 YFHO. PROTE
                       1E-99 Ras           8E-062        germ bandRAS INCLUDES RAB RAC RAL RAN RAP SHARESinvagin
                                                                     extension -RHO
                                                                                 germ-band extension - posterior midgut MOTIF
                                                                                              9E-090
Rho1 - Drosophila melanogaster - gastrulation involving109139 PFAM00071 FAMILY. SUB-FAMILIES YPT1 MORE. P-LOOP M
                       2E-27 Bap31         4E-043       114261 PFAM05529 plasma INTEGRAL - integral to plasma membran
                                                                    IS A POLYTOPIC membrane ENDOPLASMIC RETICULUM
                                                                                BRLZ          2E-004
B-cell receptor-associated protein 31 - Rattus norvegicus - Golgi membrane -BAP31 B-CELL RECEPTOR-ASSOCIATED 31-LI
                            0 WD40         2E-008       109458 PFAM00400 WD40 G-BETA REPEAT. 110734 PFAM01757 AC
                                                                    WD smoothened signaling pathway THIS FAMILY INCLUD
                                                                                WD40          2E-009
supernumerary limbs - Drosophila melanogaster - negative regulation ofDOMAIN ACYLTRANSFERASE - regulation of Wnt rec
                       5E-25 kinase        1E-004       109458 PFAM00400 kinase C binding - cytoplasm - oviposition - oogen
                                                                    WD DOMAIN SPECIFIC3E-005
                                                                                WD40            REPEAT. 111696 PFAM02826 2-
Receptor of activated protein WD40 C 1 - Drosophila melanogaster - protein WD40 G-BETADEHYDROGENASE NAD BINDIN
                       4E-31 Rhomboid 0.019             110676 PFAM01694 FAMILY. FAMILY CONTAINS INTEGRAL MEMBR
                                                                    RHOMBOID THIS PROTEIN.
                                                                                PI3K_p85B integral to membrane
rhomboid-4 - Drosophila melanogaster - plasma membrane - serine-type peptidase activity -0.056 EUKARYOTES. MEMBRANE

                     2E-15 RF-1           5E-014        109525 PFAM00472 RF-1 IS FOUND - CHAIN RELEASE
                                                                    THIS DOMAIN DOMAIN. RF-2 FUNCTION. PEPTIDYL-TRN
                                                                               IBR           0.051
peptidyl-tRNA hydrolase domain protein - Geobacter sulfurreducens PCA - molecular_functionIN biological_process FACTORS
                      - Drosophila melanogaster - translation -PFAM00673 RIBOSOMAL_L5_C L5P C-TERMINUS.ASSOCIA
Ribosomal protein L112E-96 Ribosomal_L5_C 1E-043                    RIBOSOMAL FAMILY THIS REGION IS large ribosomal su
                                                                               LIGANc        0.23
                                                        109718 structural constituent of ribosome - cytosolicFOUND PFAM00
                      - Drosophila melanogaster - translation -PFAM01246 RIBOSOMAL_L24E L24E. 115191 PFAM06519 su
Ribosomal protein L242E-74 Ribosomal_L24e 5E-026                    RIBOSOMAL TOLA ribosome - cytosolic large ribosomal B
                                                                               TRASH         3E-008
                                                        110260 structural constituent ofTHIS FAMILY CONSISTS SEVERAL P
                     1E-70 Ribosomal_L7Ae 7E-027        110262 structural constituent of ribosome - cytosolic S12Eribosomal s
                                                                    RIBOSOMAL THIS FAMILY INCLUDES FROM GADD45
                                                                               ShKT          0.13
Ribosomal protein S12 - Drosophila melanogaster - translation -PFAM01248 RIBOSOMAL_L7AE L7AE L30E small METAZOAF
                     2E-81 Ribosomal_S13_N8E-029        116676 structural constituent of ribosome FOUND N-TERMINAL DOM
                                                                    RIBOSOMAL THIS DOMAIN IS cytosolic small ribosomal s
                                                                               WNT1          0.036
Ribosomal protein S13 - Drosophila melanogaster - translation -PFAM08069 RIBOSOMAL_S13_N -S13 S15 AT ALSO IDENTIF
                     8E-79 Ribosomal_S11  6E-043        109468 - structural RIBOSOMAL_S11 S11. 111140 small ribosomal
                                                                    RIBOSOMAL NHASE_BETA NITRILE HYDRATASE BETA
                                                                               SF_P          0.046
Ribosomal protein S14b - Drosophila melanogaster - translationPFAM00411constituent of ribosome - cytosolicPFAM02211 SUB
                     2E-78 Ribosomal_S19e 2E-071        110114 - structural RIBOSOMAL_S19E S19E.DOMAINPFAM09328 D
                                                                    RIBOSOMAL PHYTOCHELATIN_C 117870 UNKNOWN
                                                                               HTH_DTXR 0.001
Ribosomal protein S19a - Drosophila melanogaster - translationPFAM01090constituent of ribosome - cytosolic small ribosomalF
                     2E-59 Ribosomal_S10  2E-028        109398 structural constituent of ribosome - cytosolic S10 S20 EUKARY
                                                                    RIBOSOMAL THIS FAMILY S10P S20E. small SUBUNIT F
                                                                               SOCS          0.36
Ribosomal protein S20 - Drosophila melanogaster - translation -PFAM00338 RIBOSOMAL_S10 INCLUDES SMALL ribosomal s
                     2E-76 Ribosomal_S12  1E-040        109230 structural constituent of ribosome - cytosolic PFAM02443 CIR
                                                                    RIBOSOMAL CIRCO_CAPSID CIRCOVIRUS CAPSID PRO
                                                                               HTH_MARR 0.15
Ribosomal protein S23 - Drosophila melanogaster - translation -PFAM00164 RIBOSOMAL_S12 S12. 111349 small ribosomal s
                          0 Ribosomal_S8e 4E-043        110219 PFAM01201 RIBOSOMAL_S8E - cytosolic small ribosomal su
                                                                    RIBOSOMAL MEMBRANE THIS DOMAIN FOUND IN VAR
                                                                               ArfGap        0.044
Ribosomal protein S8 - Drosophila melanogaster - translation - structural constituent of ribosomeS8E. 118451 PFAM09922 DU
                     1E-48 Ribosomal_60s  2E-028        109484 structural constituent of ribosome - cytosolic large ribosomal s
                                                                    ACIDIC RIBOSOMAL THIS 60S PROTEIN. L12 P0 P1 P2.
                                                                               LITAF         0.18
Ribosomal protein LP1 - Drosophila melanogaster - translation -PFAM00428 RIBOSOMAL_60SFAMILY INCLUDES ARCHAEB
                          0 Ribosomal_L16 5E-023        109315 PFAM00252 RIBOSOMAL_L16 ribosomal subunit - ribosome -
                                                                    RIBOSOMAL cytosolic large L16P L10E. 110242 PFAM012
                                                                                - FORM_NIR_TRANS FORMATE NITRITE K_
Qm - Drosophila melanogaster - translation - structural constituent of ribosomeChtBD1        0.22
                          0 Ribosomal_L13 2E-033        109622 - structural RIBOSOMAL_L13 L13. cytosolic large ribosomal
                                                                    RIBOSOMAL ADENOVIRUS LARGE THIS FAMILY CONSI
                                                                               alkPPc        0.075
Ribosomal protein L13A - Drosophila melanogaster - translationPFAM00572constituent of ribosome - 110678 PFAM01696 ADE
                      - Drosophila melanogaster - translation -PFAM01158 RIBOSOMAL_L36E L36E. HOMOSPERMIDINE su
Ribosomal protein L367E-57 Ribosomal_L36e 2E-045                    RIBOSOMAL HOMO_SPERM_SYN 115087 PFAM06408 T
                                                                               Zn_pept       0.027
                                                        110180 structural constituent of ribosome - cytosolic large ribosomal S
                     4E-32 Ribosomal_L38e 9E-029        110756 PFAM01781 RIBOSOMAL_L38E L38E FAMILY. 119040 PFAM
                                                                    RIBOSOMAL CONJUGATING ENZYME HYBRID LOCALIS
                                                                               B41
Drosophila yakuba - molecular_function - cellular_component - biological_process             0.006
                        1E-56 Ribosomal_L44 9E-034         109970 - structural RIBOSOMAL_L44 L44. cytosolic large ribosomal
                                                                          RIBOSOMAL NA_H_EXCHANGER SODIUM HYDROGEN
                                                                                       ZnF_C4          0.11
Ribosomal protein L36A - Drosophila melanogaster - translationPFAM00935constituent of ribosome - 110030 PFAM00999 FAM
                              0 Ribosomal_L6e
                                            4E-042         110181 PFAM01159 RIBOSOMAL_L6E - mitotic spindle CONVERSIO
                                                                          RIBOSOMAL THIS IS particle
                                                                                       LamNT           FAMILY 112671 PFAM03868 RIB
Ribosomal protein L6 - Drosophila melanogaster - cytosolic large ribosomal subunit - lipid A 0.15 L6E.CATALYSES elongation -
                         - Drosophila melanogaster - translation -PFAM05162 RIBOSOMAL_L41 L41. DOMAIN UNKNOWNDUF
Ribosomal protein L411E-07 Ribosomal_L41    2E-010                        RIBOSOMAL MITOCHONDRIAL 116799 PFAM08213 FUN
                                                                                       HTTM            0.23
                                                           113914 structural constituent of ribosome - cytosolic large ribosomal su
                         - Drosophila melanogaster - translation -PFAM00240 FAMILY. UBIQUITIN-LIKE SMT3 NEDD8 PROTE
Ribosomal protein L404E-70 ubiquitin        2E-030                        UBIQUITINUBQ FAMILY ubiquitin-dependent protein cata
                                                                                        THIS           4E-028
                                                           109304 protein modification process -CONTAINS A NUMBER RUB1 P
                        3E-76 Ribosomal_S19 5E-035         109268 structural constituent of ribosome - cytosolic PFAM02616 PRO
                                                                          RIBOSOMAL SCPA_SCPB S19. B SCPB PARTICIPATE
                                                                                       calpain_III 0.33
Ribosomal protein S15 - Drosophila melanogaster - translation -PFAM00203 RIBOSOMAL_S19SCPA111508 small ribosomal s
                              0 Ribosomal_S3_C
                                            2E-027         109255 PFAM00189 RIBOSOMAL_S3_C S3 C-TERMINAL -DOMAIN.-P
                                                                          RIBOSOMAL THIS FAMILY CONTAINS matrix nucleus
                                                                                       KH              activity
Ribosomal protein S3 - Drosophila melanogaster - DNA-(apurinic or apyrimidinic site) lyase 6E-004 - nuclear A CENTRAL DOM
                        2E-45 Ribosomal_S27e3E-024         110652 PFAM01667 RIBOSOMAL_S27E S27. 112688 PFAM03886 DU
                                                                          RIBOSOMAL UNKNOWN FUNCTION PROTEINS IN THIS
                                                                                       MeTrc           0.24
Ribosomal protein S27 - Drosophila melanogaster - structural constituent of ribosome - cytosolic small ribosomal subunit - lipid
                         - Drosophila melanogaster - translation -PFAM00237 RIBOSOMAL_L22 INCLUDES FROM ribosomal su
Ribosomal protein L173E-90 Ribosomal_L22    3E-029                        RIBOSOMAL THIS FAMILY L22P L17E. large PROKARYO
                                                                                       IL10            0.073
                                                           109301 structural constituent of ribosome - cytosolicL22 L17 EUKARY
                                DUF1946     0.39                          DOMAIN DUF1946 PROTEINS. DESCRIBED. 116804 PF
                                                                                       HTH_MERR 0.14
                                                           117733 PFAM09179 UNKOWN.FUNCTION MEMBERS THIS FAMILY
                              0 Ribosomal_L2_C
                                            6E-047         112746 PFAM03947 RIBOSOMAL_L2_C cytosolic large ribosomal sub
                                                                          RIBOSOMAL PROTEINS RNA BINDING UNKNOWN FUNC
                                                                                       VPS10           0.14
Ribosomal protein L8 - Drosophila melanogaster - translation - structural constituent of ribosome -L2 C-TERMINAL DOMAIN. 1
                         - Drosophila melanogaster - translation -PFAM01778 RIBOSOMAL_L28E L28E CONSISTS SEVERAL P
Ribosomal protein L286E-51 Ribosomal_L28e   2E-035                        RIBOSOMAL WZYE THIS FAMILY FAMILY. 115549 of ribo
                                                           110753 cytosolic largeDDT                   0.013
                                                                                         ribosomal subunit - structural constituent PFAM
                        3E-33 CSD           2E-008          norvegicusCSD TEN_N TENEURIN DNA-BINDING DOMAIN. 115160
                                                                           - RNA binding - Golgi apparatus
                                                                                       CSP             3E-013
cold shock domain containing C2, RNA binding - Rattus109374 PFAM00313 'COLD-SHOCK'INTRACELLULAR THIS FAMILY
                              0 SCAMP       0.055          112936 - structural constituent of MEMBRANE-TRAFFICKING riboso
                                                                          SCAMP IN XPGNVERTEBRATES SECRETORY CARRIER MEM
                                                                                                       0.13
mitochondrial ribosomal protein L28 - Drosophila melanogaster PFAM04144 FAMILY. 1-3ribosome - mitochondrial largeN-TER
                     0.000007 Ets           0.12           109244 PFAM00178 ETS-DOMAIN.0.007
                                                                          ETS          ETS
rRNA promoter binding protein - Rattus norvegicus - double-stranded DNA binding - transcription factor activity - transcription fa
                                Adeno_E3B 0.033                           ADENOVIRUS UNKNOWN PROTEIN. A FAMILY PARALO
                                                                                       Sema            0.31
                                                           112201 PFAM03376 ADENO_E3B E3BFUNCTION 116217 PFAM0759
                        5E-94 eIF-5_eIF-2B1E-054           110838 PFAM01873 FOUND IN THIS FAMILY INCLUDES N TERMINU
                                                                          DOMAIN EIF-5_EIF-2B IF2B IF5. complex - GTP binding -
                                                                                       eIF2B_5         6E-049
Eukaryotic initiation factor 2beta - Drosophila melanogaster - formation of translation initiation ternary EIF-5 EIF-2 BETA. HOMO
                        4E-75 Ribosomal_S17 1E-026         109426 PFAM00366 RIBOSOMAL_S17 S17. FACTOR TERMINATES
                                                                          RIBOSOMAL DOMAIN 0.22
                                                                                       DysFC
Drosophila pseudoobscura - molecular_function - cellular_component - biological_process RELEASE 112288 PFAM03463 ERF
                              0 Ribosomal_60s
                                            1E-018         109484 structural constituent of ribosome - cytosolic large ribosomal s
                                                                          ACIDIC RIBOSOMAL THIS 60S PROTEIN. L12 P0 P1 P2.
                                                                                       HMG17           0.16
Ribosomal protein LP0 - Drosophila melanogaster - translation -PFAM00428 RIBOSOMAL_60SFAMILY INCLUDES ARCHAEB
                        4E-33 Ribosomal_S30 3E-020         113525 PFAM04758 RIBOSOMAL_S30 small ribosomal subunitA lipid
                                                                          RIBOSOMAL UBIQUITIN THIS FAMILY CONTAINS - FAM
                                                                                       UBQ             6E-005
Ribosomal protein S30 - Drosophila melanogaster - structural constituent of ribosome - cytosolicS30. 109304 PFAM00240 NUM
                        9E-47 Ribosomal_L37ae
                                            2E-047         110755 - structural RIBOSOMAL_L37AE L37AE FAMILY. EUKARYO
                                                                          RIBOSOMAL THIS of ribosome - cytosolic large ribosomal
                                                                                       PHD             0.10
Ribosomal protein L37A - Drosophila melanogaster - translationPFAM01780constituent IS FOUND IN ARCHAEBACTERIA IT C
                        3E-17 7TM_GPCR_Srx  0.11           118849 PFAM10328 7TM_GPCR_SRX CHEMORECEPTOR CHEMOR
                                                                          - molecular_function
                                                                                       MA3             0.078
zgc:158463 - Danio rerio - cellular_component - biological_processSERPENTINE TYPE GPCR 7TM SRX. SEVEN-TRANSMEM
                        5E-38 L15           7E-009         109319 - structural L15 EUKARYOTIC MEMBRANE large ribosomal
                                                                          RIBOSOMAL L15. 109866 PFAM00828 RIBOSOMAL_L18E
                                                                                       PSN             0.46
Ribosomal protein L27A - Drosophila melanogaster - translationPFAM00256constituent of ribosome - cytosolic UNKNOWN FUN
                              0 PCI
Int6 homologue - Drosophila melanogaster7E-020             110403 PFAM01399 DOMAIN INT-6 NIP-1 TRIP-15 . 112641 PFAM03
                                                                           translation PINT
                                                                                        initiation factor activity - eukaryotic translation in
                                                                                                        ALSO
                                              - translational initiation -PCI THIS DOMAIN. HAS5E-012BEEN CALLED PINT MOTI
                                PRANC       0.031                         PRANC THIS PRESUMED DOMAIN IS FOUND AT A ROL
                                                                                       XPGN            0.69
                                                           117914 PFAM09372 DOMAIN. C-TERMINUS PROTEINS. F-BOXVARI
                        2E-95 Amidase       acid amide hydrolasePFAM01425 AMIDASE. 118101 PFAM09565 ENDONUCLEAS
CG8839 - Drosophila melanogaster - fatty 3E-013                           AMIDASE particle
                                                                                       TOP4c
                                                           110429 activity - lipid RE_NGOFVII 0.23      NGOFVII RESTRICTION THIS FA
                        4E-30 Ribosomal_S7  1E-012         109243 translation - RIBOSOMAL_S7 S7P ribosome - mitochondrial s
                                                                          RIBOSOMAL THIS FAMILY CONTAINS S5 EUKARYOTES
                                                                                       MyTH4           0.76
mitochondrial ribosomal protein S7 - Drosophila melanogaster - PFAM00177 structural constituent ofS5E. S7FROM PROKARYO
                          Rattus                                                       RPOLA_N 0.14
ribosomal protein L12 -0.003 norvegicus - protein binding - nucleus - nucleolus - cytoplasm - cytosol - translational elongation
                        2E-24 Mpp10         3E-012
zgc:100957 - Danio rerio - cellular_component                             THIS FAMILY INCLUDES PROTEINS RELATED TO SNO
                                                                                       PSN             3E-007
                                                           112805 PFAM04006 MPP10 PROTEIN. 10 . U3 18S PRE-RRNA.M PH
                                            0.24
                                CTP-dep_RFKase                            DOMAIN CTP-DEP_RFKASE DUF120. IS A RIBOFLAVIN
                                                                                       TBOX            0.58
                                                           110934 PFAM01982 UNKNOWN FUNCTION THIS CTP-DEPENDENT
                                7TM_GPCR_Sru0.40                          SERPENTINE TYPE GPCR 7TM SRU. SEVEN-TRANSME
                                                                                       MUTSd           0.066
                                                           118843 PFAM10322 7TM_GPCR_SRU CHEMORECEPTOR CHEMOR

                            0 DnaJ         1E-027       109290 PFAM00226 DOMAIN. J-DOMAINS synaptic vesicle uncoating
                                                                    DNAJ DOMAINS ARE ASSOCIATED WITH SYSTEM IT IS
                                                                                 DnaJ           2E-021
Cysteine string protein - Drosophila melanogaster - plasma membrane - neurotransmitter secretion -HSP70 HEAT-SHOCK INT
                       2E-98 - Drosophila 7E-010
Glutathione S transferase D1GST_N                       111671 PFAM02798 S-TRANSFERASE
                                                                    GST_N GLUTATHIONE FUNCTION CONJUGATION REDU
                                                                                 CHK
                                           melanogaster - glutathione transferase activity 0.12 N-TERMINAL DOMAIN. TARG
                       2E-57 GST_C         2E-004       109112 PFAM00043 S-TRANSFERASE C-TERMINAL DOMAIN. S-CR
                                                                    GST_C GLUTATHIONE 0.11 CONJUGATES REDUCED T
                                                                                 RasGAP         GST
CG6673 - Drosophila melanogaster - glutathione transferase activity - transferase activity, transferring sulfur-containing groups
                        melanogaster - dolichyl-diphosphooligosaccharide-protein glycotransferase activity -ESSENTIAL SUBUN
CG33303 - Drosophila1E-72 Ribophorin_I 1E-057                       RIBOPHORIN_I DOLICHYL-DIPHOSPHOOLIGOSACCHARIDE-
                                                                                                0.23
                                                        113370 PFAM04597 I. FH2 RIBOPHORIN I IS AN oligosaccharyltrans
                             - Thioredoxin 8E-006        protein folding - protein disulfide isomerase activity - endoplasmic retic
                                                                    THIOREDOXIN THIOREDOXINS NOISE. 110233 PFAM01
                                                                                 SERPIN         0.20
Protein disulfide isomerase0 Drosophila melanogaster -109153 PFAM00085 THIOREDOXIN. BOND. ARE SMALL ENZYMES T
                        1 - Drosophila melanogaster     109628 PFAM00578 AHPC-TSA FAMILY.activity peroxidase activity -
                                                                    AHPC thioredoxin peroxidase . 118938 PFAM10417 1-CYS
                                                                                  THIS          0.47
thioredoxin peroxidase8E-88 AhpC-TSA 2E-027 - antioxidant activity - TSA LITAF FAMILY CONTAINS-PROTEINS RELATE
                        1 - Drosophila melanogaster     109628 PFAM00578 AHPC-TSA FAMILY.activity peroxidase activity -
                                                                    AHPC thioredoxin peroxidase . 118938 PFAM10417 1-CYS
thioredoxin peroxidase8E-88 AhpC-TSA 2E-027 - antioxidant activity - TSA THIS FAMILY CONTAINS-PROTEINS RELATE
                             Drosophila melanogaster - GDP-dissociation inhibitor activity -113632 PFAM04866 ROTA_NS6 NO
GDP dissociation inhibitor -0 GDI          1E-116                   GDI GDP DISSOCIATION ROTAVIRUS UNKNOWN FUNC
                                                                                 ADEAMc         0.042
                                                        110027 PFAM00996 INHIBITOR. neurotransmitter secretion - vesicle-
                            0 Peptidase_S9_N
                                           4E-088       111751 PFAM02897 OLIGOPEPTIDASE THIS UNUSUAL DOMAIN PR
                                                                    PROLYL PEPTIDASE_S9_N N-TERMINAL BETA-PROPEL
CG5355 - Drosophila melanogaster - serine-type endopeptidase activity            TLC            0.049
                       1E-41 DUF1515       0.023        116060 PFAM07439 isomerase activity
                                                                    UNKNOWN FUNCTION 0.009
                                                                                 TPR             LENGTH. SPECIES. UNKNOWN.
CG5482 - Drosophila melanogaster - FK506 binding - peptidyl-prolyl cis-transDUF1515 . 130THIS FAMILY CONSISTS SEVER
                       6E-29 7TMR-DISM_7TM 4E-015
zgc:100957 - Danio rerio - cellular_component                       DIVERSE INTRACELLULAR THIS ENTRY REPRESENTS
                                                                                 PSN            7E-009
                                                        116309 PFAM07695 7TMR-DISM_7TM 7TM SIGNALLING. 7TM-DISM
                       6E-18 - Drosophila 3E-005
Heat shock protein cognate 4DEC-1_N                     113398 PFAM04625 DEC-1_N the syncytial blastoderm - axon ASSEMB
                                                                    N development via DEC-1 GENE IN CHORION-1 guidanc
                                                                                 ANX            0.14
                                           melanogaster - embryonic TERMINAL DEFECTIVE REGION. DROSOPHILA ENCO

                        1E-41 Sec61_beta 5E-018           112711 PFAM03911 SEC61_BETA membrane, translocation - protein t
                                                                    THIS FAMILY CONSISTS HOMOLOGUES A COMPONEN
Sec61beta - Drosophila melanogaster - SRP-dependent cotranslational proteinSAA                 SEC61BETA FAMILY. SEC61 SYS
                                                                                  targeting to 0.52
                        3E-83 TRAP_beta 3E-068            114477 PFAM05753 binding - signal recognition particle, endoplasmic
                                                                    TRAP_BETA BETA TRAPB THIS FAMILY CONSISTS SEV
Signal sequence receptor beta - Drosophila melanogaster - signal sequence TRANSLOCON-ASSOCIATED . SSR-BETA PROr
                        5E-85 Clat_adaptor_s
                                           6E-061         110234 PFAM01217 CHAIN. coating - vesicle coating - COMPLEX SM
                                                                     - synaptic vesicle 109395 PFAM00335 FAMILY. 115251 PF
                                                                                 LPD_N         0.33
AP-1sigma - Drosophila melanogaster - neurotransmitter secretion CLAT_ADAPTOR_S CLATHRIN ADAPTORcoated vesicle -
                               Drosophila melanogaster - proteinPFAM00025ADP-ribosylation - GTP FAMILY. TOGETHER. 117
ADP ribosylation factor 79F0- Arf          4E-090                   ARF FACTOR COMBINES A NUMBER - endosome PROS
                                                                                 ARF           1E-102
                                                          109094 amino acid ADP-RIBOSYLATION binding DIFFERENT transp
                        9E-32 SPC12        2E-023         115314 PFAM06645 SPC12 activity0.14
                                                                    MICROSOMAL SIGNAL PEPTIDASE KDA complex THIS
                                                                                 CYCLIN         - signal peptidase SUBUNIT
Spase 12-subunit - Drosophila melanogaster - signal peptide processing - peptidase 12 . PROTEINS. SEQUENCES. RIBOSOM
                        6E-17 Tom7         1E-009         116648 PFAM08038 TOM7 FAMILY. RECEPTORS. TRANSLOCASE.
                                                                    THIS FAMILY CONSISTS MITOCHONDRIAL IMPORT FOR
                                                                                 PLAc          0.18
Translocase of outer membrane 7 - Drosophila melanogaster - protein targeting to mitochondrion - P-P-bond-hydrolysis-driven
                        3E-69 Clathrin_lg_chE-020
                                           3              vesicle PFAM01086 pit - neurotransmitter secretion - neurotransmitter
                                                                    CLATHRIN_LG_CH CLATHRIN LIGHT ORGANISATION F
                                                                                 EH            0.14
Clathrin light chain - Drosophila melanogaster - clathrin 110111 coat - coated CHAIN. 114398 PFAM05672 MAP7 E-MAP-115 M
                     1E-43 SynaptobrevinE-033
                                        4            109992 PFAM00957 SYNAPTOBREVIN.plasma membrane - SECRET
                                                                 SYNAPTOBREVIN activity 109535 PFAM00482 DOMAIN
                                                                             receptor   0.078
Synaptobrevin - Drosophila melanogaster - vesicle-mediated transport - SNAP MCM GSPII_F-BACTERIAL TYPE II synaptic
                     6E-17 Schizosaccharomyces pombe - molecular_function - ER to Golgi vesicle-mediated transport - IN T
TRAPPcomplexsubunitBet3 -TRAPP          1E-039                   TRAPP TRANSPORT PARTICLE PLAYS A KEY ROLE intr
                                                                             TSPN       0.22
                                                     112849 PFAM04051 COMPONENT. ER-TO-GOLGI COMPARTMENT.
                          0 SRP72       1E-015       117069 PFAM08492 SRP72 to BEEN IDENTIFIED binding signal PF
                                                                 protein targeting RNA-BINDING DOMAIN. BINDING SITE
                                                                             TOPEUc     3E-004
Srp72 - Drosophila melanogaster - SRP-dependent cotranslational THIS REGION HASmembrane - 7S RNAASRNA. -113874rec

                       2E-76 NDUFB10 5E-063             118773 PFAM10249 NDUFB10 NADH-UBIQUINONE 10.NADH to ubiq
                                                                     OXIDOREDUCTASE SUBUNIT IS A FAMILY CONSERVED
Pdsw - Drosophila melanogaster - NADH dehydrogenase (ubiquinone) activity KISc                0.066
                                                                                - mitochondrial electron transport, 180 RESIDU
                        subunit 6 - Drosophila melanogaster - hydrogen-exporting ATPase activity, phosphorylative mechanism
mitochondrial ATPase 5E-99 ATP-synt_A 5E-061                         ATP SYNTHASE A SERPENTINE TYPE GPCR CHEMORE
                                                                                TOP4c         0.18
                                                        109186 PFAM00119 ATP-SYNT_A CHAIN. 118846 PFAM10325 7TM_
                       5E-12 COX7a         0.003        111162 PFAM02238 COX7A VIIA. 13 chain complex COMPLEX PFAM
                                                                      - mitochondrial C OXIDASE SUBUNIT A IV mitochondria
                                                                                Glyco_18      0.70
CG9603 - Drosophila melanogaster - cytochrome-c oxidase activityCYTOCHROMErespiratorySUB-UNIT CHAIN.- 113023 IS TE
                       5E-66 ATP-synt_C 5E-022          109204 PFAM00137 ATP-SYNT_C C. 118666 - proton transport - mito
                                                                     ATP SYNTHASE SUBUNIT TELLURIUM_RES PROTEIN.
                                                                                TLC           0.15
CG1746 - Drosophila melanogaster - hydrogen-exporting ATPase activity, phosphorylative mechanism PFAM10138TELLURIUM
                       2E-30 ATP-synt_E 9E-025          114406 PFAM05680 ATP-SYNT_E CHAIN. 0 CONSISTS109812 - mito
                                                                     ATP SYNTHASE E THIS FAMILY SUBUNIT. SEVERAL C
                                                                                PLCYc         0.021
CG3321 - Drosophila melanogaster - hydrogen-exporting ATPase activity, phosphorylative mechanism - proton transport PFAM
                       4E-43 NDUF_B7 2E-045             114402 PFAM05676 NDUF_B7 NADH-UBIQUINONE B18 NDUFB7 . S
                                                                     OXIDOREDUCTASE dehydrogenase activity mitochondri
                                                                                IBR           0.012
CG5548 - Drosophila melanogaster - NADH dehydrogenase (ubiquinone) activity - NADHSUBUNIT THIS FAMILY-CONSISTSO
                       2E-34 ATP_synt_H 3E-029          114227 PFAM05493 H. 9 KDA. SYNTHASE SUBUNIT H proton-transp
                                                                     ATP_SYNT_H ATP ATPASE. 111055 PFAM02118 EXTRE
                                                                                LITAF         0.38
CG1268 - Drosophila melanogaster - hydrogen-exporting ATPase activity, phosphorylative mechanism - vacuolarIS AN CHEMO
                            0 COX3         1E-124       109561 PFAM00510 COX3 III. OXIDASE SUBUNIT mitochondrion - mit
                                                                     CYTOCHROME C 111560 PFAM02674 PROTEIN. COLIC
                                                                                LITAF         0.021
mitochondrial Cytochrome c oxidase subunit III - Drosophila melanogaster - cytochrome-c oxidase activity - COLICIN_VPCOLV
                       5E-96 ATP-synt_C 1E-008          109204 PFAM00137 phosphorylative 109702 PFAM00654 CHANNEL
                                                                     ATP SYNTHASE SUBUNIT VOLTAGE_CLC VOLTAGE GA
                                                                                ZnF_TAZ       0.17
VhaPPA1-1 - Drosophila melanogaster - hydrogen-exporting ATPase activity,ATP-SYNT_C C. mechanism - vacuolar proton-tra
                        16kD ATP-synt_C 1E-019          109204 - hydrogen-exportingSUBUNIT109702 PFAM00654 CHANNEL
                                                                     ATP SYNTHASE ATPase VOLTAGE_CLC VOLTAGE GA
                                                                                LITAF         0.010
Vacuolar H[+] ATPase2E-78 subunit - Drosophila melanogaster PFAM00137 ATP-SYNT_C C. activity, phosphorylative mechan
                       9E-16 Renin_r       1E-012       116462 PFAM07850 -RENIN SEQUENCES FEATURED IN THIS FAMI
                                                                     RENIN_R CAP10
                                                                                angiotensin maturation - molecular_function - pr
                                                                                              0.38
ATPase, H+ transporting, lysosomal accessory protein 2 - Rattus norvegicus RECEPTOR-LIKE PROTEIN. SEGMENT. ERK1 E
                        26kD vATP-synt_E7E-075          110943 PFAM01991 VATP-SYNT_ETHIS
                                                                      hydrogen-exporting ATPase SUBUNIT. 109812 PFAM0076
                                                                                DWA             31 activity, phosphorylative mech
Vacuolar H[+]-ATPase3E-99 E subunit - Drosophila melanogaster -ATP SYNTHASE E KDA0.036 FAMILY INCLUDES VACUO
                       2E-41 Oxidored_q41E-037          109558 PFAM00507 OXIDORED_Q4 NADH-UBIQUINONE 3. 116280
                                                                     PLASTOQUINONE OXIDOREDUCTASE (ubiquinone) activ
                                                                                PSN
mitochondrial NADH-ubiquinone oxidoreductase chain 3 - Drosophila melanogaster - NADH0.016     dehydrogenase CHAIN M PENET
                            0 Oxidored_q67E-049         110085 PFAM01058 OXIDORED_Q6 20 respiratory 110067 PFAM010
                                                                     NADH activity - mitochondrial SUBUNIT. chain CARBOXYL
                                                                                Glyco_32      0.16
CG9172 - Drosophila melanogaster - NADH dehydrogenase (ubiquinone) UBIQUINONE OXIDOREDUCTASE KD complex I - m
                        melanogaster - mitochondrial 117563 PFAM08997 UCR_6-4KD UBIQUINOL-CYTOCHROME 6.4KD
                                                                     C REDUCTASE cytochrome c - ubiquinol-cytochrome-c red
                                                                                FBG           0.23
CG14482 - Drosophila2E-18 UCR_6-4kD 2E-017 electron transport, ubiquinol to COMPLEX CYTOCHROME IS AN ESSEN
                       3E-65 GRIM-19       3E-055       114904 PFAM06212 to ubiquinone 0.14
                                                                     THIS FAMILY CONSISTSNADH dehydrogenase activity - m
                                                                                calpain_III - SEVERAL EUKARYOTIC GENE
CG3446 - Drosophila melanogaster - mitochondrial electron transport, NADHGRIM-19 PROTEIN. RETINOIC-INTERFERON-IN
                            0 Drosophila melanogaster 109102 PFAM00033 N-TERMINAL B6 PETB.mitochondrial respiratory c
mitochondrial Cytochrome b -Cytochrom_B_N  2E-080                    CYTOCHROM_B_N CYTOCHROME B CYTOCHROM_B_C
                                                                                B561          activity - 109101 PFAM00032 C-T
                                                         - ubiquinol-cytochrome-c reductase 0.62
                       8E-38 Oxidored_q36E-027          109550 PFAM00499 OXIDORED_Q3 NADH-UBIQUINONE 6. 118500
                                                                     PLASTOQUINONE OXIDOREDUCTASE (ubiquinone) activ
                                                                                PSN
mitochondrial NADH-ubiquinone oxidoreductase chain 6 - Drosophila melanogaster - NADH0.002     dehydrogenase CHAIN MEMBRA
                        b - Drosophila melanogaster - hydrogen-exporting ATPase activity, phosphorylative CHAIN PRECURSO
ATP synthase, subunit2E-79 Mt_ATP-synt_B   4E-034                    MITOCHONDRIAL ATP 0.033
                                                                                GLECT         SYNTHASE B mechanism - proton
                                                        114146 PFAM05405 MT_ATP-SYNT_B ATP-SYNT_B . TRANSPORT.
                       9E-94 Cytochrom_C1  4E-064       111098 - electron transporter, transferring electrons within CoQH2-cyto
                                                                     CYTOCHROME CAENORHABDITIS ELEGANS UNKNOW
                                                                                CT            0.12
CG4769 - Drosophila melanogaster - oxidative phosphorylation PFAM02167 CYTOCHROM_C1 C1 FAMILY. 114601 PFAM058
                       1E-64 Oxidored_q12E-037          109421 PFAM00361 OXIDORED_Q1 NADH-UBIQUINONE FAMILY M
                                                                     PLASTOQUINONE COMPLEX
                                                                                MYSc           dehydrogenase (ubiquinone) activ
mitochondrial NADH-ubiquinone oxidoreductase chain 2 - Drosophila melanogaster - NADH0.15 I VARIOUS THISCHAINS. IS
                            0 COX2_TM 1E-033            111663 PFAM02790 COX2_TM DOMAIN. N-TERMINAL ALPHA-HELIC
                                                                     CYTOCHROME C OXIDASE SUBUNIT II TRANSMEMBRA
                                                                                PSN           0.14
mitochondrial Cytochrome c oxidase subunit II - Drosophila melanogaster - cytochrome-c oxidase activity - mitochondrion - mito
                        melanogaster - pyruvate dehydrogenasePFAM02779 DOMAIN. ALPHA-KETO DECARBOXYLASES. 10
CG11876 - Drosophila1E-50 Transket_pyr1E-023                         TRANSKET_PYR TRANSKETOLASE PYRIMIDINEcomplex
                                                                                SprT          - pyruvate dehydrogenase BINDIN
                                                        111652 (acetyl-transferring) activity 0.025
                            0 Complex1_51K 3E-054       110509 PFAM01512 to ubiquinone 0.13 DOMAIN UNKNOWN PLEC
                                                                     NADH DEHYDROGENASE KD dehydrogenase activity - m
                                                                                THN           - NADH
CG9140 - Drosophila melanogaster - mitochondrial electron transport, NADHCOMPLEX1_51K RESPIRATORY-CHAIN 51 SUB
                       5E-98 COX1          2E-068       109182 PFAM00115 COX1 I. 118849 PFAM10328 mitochondrion - mito
                                                                     CYTOCHROME C QUINOL OXIDASE 7TM_GPCR_SRX 7
                                                                                B561          0.31
mitochondrial Cytochrome c oxidase subunit I - Drosophila melanogaster - cytochrome-c oxidase activity - POLYPEPTIDE SER
                       6E-44 Mito_carr     1E-015       109219 PFAM00153 PROTEIN. 115876 - ATP:ADP antiporter activity -
                                                                     MITO_CARR MITOCHONDRIAL CARRIER UNKNOWN FU
                                                                                LH2           0.14
stress-sensitive B - Drosophila melanogaster - flight behavior - response to mechanical stimulus PFAM07248 DUF1431 . FUNC
                       0.025 Srg           0.057        111055 PFAM02118 CHEMORECEPTOR. 118688 PFAM10160 TMEM
                                                                     SRG FAMILY MEMBRANE THIS IS A REGION
                                                                                PSN           0.96
knockdown - Drosophila melanogaster - tricarboxylic acid cycle - citrate (Si)-synthase activity - mitochondrial matrix AMINO AC

                        0 PGAM        1E-029       109361 PFAM00300 FAMILY.
                                                             PGAM PHOSPHOGLYCERATE MUTASE ARE ENTRY. R
                                                                         activity 0.22
Phosphoglyceromutase - Drosophila melanogaster - phosphoglycerate mutaseGRAN Y019_MYCTU YK23_YEASTNOT INCLU
                        0 Drosophila melanogaster 109402 PFAM00342dehydrogenaseGLUCOSE-6-PHOSPHATEglucone
Phosphoglucose isomerase -PGI         1E-114                 PGI PHOSPHOGLUCOSE ISOMERASE CATALYSES INTE
                                                                        TFIIE      (decarboxylating) activity - FRUCT
                                                   - phosphogluconate ISOMERASE. 0.26

                     9E-88 ADK            2E-045       109464 PFAM00406 KINASE. 111150 PFAM02223 THYMIDYLATE ZE
                                                                     ADK ADENYLATE
                                                                                AAA        0.024
Dak1 - Drosophila melanogaster - cytidylate kinase activity - uridylate kinase activity THYMIDYLATE_KIN 115091 PFAM0641

                        3E-96 - Drosophila2E-022
                                          melanogaster - CDP-diacylglycerol-inositol 3-phosphatidyltransferase activity - photo
Phosphatidylinositol synthaseCDP-OH_P_transf                    ALL THESE MEMBERS HAVE CDP-ALCOHOL PHOSPHA
                                                     110093 PFAM01066 CDP-OH_P_TRANSFABILITY TO CATALYSE DIS
                            0 Thiolase_N 1E-105      109175 PFAM00108 - cytosol
                                                                THIOLASE_N THIOLASE IS REPORTED TO BE STRUCTU
                                                                            EGF_Lam 0.28
CG9149 - Drosophila melanogaster - acetyl-CoA C-acetyltransferase activity N-TERMINAL DOMAIN. BETA-KETOACYL PFAM
                        3E-79 melanogaster - spermatogenesis PFAM08557 DELTA4-DESATURASESPHINGOLIPIDS ARE IM
infertile crescent - DrosophilaLipid_DES 9E-018                 LIPID_DESTLC SPHINGOLIPID DES . EUKARYOTES. - sphi
                                                                                          0.10
                                                     117132 - plasma membrane - stearoyl-CoA 9-desaturase activity4-DES
                        1E-33 Lipase      3E-004     109217 PFAM00151 LIPASE. 116404 PFAM07790 DUF1628 . SPECIE
                                                                            Glyco_18      0.16
CG5162 - Drosophila melanogaster - structural molecule activity LIPASE UNKNOWN FUNCTION SEQUENCES MAKING U

                     1E-65 adh_short 1E-016           109173 activity
                                                               ADH_SHORT SHORT CHAIN DEHYDROGENASES. 1172
                                                                       53EXOc   0.048
antdh - Drosophila melanogaster - carbonyl reductase (NADPH)PFAM00106 DEHYDROGENASE.THIS FAMILY CONTAINS A

                      melanogaster - peroxisomal membrane PFAM04117 MPV17_PMP22 MPV17A MAJOR COMPONENT
CG14778 - Drosophila7E-42 Mpv17_PMP22   1E-021     112912             MYSc     0.47
                                                            PEROXISOMAL MEMBRANE IS PMP22 FAMILY. 22-KDA
                    melanogaster        1E-006     118786 PFAM10262 T.RINGSELENOPROTEIN-T HUMANS. UDP-GLU
CG3887 - Drosophila 0.0009 SelT - cellular_component                   100     0.37
                                                            SELT SELENOPROTEIN THIS ENTRY IS AN APPROXIMA

                         (zinc Zip          4E-015        111436 PFAM02535 FAMILY- CONSISTS TRANSPORT PROTEINS M
                                                                     zinc ion transport zinc ion TRANSPORTERS. PLANT. FA
                                                                                 GGL            0.016
solute carrier family 392E-61 transporter), member 9 - Danio rerio - ZIP ZINC TRANSPORTER.transmembrane transporter activ
                             0 Transferrin 1E-010         109463 PFAM00405 TRANSFERRIN. 116002 PFAM07379FAMILY CO
                                                                     TRANSFERRIN UNKNOWN FUNCTION THIS DUF1494 .
                                                                                 TR_FER         iron ion
Transferrin 1 - Drosophila melanogaster - cellular iron ion homeostasis - ferric iron binding - 8E-023 transmembrane transporte
                        Drosophila        3E-056      binding - GTPase activity - cell adhesion - regulation MORE. P-LOOP M
                                                                  RAS INCLUDES RAB RAC RAL RAN RAP cell shape
                                                                              RAB            5E-061
Rab-related protein 4 -2E-80 Ras melanogaster - GTP 109139 PFAM00071 FAMILY. SUB-FAMILIES YPT1 of SHARES MOTIF
                       8E-62 Drosophila 5E-054        - determination of adultTLC span regulation ACTIVITY. 109939 PFAM0
                                                                  MICROTUBULE ASSOCIATED of protein ubiquitination
                                                                               life           1B 3.
Autophagy-specific gene 8a -MAP1_LC3 melanogaster 111837 PFAM02991 MAP1_LC3 -1A0.079 3LIGHT CHAIN IS PROPOS
                       3E-47 Dynein_light 2E-048      110238 PFAM01221 1.TLC DYNEIN LIGHT CHAIN TYPE SERPENTIN
                                                                  DYNEIN_LIGHT 118845 PFAM10324 7TM_GPCR_SRW micro
                                                                                             0.017
Cytoplasmic dynein light chain 2 - Drosophila melanogaster - cytoskeleton - motor activity - cytoplasmic dynein complex -7TM S

                        2E-11 zf-DNL
zgc:158228 - Danio rerio - cellular_component6E-020                    DNL ZINC DOMAIN IS NAMED AFTER A L. ZINC-FINGER
                                                                                   LITAF      0.51
                                                           113932 PFAM05180 ZF-DNL FINGER. C-TERMINAL SHORT MOTIF D
                          0.12 XPC-binding 0.029            Rattus PFAM09280 XPC-BINDING DOMAIN.A STRUCTURE CONSIS
                                                                       MEMBERS SEC14THIS FAMILY ADOPT ARRAY. REPAIR. 11185
NADH dehydrogenase (ubiquinone) flavoprotein 3-like -117824 norvegicus - mitochondrion 0.13
                         melanogaster        0.14          112618 PFAM03814 POTASSIUM-TRANSPORTING SUBUNIT. 10981
                                                                       KDPA ATPASE A FHIPEP OLIGOSACCHARYL TRANSFE
CG32185 - Drosophila2E-23 KdpA - biological_process - molecular_function - cellular_component
                        1E-28 RdRP           0.081
CG7630 - Drosophila melanogaster - lipid particle                      RDRP RNAElp3 DEPENDENT THIS FAMILY PROTEINS ARE
                                                                                              0.087
                                                           113935 PFAM05183 POLYMERASE. POLYMERASES. TEMPLATES. E
                         Coxiella burnetii RSA 493 - structural constituent of ribosome FAMILY CONSISTS SEVERAL BACTER
ribosomal protein S4 - 0.059 HAP3            0.34                      FLAGELLAR THIS
                                                                                   PIPKc      0.44
                                                           115795 PFAM07164 HAP3 HOOK-ASSOCIATED 3 . SEQUENCES. RH
                        4E-37 Ufm1           1E-037        112486      UBIQUITINHATPase_c 0.36 THIS IS A FAMILY SHORT P
                                                                                    FOLD MODIFIER
ubiquitin-fold modifier 1 - Rattus norvegicus - protein binding PFAM03671 UFM1 1 PROTEIN. UBIQUITIN-LIKE TYPE-1 TYP
                        5E-31 Macro          0.003         110647 PFAM01661 DOMAIN. ADP-RIBOSE MODULE. PROTEINS. C
                                                                       - molecular_function
                                                                                   A1pp       1E-005
zgc:110708 - Danio rerio - biological_process - cellular_componentMACRO THIS DOMAIN IS AN BINDING IT FOUND IN A NU
                        2E-73 - Mus musculus - Golgi apparatusPFAM05216 UNC-50 FAMILY. GMH1P FACTORS. 118442 PF
unc-50 homolog (C. elegans)UNC-50            1E-108        113967                  TLC        0.027
                                                                       FROM SACCHAROMYCES CEREVISIAE IS LOCATED IN
                    0.000004 Cw-hydrolase    0.007          homology comparisons and RT-PCR - WALL-ASSOCIATEDLARGEL
                                                                       CELL MEMBERS THIS FAMILY ARE CONFINED HYDRO
                                                                                   LITAF      0.30
Putative protein of unknown function identified by fungal119215 PFAM10695 CW-HYDROLASESaccharomyces cerevisiae - mo
                        4E-44 DUF602         4E-085        113412 PFAM04641 DUF602 DUF602. PROTEINS. 111369 PFAM024
                                                                       UNKNOWN FUNCTION 0.043 FAMILY REPRESENTS SEV
                                                                                   PSN
zgc:55448 - Danio rerio - molecular_function - cellular_component - biological_process        THIS
                               DUF70         0.026                     UNKNOWN FUNCTION FUNCTION. PROTEINS. 112854
                                                           110862 PFAM01901 DUF70 DUF70.ARCHAEBACTERIAL PROTEINS
                        2E-11 DUF1151        1E-033        115295 PFAM06625 DUF1151 . FUNCTION. 113405 PFAM04633
                                                                       UNKNOWN FUNCTION 0.071 FAMILY CONSISTS SEVER
                                                                                   LITAF      THIS
family with sequence similarity 107, member B - Danio rerio - cellular_component - molecular_function - biological_processHER
                             - MreD          1E-004        112889 PFAM04093 SHAPE-DETERMINING D IS ROD-SHAPED. 1
                                                                       MRED ROD MUREIN FORMATION
                                                                                   ZnF_C3H1
Drosophila pseudoobscura 0 molecular_function - cellular_component - biological_process 1E-007 MRED.INVOLVED IN SH
                               Terminase_10.054                        PHAGE MAJORITY MEMBERS THIS FAMILY ARE FUNC
                                                                                   SEC63      0.52
                                                           112181 PFAM03354 TERMINASE_1 TERMINASE. PROTEINS.BACTE
                        1E-11 FimH_man-bind  0.94          117714 PFAM09160 FRI MEMBERS THIS FAMILY ADOPT A SEC
                                                                       FIMH MANNOSE           0.30
Intronic Protein 259 - Drosophila melanogaster - phagocytosis, engulfment FIMH_MAN-BIND BINDING. TOPOLOGY. MANN

                       0.0008 Retrotrans_gag
                                           protein     112542 PFAM03732 PROTEIN. CAPSID-LIKE RETROTRANSPOSON
                                                                  RETROTRANS_GAG RETROTRANSPOSON GAG OR PR
                                                                              ZnF_C2HC 0.006
activity-regulated cytoskeleton-associated 0.082 - Rattus norvegicus - cytoplasm - endoderm development - anterior/posterior
                              RALF         0.14                   RALF RAPID ALKALINIZATION FACTOR A UBIQUITOUS
                                                       114232 PFAM05498 . 5-KDA DEVELOPMENT. 116286 PFAM07672 T

                     0.012 fate specification
                                          2E-007    110088 PFAM01061 ABC2_MEMBRANETHIS FAMILY INCLUDES 110
Caenorhabditis elegans - cell ABC2_membrane- cytoplasm                TLC       0.002
                                                             TYPE ACYLTRANSFERASE ABC-2 TRANSPORTER. A R
                        family protein - Colwellia
                                          0.001     116309 PFAM07695 7TMR-DISM_7TM 7TM SIGNALLING. 7TM-DISM
                                                             DIVERSE INTRACELLULAR THIS ENTRY REPRESENTS
                                                                      PSN       4E-004
cytochrome C assembly0.21 7TMR-DISM_7TM psychrerythraea 34H - protein complex assembly - respiratory chain complex
                              TatC        0.098              TATC TRANSLOCASE BACTERIAL TAT SYSTEM HAS A
                                                    109939 PFAM00902 SEC-INDEPENDENT . MEMBRANE. PH-DRIVEN
                              MAD         0.22               MAD MITOTIC CHECKPOINT THIS FAMILY CONSISTS S
                                                    114288 PFAM05557 PROTEIN. PROTEINS. OCCUR. EUKARYOTES.
                              Srg         0.039              SRG FAMILY INIT_TRNA_PT INITIATOR TRNA PHOSPHO
                                                    111055 PFAM02118 CHEMORECEPTOR. 112969 PFAM04179 TRAN


                            DUF1211      0.76                  UNKNOWN FUNCTION THIS FAMILY REPRESENTS A C
                                                      115397 PFAM06736 DUF1211 . ARCHAEA. PROTEINS.
                            DUF1240      0.70                  UNKNOWN FUNCTION THIS FAMILY CONSISTS A NUMB
                                                      115490 PFAM06836 DUF1240 . PESTIS. UNKNOWN.

                            DUF1656     0.39                   UNKNOWN FUNCTION THIS FAMILY PROTEINS. 113224
                                                      116481 PFAM07869 DUF1656 . HYPOTHETICAL. CONTAINS BACTE
                            DUF402      0.73                   UNKNOWN FUNCTION 0.067
                                                                        AP2Ec       FAMILY MEMBER FOMD
                                                      112957 PFAM04167 DUF402 . WEDMORENSIS. UNKNOWN. IS A FR
                            YfhO        0.024                  YFHO BACTERIAL MEMBRANE THIS IS A CONSERVED
                                                                        B561        0.14
                                                      118122 PFAM09586 YFHO. PROTEIN. TWO-COMPONENT SYSTEM
                                        0
                            Lyase_catalyt .072                 LYASE_CATALYT LYASE MEMBERS THIS FAMILY ARE P
                                                                        CASc        0.19
                                                      117653 PFAM09093 CATALYTIC. ALPHA-HELICES TURNS. HAIRPIN
                            DUF443      0.068                  UNKNOWN FUNCTION 0.28
                                                                        FBD         FAMILY UNCHARACTERISED AG
                                                      113062 PFAM04276 DUF443 . PROTEINS. 113418 PFAM04647 B. RN
                            DHC_N2      0.055                  DYNEIN DHC_N2 N-TERMINAL 2. MICROTUBULES. C-T
                                                                        Glyco_18    REGION DYNEINS ARE DESCRIB
                                                      116973 PFAM08393HEAVY CHAIN 0.054
                                        0.10
                            Pox_VERT_large                     POX_VERT_LARGE POXVIRUS EARLY TRANSCRIPTION
                                                                        HTTM        0.095
                                                      113220 PFAM04441 SUBUNIT. VITRO. PROMOTERS. 82 70 109650
                            7TM_GPCR_Srv0.16                   SERPENTINE TYPE GPCR CHEMORECEPTOR CHEMOR
                                                                        HTTM        0.28
                                                      118844 PFAM10323 7TM_GPCR_SRV 7TM SRV. SEVEN-TRANSMEM
                            DUF637      0.30                   POSSIBLE IB
                                                                         HEMAGGLUTININ THIS FAMILY REPRESENT
                                                                                    0.29
                                                      113596 PFAM04830 DUF637 . HEMOLYSIN. 116015 PFAM07393 SEC
                            MatK_N      0.24                   MATK_N REGION. UNKNOWN. 109806 PFAM00763 DOM
                                                                        KISc        0.74
                                                      110795 PFAM01824 MATK TRNK AMINO TERMINAL FUNCTION THI
                            TLC         0.16                   TLC ATP ADP YFHO BACTERIAL PFAM09586 YFHO. A
                                                                        Knot1       0.063
                                                      112050 PFAM03219 TRANSPORTER. 118122MEMBRANE THIS IS PR
                            TatC        0.008                  TATC TRANSLOCASE BACTERIAL TAT SYSTEM HAS A
                                                                        LIM         0.13
                                                      109939 PFAM00902 SEC-INDEPENDENT . MEMBRANE. PH-DRIVEN
                            KAP         0.77                   KAP THIS FAMILY CONSISTS SEVERAL EUKARYOTIC K
                                                                        LMWPc       0.11
                                                      114526 PFAM05804 KINESIN-ASSOCIATED . PROTEINS. TRACKS.
                            MreD        0.18                   MRED ROD MUREIN FORMATION D IS ROD-SHAPED. 1
                                                                        NUC         0.30
                                                      112889 PFAM04093 SHAPE-DETERMINING MRED.INVOLVED IN SH
                            YMF19       0.33                   PLANT ATP SYNTHASE F-ATPASES CORRESPONDS T
                                                                        PI3K_C2     0.18
                                                      111240 PFAM02326 YMF19 F0. 8 F0THIS FAMILY 3.6.1.34 .
                                                                        PLAc        0.15
                                                                        PP2Ac       0.37
                         protein binding 0.10
Caenorhabditis elegans - 0.4 DUF618                            UNKNOWN FUNCTION 0.012 FAMILY REPRESENTS A C
                                                                        PRP         THIS
                                                      113584 PFAM04818 DUF618 DUF618. PROTEINS. 116286 PFAM076
                               Ndc1_Nup 0.033                        NUCLEOPORIN IS A NDC1-NUP. NDC1 BODY. N-TERMI
                                                                                PSN           0.076
                                                         118067 PFAM09531 NDC1_NUP THAT COMPONENT NUCLEAR POR
                               DUF2410      0.17                     HYPOTHETICAL THIS IS A KNOWN.THERE TGR. 11630
                                                                                PSN           0.46
                                                         118828 PFAM10307 DUF2410 . FUNGI.FAMILY PROTEINS CONSERV
                               DUF2206      0.008                    MEMBRANE THIS . FUNCTION. 112889 PFAM04093 SHA
                                                                                PTX           0.18
                                                         118500 PFAM09971 DUF2206DOMAIN FOUND IN VARIOUS HYPOTH
                               Baculo_Y1420.014                      BACULOVIRUS ALPHA 0.43 PROTEIN. 114698 PFAM05
                                                                                RGS           BETA
                                                         113677 PFAM04913 BACULO_Y142 Y142HYDROLASE UNKNOWN F
                               Pox_E2       0.27                     POXVIRUSRL11IS ENCODED BY POX VIRUSES 117839 PFA
                                                                                              0.61
                                                         113273 PFAM04497 POX_E2 E2 PROTEIN. UNKNOWN.ITS FUNCTIO
                                            0.72
                               ER_lumen_recept                       ER_LUMEN_RECEPT 111403 PFAM02500 N-TERMINUS.
                                                                                S_TKc         0.13
                                                         109850 PFAM00810 RECEPTOR. ER LUMEN RETAINING DNA_PACK
                               7TM_GPCR_Srw 0.005                    SERPENTINE TYPE GPCR 7TM SRW. SEVEN-TRANSME
                                                                                TLC           0.090
                                                         118845 PFAM10324 7TM_GPCR_SRWCHEMORECEPTOR CHEMOR
                          0.16 Ndc1_Nup 0.015            118067 PFAM09531 NDC1_NUP THAT COMPONENT NUCLEAR POR
                                                                     NUCLEOPORIN - A NDC1-NUP. NDC1 BODY. N-TERMI
                                                                                TLC           0.38
spore germination protein GerKA - Bacillus anthracis str. Ames - molecular_function ISasexual sporulation
                               Prominin     0.43                     PROMININ VWC
                                                                                PROMININS0.003 AN EMERGING FAMILY PRO
                                                                                               ARE
                                                         114214 PFAM05478 PROMININ. TOPOLOGY. -LIKE 1 PROML1 N-TE
                        0.011 zf-CCHC       0.020
CG3800 - Drosophila melanogaster - nucleic acid binding              ZINC KNUCKLE IS KNUCKLE. CX2CX4HX4C ACID. . HIV
                                                                                ZnF_C2HC 0.003
                                                         109166 PFAM00098 ZF-CCHCA BINDING MOTIF COMPOSED FOLL
                        9E-26 FtsX          4E-010
zgc:100957 - Danio rerio - cellular_component                        FTSX THISOSTEO
                                                                                 IS A FAMILY PERMEASES HYPOTHETICAL T
                                                                                              7E-006
                                                         111573 PFAM02687 PERMEASE. PROTEINS. LIPOPROTEIN-RELEA
                         (see DUF2076       8E-010       118379 PFAM09849 DUF2076 . FUNCTION. LIGAND-BINDING PROT
                                                                     a PP1c-related ser/thr CONSERVED IN BACTERIA - Sacc
                                                                                OSTEO         7E-007
Functionally redundant8E-13also SIS2) inhibitory subunit of Ppz1p, UNCHARACTERIZED protein phosphatase Z isoformTHIS D
                                            0.070
                               TRAM_LAG1_CLN8                        TLC UNKNOWN FUNCTION DOMAIN. 115843 PFAM072
                                                                                VWC           0.34
                                                         112603 PFAM03798 TRAM_LAG1_CLN8THIS FAMILY CONSISTS SE
                           ABC transporter, permease protein - Campylobacter7TM_GPCR_SRZ 7TM SRZ. SEVEN-TRANSMEM
capsular polysaccharide0.21 7TM_GPCR_Srz    8E-005                   SERPENTINE TYPE GPCR CHEMORECEPTOR ATPase
                                                                                PSN           0.002
                                                         118846 PFAM10325 jejuni RM1221 - transport - membrane -CHEMOR
                          0.05 XK-related 0.040          118346 PFAM09815 XK-RELATED 0.27 factor activity
                                                                     DNA-dependent - FAMILY COMPRISE VARIOUS PROTEIN
                                                                                 THIS transcription
Candida albicans - filamentous growth - regulation of transcription, MEMBERS Amb_all          PROTEIN. SODIUM-DEPENDENT
                          Homo sapiens - protein
                                            1E-004        - blood coagulation extracellular region - plasma membrane - platelet
                                                                     SERPENTINE TYPE GPCR 7TM SRU. SEVEN-TRANSME
                                                                                PSN           3E-004
Coagulation factor VIII - 0.16 7TM_GPCR_Sru binding118843 PFAM10322-7TM_GPCR_SRU CHEMORECEPTOR CHEMOR
                          0.29 TatC         4E-006       sapiens - ATP binding - lipid transport - cellular homeostasis - integral t
                                                                     TATC TRANSLOCASE BACTERIAL TAT SYSTEM HAS A
                                                                                PSN           0.004
ATP-binding cassette sub-family A member 12 - Homo 109939 PFAM00902 SEC-INDEPENDENT . MEMBRANE. PH-DRIVEN
                        0.001 Acyl_transf_3 9E-006       110734 PFAM01757 ACYL_TRANSF_3 FAMILY. ENZYMES. 300 LON
                                                                     ACYLTRANSFERASE -0.012
                                                                                PSN            nucleus - cytosol
sequenceorphan - Schizosaccharomyces pombe - biological_process - molecular_functionTHIS FAMILY INCLUDES A RANGE
                               7TM_GPCR_Srz 7E-005                   SERPENTINE TYPE GPCR CHEMORECEPTOR CHEMOR
                                                                                PSN           0.12
                                                         118846 PFAM10325 7TM_GPCR_SRZ 7TM SRZ. SEVEN-TRANSMEM
                          - protein binding 4E-004
Caenorhabditis elegans 0.21 MBOAT                                    MBOAT MEMBRANE BOUND TRANSFERASE FAMILY PR
                                                                                PSN           0.001
                                                         111904 PFAM03062 FAMILY. O-ACYL ENZYMES. RESIDUE. 118844
                          0.44 7TM_GPCR_Srz 0.022         - neurotransmitter secretion - synaptic 7TM SRZ. SEVEN-TRANSMEM
                                                                     SERPENTINE TYPE GPCR CHEMORECEPTOR CHEMOR
                                                                                NGN           0.062
tomosyn - Drosophila melanogaster - syntaxin-1 binding118846 PFAM10325 7TM_GPCR_SRZ vesicle priming - synaptic vesicl
                          A - Colwellia psychrerythraea 34H - molecular_function FUNCTION THIS FAMILY CONTAINS A NUMB
putative rare lipoprotein 0.16 DUF1461      0.052                    UNKNOWN - biological_process
                                                         115938 PFAM07314 DUF1461 . 200 LONG. PROTEINS. 116897 PFAM
                                            0.22
                               Glyco_transf_22                       MANNOSYLTRANSFERASE MEMBERS THIS FAMILY AR
                                                                                LITAF         0.17
                                                         112701 PFAM03901 GLYCO_TRANSF_22 ALG9-LIKE FAMILY. ENZY
                          0.41 DUF1461      0.006        - Rattus norvegicus monooxygenase activity - microsome
                                                                     UNKNOWN FUNCTION 0.054 PROTEINS. 118848 PFAM
                                                                                HintN          LONG.
cytochrome P450, family 2, subfamily c, polypeptide 22 115938 PFAM07314- DUF1461 . 200THIS FAMILY CONTAINS A NUMB
                          0.67 7TM_GPCR_Srz 0.029        118846 PFAM10325 7TM_GPCR_SRZ CHEMORECEPTOR CHEMOR
                                                                                DM5           0.18
CG31221 - Drosophila melanogaster - lipoprotein receptor activity SERPENTINE TYPE GPCR 7TM SRZ. SEVEN-TRANSMEM
                               AgrB         0.008                    AGRB ACCESSORY GENE REGULATOR ARG LOCUS CO
                                                                                TBOX          0.25
                                                         113418 PFAM04647 B. RNAIII. SYSTEM. SENSING. PROTEIN. 11884
                                        Best
                   Best                 match to
Alphanu            match to             mitochond
meric     Text     rRNA                 rial
Index     index    database   E value   sequences E value




         TRYP_SPC SERINE PROTEASE MANY THESE ARE SYNTHESISED AS INACTIVE PRECURSOR ZYMOGENS
47370 SMART00020 TRYPSIN-LIKE FORMS. RESIDUES. . 47897 SMART00605 DOMAIN.. 47917 SMART00640 GLYCO_32
         TRYP_SPC SERINE PROTEASE MANY THESE ARE SYNTHESISED AS INACTIVE 47897 SMART00605 DOMA
47370 SMART00020 TRYPSIN-LIKE FORMS. RESIDUES. . 47917 SMART00640 GLYCO_32 32PRECURSOR ZYMOGENS
         TRYP_SPC SERINE PROTEASE MANY THESE ARE SYNTHESISED AS INACTIVE PRECURSOR ZYMOGENS
47370 SMART00020 TRYPSIN-LIKE FORMS. RESIDUES. . 47391 SMART00042 C1R C1S PROTEIN. DEVELOPMENTALLY
         TRYP_SPC SERINE PROTEASE MANY THESE ARE SYNTHESISED AS INACTIVE PRECURSOR ZYMOGENS
47370 SMART00020 TRYPSIN-LIKE FORMS. RESIDUES. . 47411 SMART00063 AXIS. N-TERMINAL MOLECULES. FACTO
         TRYP_SPC SERINE PROTEASE MANY THESE ARE SYNTHESISED AS INACTIVE PRECURSOR ZYMOGENS
47370 SMART00020 TRYPSIN-LIKE FORMS. RESIDUES. . 47548 SMART00218 ZU5 ZO-1 UNC5-LIKE FUNCTION. 47677 S
         TRYP_SPC SERINE PROTEASE MANY THESE ARE SYNTHESISED AS INACTIVE PRECURSOR ZYMOGENS
47370 SMART00020 TRYPSIN-LIKE FORMS. RESIDUES. . 47907 SMART00630 47638 SMART00310 PHOSPHOTYROSINE
         TRYP_SPC SERINE PROTEASE MANY THESE ARE SYNTHESISED AS INACTIVE PRECURSOR ZYMOGENS
47370 SMART00020 TRYPSIN-LIKE FORMS. RESIDUES. . 47991 SMART00723 ADHESION-ASSOCIATED MUC4 47824 SM

         MYSC LARGE ATPASE MOLECULAR MUSCLE KINESIN. .
47571 SMART00242 MYOSIN. ATPASES. MOTOR. ACTIN. CONTRACTION CONSISTS A CYCLICAL INTERACTION BETW
         IS A CYTOKINE THAT ACTS AS GROWTH FACTOR FOR EARLY LYMPHOID CELLS BOTH MULTIFUNCTIONA
47466 SMART00127 IL7 INTERLEUKIN-7 INTERLEUKIN-9 FAMILY. IL-7 B- T-CELL LINEAGES. IL-9 UNCLEAR. . 47461 SM

         SCP FAMILY EXTRACELLULAR HUMAN GLIOMA GLIPR PLANT REPRESENT FUNCTIONAL LINKS BETWEEN
47528 SMART00198 TPX-1 AG5 PR-1 SC7 DOMAINS. PATHOGENESIS-RELATED SYSTEM. FUNCTION. . 90506 SMART0
         SCP FAMILY EXTRACELLULAR HUMAN GLIOMA GLIPR PLANT REPRESENT FUNCTIONAL LINKS BETWEEN
47528 SMART00198 TPX-1 AG5 PR-1 SC7 DOMAINS. PATHOGENESIS-RELATED SYSTEM. FUNCTION. . 47932 SMART0
         SCP FAMILY EXTRACELLULAR HUMAN GLIOMA GLIPR PLANT REPRESENT FUNCTIONAL LINKS BETWEEN
47528 SMART00198 TPX-1 AG5 PR-1 SC7 DOMAINS. PATHOGENESIS-RELATED SYSTEM. FUNCTION. . 90506 SMART0

         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS SMART00724 LAG
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47891 SMART00595 47992 WHOSE GENES MU
         LYSOZYME SUBFAMILY EUBACTERIAL ENZYMES DISTANTLY RELATED DOPAMINE-BETA-HYDROXYLASE
47396 SMART00047 LYZ2 2 LYSOZYMES. . 47940 SMART00665 B561 B-561 DOMAIN.TO EUKARYOTIC CYTOCHROME F
         KAZAL TYPE SERINE PROTEASE INHIBITORS SMART00682 G2F FIBULIN HECTC HOMOLOGOUS UBIQUIT
90503 SMART00280 FOLLISTATIN-LIKE DOMAINS. . 47954NIDOGEN DOMAIN G2 47461 SMART00119 E6-AP E3TO CARB
         KAZAL TYPE SERINE PROTEASE INHIBITORS SMART00543 MIF4G 4G EIF4G NMD2P CBP80. ALPHA-HELIC
90503 SMART00280 FOLLISTATIN-LIKE DOMAINS. . 47844MIDDLE DOMAIN EUKARYOTIC INITIATION FACTOR ALSO O

         OSTEO OSTEOPONTIN IS AN ACIDIC PHOSPHORYLATED GLYCOPROTEIN ABOUT KD WHICH ABUNDANT
47367 SMART00017 40 HYDROXYAPATITE. . 47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. 4
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES 4
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47367 SMART00017 40 HYDROXYAPATITE.MU
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES 4
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47367 SMART00017 40 HYDROXYAPATITE.MU
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES 4
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47367 SMART00017 40 HYDROXYAPATITE.MU

         TLC TRAM HOMOLOGY DOMAIN WITH AT LEAST TRANSMEMBRANE ARE ESSENTIAL FOR CERAMIDE SYN
47992 SMART00724 LAG1 CLN8 DOMAINS. 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPENDENT SYNDROME. SE
         PIPKC PHOSPHATIDYLINOSITOL PHOSPHATE KINASES TLC TRAM HOMOLOGY DOMAIN WITH AT LEAST T
47658 SMART00330 . 47992 SMART00724 LAG1 CLN8 DOMAINS. 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPEND
         DISIN HOMOLOGUES SNAKE PROTEINS. ADAMS. . 47788 SMART00482 TO INTEGRIN THEY CONTAIN A SE
47399 SMART00050 RECEPTORS. 'RGD' DISINTEGRINS INHIBIT BINDING LIGANDS47983 SMART00714 MEMBRANE-AS
         DM DOUBLESEX MOTIF 47541 SMART00211 TYPE I REGION HUMAN CONTAINS REPEATS
47629 SMART00301 DNA-BINDING .TY THYROGLOBULINREPEATS. N-TERMINAL 11 TYPE-1 HEPARIN. ARE PROPOSE

         RUN DOMAIN INVOLVED IN GTPASE SIGNALING FES BINDING APURINIC
47889 SMART00593 RAS-LIKE . 47826 SMART00525 IRON-SULPPHUR DNA- ENDO3 OR APYRIMIDINIC SITE LYASE SU
         REPEATS FOUND IN DROSOPHILA PLAC CYTOPLASMIC PHOSPHOLIPASE CATALYTIC SMART00119 E6-AP
47966 SMART00696 DM9 PROTEINS. . 47372 SMART00022 A2 PHOSPHOLIPIDS. ISOFORMS. 47461 SUBUNIT CYTOSOL
         ZNMC METALLOPROTEASE METALLOPEPTIDASES. SUBFAMILIES. ZINC-BINDING SITE. . 47550 HIGHEST
47564 SMART00235 ZINC-DEPENDENT NEUTRAL ZINC THIS ALIGNMENT REPRESENTS A SUBSET KNOWNSMART002
         LU ANTIGEN UPA RECEPTOR DOMAIN REPEATED IN PLASMINOGEN ACTIVATOR OCCURS SINGLY OTHER
47473 SMART00134 LY-6 -LIKE THREE-FOLD UROKINASE-TYPE GPI-LINKED CELL-SURFACE CD59 SGP-2 . NEUROTO
         PRP MAJOR PRION IS A COMPONENT FIBRILS IN DISEASE KURU SYNDROME BOVINE SPONGIFORM LITA
47496 SMART00157 SCRAPIE-ASSOCIATED CREUTZFELDT-JAKOB GERSTMANN-STRAUSSLER ENCEPHALOPATHY.
         TYRKC TYROSINE KINASE CATALYTIC DOMAIN PSN PRESENILIN SIGNAL PEPTIDASE FAMILY 2 ALZHEIM
47549 SMART00219 PHOSPHOTRANSFERASES. TYROSINE-SPECIFIC SUBFAMILY. . 47998 SMART00730 1ARE POLYT
         FGF ACIDIC BASIC FIBROBLAST GROWTH FACTOR MITOGENS THAT STIMULATE OR DIFFERENTIATION C
47749 SMART00442 FAMILY. ORIGIN. ACTIVITIES. .
         BHL BACTERIAL SMART00695 UBIQUITIN-SPECIFIC PROTEASES.
47719 SMART00411 . 47965 PROKARYOTIC HISTONE LIKE DOMAIN DUSP IN
         REPEAT WR1 DOMAIN APPARENTLY UNIQUE SO FAR ELEGANS. DOMAINS. 3 DOMAIN. . 47891 SMART00
47618 SMART00289TYPE WORM-SPECIFIC 1 1. CYSTEINE-RICH C.TO OFTEN APPEARS WITH KU ABOUT DOZEN WOR
         PRP MAJOR PRION IS A COMPONENT FIBRILS IN DISEASE KURU SYNDROME BOVINE SPONGIFORM DOM
47496 SMART00157 SCRAPIE-ASSOCIATED CREUTZFELDT-JAKOB GERSTMANN-STRAUSSLER ENCEPHALOPATHY.
         SAM_PNT 47940 SMART00665 B561 SUBFAMILY CYTOCHROME FERRIC REDUCTASE TRANSMEMBRANE
47580 SMART00251 . SAM POINTED DOMAIN A B-561 DOMAIN. DOPAMINE-BETA-HYDROXYLASE GLAND. RESIDUES. R



         RRM RNA 47688 SMART00361 RRM_1 47926 SMART00649 RL11 L11 L12 47927
90510 SMART00360 . RECOGNITION MOTIF RIBOSOMAL RADC ADENINE DIMETHYLASES SMART00650
         HISTONE BTP BROMODOMAIN TRANSCRIPTION FACTORS PHD DOMAIN CONTAINING PROTEINS SUBDO
47735 SMART00428 H3 . 47875 SMART00576 HISTONE-LIKE 47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUC

         DOMAIN L27 LIN-2 LIN-7 . 90506 SMART00312 P47PHOX P40PHOX. PI3K ISOFORM. 47486 SMART00147 RA
47868 SMART00569IN RECEPTOR TARGETING PROTEINS PX PHOX HOMOLOGOUS PRESENT EUKARYOTIC UNKNO
         HMG HIGH MOBILITY GROUP F-ACTIN FUNCTION. 47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATAL
47710 SMART00398 . 47635 SMART00307ILWEQ I LWEQ DOMAIN THOUGHT TO POSSESS AN BINDING PSN PRESENI
         KR KRINGLE DOMAIN NAMED AFTER A DANISH FOUND IN SEVERAL SERINE PEPTIDES. 47931 OCCUR UP
47469 SMART00130 PASTRY. ROR-LIKE RECEPTORS. 38 . PLASMINOGEN-LIKE LYSINE- PROTEASES CAN SMART006
         REPEATS NOTE THAT THESE ARE PERMUTED WITH RESPECT SMART00356 ZNF_C3H1 47853 SMART005
47648 SMART00320 WD40 DOMAIN. . 47880 SMART00582 PRE-MRNA 47683TO STRUCTURAL BLADES BETA PROPELL
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES 4
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47367 SMART00017 40 HYDROXYAPATITE.MU

         HOMOLOGUES CYTOKINES FUNCTIONS. 1 BIOLOGICAL 47807 SMART00503 BETA ARE ALSO KNOWN A
47464 SMART00125 IL1 INTERLEUKIN-1WITH VARIOUS CATABOLIN. .INTERLUEKIN ALPHAN-TERMINAL THREE-HELIX
         AMOP DOMAIN PRESENT IN OTHER PROTEINS
47991 SMART00723 ADHESION-ASSOCIATED MUC4 .
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS SMART00350 4756
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47873 SMART00574 47677 WHOSE GENES MU
         BRLZ BASIC REGION LEUCIN B-BOX BBC DOMAIN COILED COIL TO SOME REPORT. ALPHA-HELICAL. S.
47665 SMART00338 . 47806 SMART00502ZIPPER C-TERMINAL 47404 SMART00055 CIP4DOMAINS FCH FES HOMOLOG
         OSTEO OSTEOPONTIN IS AN ACIDIC PHOSPHORYLATED GLYCOPROTEIN ABOUT KD WHICH ABUNDANT
47367 SMART00017 40 HYDROXYAPATITE. . 47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. 4
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES 4
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47367 SMART00017 40 HYDROXYAPATITE.MU
         RPOLD RNA POLYMERASES D POLYMERASE SUBUNIT BACTERIAL ALPHA CHAIN G_ALPHA G PROTEINS
47937 SMART00662 DNA-DIRECTED . 47604 SMART00275 47708 SMART00396 ZNF_UBR1 N-RECOGNIN N-END UBR1P
         RRM RNA 47930 SMART00653 EIF2B_5 EIF2B EIF5 47738 SMART00431 47452 SMART00108 LER LEUCINE R
90510 SMART00360 . RECOGNITION MOTIF DOMAIN PRESENT IN TRANSLATION INITIATION FACTOR BULB-TYPE MA
         OSTEO OSTEOPONTIN IS AN ACIDIC PHOSPHORYLATED GLYCOPROTEIN ABOUT KD WHICH ABUNDANT
47367 SMART00017 40 HYDROXYAPATITE. . 47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. 4
         S_TKC SERINE THREONINE KINASES CATALYTIC DOMAIN OR KINASE GHB GLYCOPROTEIN HORMONE B
47550 SMART00220 PHOSPHOTRANSFERASES. THREONINE-SPECIFIC SUBFAMILY. . 47416 SMART00068 HOMOLOG
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES 4
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47367 SMART00017 40 HYDROXYAPATITE.MU

         EFH CALCIUM BINDING MOTIF ARE MOTIFS THAT OCCUR AT EMERGING. 12 BETWEEN DISEASE . 90484
90486 SMART00054 EF-HAND EF-HANDS CALCIUM-BINDING PAIRS. S100LEAST IN LINKS ALPHA-HELIX. IONS. STATE
         CYTOCHROME FERRIC REDUCTASE TRANSMEMBRANE RECYCLES ASCORBATE FOR GENERATION NOR
47940 SMART00665 B561 B-561 DOMAIN. DOPAMINE-BETA-HYDROXYLASE GLAND. RESIDUES. IRON-REGULATED MU
         RHO RAS HOMOLOGY SUBFAMILY SMALL GTPASES MEMBERS THIS INCLUDE RAC AS WELL RAB ARE IM
47505 SMART00174 RAS-LIKE CDC42 ISOFORMS. . 47506 SMART00175 TRAFFICKING. 47504 SMART00173 EF-TU GTP
         BRLZ BASIC REGION LEUCIN TOP4C 47806 SMART00502 B-BOX C-TERMINAL 47807 SMART00503 N-TERM
47665 SMART00338 . 47741 SMART00434ZIPPER DNA TOPOISOMERASE IV BACTERIAL GYRA PARC BBC DOMAIN CO
         REPEATS NOTE THAT THESE ARE PERMUTED WITH RESPECT TO STRUCTURAL BLADES BETA PROPELL
47648 SMART00320 WD40 DOMAIN. . 47864 SMART00564 BETA-PROPELLER PYRROLO-QUINOLINE IRE1P-LIKE DEHY
         REPEATS NOTE THAT THESE ARE PERMUTED WITH THROMBOSPONDIN-1 TGF-BETA. 47362 SMART0000
47648 SMART00320 WD40 DOMAIN. . 47539 SMART00209 TSP1 1RESPECT TO STRUCTURAL BLADES BETA PROPELL
         FAMILY DOMAIN REGION THAT P85-BINDING P110 PI3K P85 SUBUNIT. . PROTEINS ASSOCIATED PROMO
47482 SMART00143 PI3K_P85B PI3-KINASEBINDS SF_P PULMONARY SURFACTANT 47369 SMART00019 AIR-LIQUID S

         IBR IN BETWEEN RING FINGERS DOMAINS OCCURS PAIRS OG CLB CLUSTERIN BETA CHAIN ADEAMC 48
47924 SMART00647 . 47379 SMART00030 47853 SMART00552 TRNA-SPECIFIC DOUBLE-STRANDED RNA-SPECIFIC RN
         LIGANC LIGASE SMART00234 LIPID-BINDING 47940 SMART00665 B561 B-561 DOMAIN. DOPAMINE-BETA-H
47833 SMART00532 . 47563N FAMILY START IN STAR PHOSPHATIDYLCHOLINE TRANSFER DOMAIN CYTOCHROME F
         TRASH DOMAIN IN HIGH MOBILTY GROUP PROTEINS HMG ILWEQ I LWEQ THOUGHT TO POSSESS AN BIN
48013 SMART00746 METALLOCHAPERONE-LIKE . 47828 SMART00527 HMG17 HMG14 17 47635 SMART00307 F-ACTIN
         SHKT SHK TOXIN DOMAIN CYSPC THIOL PROTEASE C2 47902 SMART00611 SEC63 SEC63P BRR2P PROT
47583 SMART00254 . 47559 SMART00230 CALPAIN-LIKE FAMILY.FAMILY PEPTIDASE CALCIUM ACTIVATED NEUTRAL
         FOUND IN PAX WNT-1 47678 SMART00351 47934 SMART00658 RPOL8C 8 47652 FOR GTPASES GTPASE
47442 SMART00097 WNT1PAIRED .BOX DOMAIN RNA POLYMERASE SUBUNIT I II III RHOGAP SMART00324 GTPASE-A
         SF_P PULMONARY SURFACTANT PROTEINS ASSOCIATED PROMOTE ALVEOLAR STABILITY BY PROTEIN
47369 SMART00019 AIR-LIQUID SPACES. SP-C 35 PROTEIN. POST-TRANSLATIONALLY . 90498 SMART00238LOWERIN
         HTH_DTXR DIPHTERIA TOX . 47873 SMART00574 47454 SMART00110 C1Q DOMAIN. C1Q. 'BOUQUET' HET
47830 SMART00529 HELIX-TURN-HELIXREGULATORY ELEMENT IRON DEPENDENT REPRESSOR POX DOMAIN ASSO
         SOCS SUPPRESSORS CYTOKINE SIGNALLING VWC -DEPENDENT + -SENSITIVE ENZYMES. 47549 SMART
47582 SMART00253 . 47544 SMART00214 47467 SMART00128 2+VON WILLEBRAND FACTOR VWF TYPE C DOMAIN IPP
         HTH_MARR HELIX_TURN_HELIX MULTIPLE ANTIBIOTIC RESISTANCE BPI LBP LIPOPOLYSACCHARIDE-BIN
47674 SMART00347 . 47656 SMART00328 BPI1 N-TERMINAL PERMEABILITY-INCREASING CETP DOMAIN BACTERICID
         ARFGAP GTP-ASE ARF. ARD1 ARFS. .
47450 SMART00105 ACTIVATING PROTEINS FOR SMALL GTPASE ARF ZINC FINGERS WITH GAPS TOWARDS GAP ST
         LITAF POSSIBLE MOTIF IN TUMOR NECROSIS FACTOR PROTEINS. . KNOWN AS OTHER ANIMAL FCH FES
47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUCED PIG7 ALPHA ALSO 47404 SMART00055 CIP4 REPORT. AL
         CHITIN BINDING DOMAIN SMART00219 PHOSPHOTRANSFERASES. TYROSINE-SPECIFIC SUBFAMILY. INC
47599 SMART00270 CHTBD1 . 47549 TYRKC TYROSINE KINASE CATALYTIC POLXC DNA POLYMERASE X FAMILY 477
         ALKPPC . 47769 SMART00463 MUTS-RELATED
47443 SMART00098ALKALINE PHOSPHATASE HOMOLOGUES SMR SMALL DOMAIN
         ZN_PEPT POLXC DNA POLYMERASE X . 47986 INCLUDES VERTEBRATE DM12 FUNCTION. 47476 SMART
47908 SMART00631 DOMAIN.. 47789 SMART00483 FAMILYSMART00718 DM4_12 DM4BETA TERMINAL DEOXYNUCLEO
         BAND HOMOLOGUES ALSO KNOWN AS EZRIN RADIXIN MOESIN ERM PRESENT IN MYOSINS 47992 SMAR
47624 SMART00295 B41 4.1 DOMAINS. PHOSPHATASES. MEMBRANE-BINDING DOMAIN. FAMILY. JAKS. . TYROSINE P
         ZINC FINGER IN NUCLEAR HORMONE RECEPTORS DOMAIN UNKNOWN FUNCTION DROSOPHILA CT CYS
47711 SMART00399 ZNF_C4 C4 . 47959 SMART00688 DM7 CG15332 CG15333 CG18293 47390 SMART00041 C-TERMIN
         LAMNT LAMININ DOMAIN VI LAMININS SUCH AS NETRINS. . 47819 SMART00516 SEC14 S. SEC14P NF1 LIP
47475 SMART00136 N-TERMINAL LAMININ-RELATED UNC-6IN HOMOLOGUES A CEREVISIAE PHOSPHATIDYLINOSITO
         HTTM HORIZONTALLY TRANSFERRED TRANSMEMBRANE DOMAIN SEQUENCE ANALYSIS VITAMIN K DEP
48019 SMART00752 GAMMA-CARBOXYLASES N-TERMINUS. REGIONS. INVENTION. MEMBERS. . 47660 SMART00332
         UBQ UBIQUITIN HOMOLOGUES . 90511 SMART00387 KINASE-LIKE KINASE- B- PHYTOCHROME-LIKE REQU
47543 SMART00213 UBIQUITIN-MEDIATED PROTEOLYSIS IS INVOLVED IN REGULATED TURNOVER PROTEINS ATPA
         CALPAIN_III PSI DOMAIN SMART00423 . 47827 SMART00526 INTEGRINS HISTONE FAMILIES
47988 SMART00720 DOMAIN.. 47730FOUND IN PLEXINS SEMAPHORINS H15 1 5
         KH K HOMOLOGY DOMAIN CURRENTLY SPECIFIC TO AP ENDONUCLEASE FAMILY THESE ENDONUCLEAS
47650 SMART00322 RNA-BINDING . 47960 SMART00689 DM6 CYSTEINE-RICH DROSOPHILA. 47821 SMART00518 AP2E
         METRC METHYLTRANSFERASE CHEMOTAXIS PROTEINS METHYLATES TO FORM METHYL ESTER ZINC F
47477 SMART00138 METHYL-ACCEPTING GAMMA-GLUTAMYL RESIDUES. . 47711 SMART00399 ZNF_C4 C4
         FAMILY INHIBITS SYNTHESIS A NUMBER CYTOKINES INCLUDING TNF PRODUCED BY ACTIVATED MACRO
47519 SMART00188 IL10 INTERLEUKIN-10 IFN-GAMMA IL-2 IL-3 GM-CSF CELLS. . 47741 SMART00434 TOP4C 47960 SM
         HTH_MERR HELIX_TURN_HELIX MERCURY RESISTANCE TRYP_SPC SERINE PROTEASE MANY THESE AR
                   47370 SMART00020 TRYPSIN-LIKE FORMS. RESIDUES.
                                1E-142
47729 SMART00422 . D.melanogaster 18S rRNA, segment 1 of 3
         MUTSD DOMAIN DNA MISMATCH REPAIR MUTS FAMILY COMPLEMENT COMPONENT GLOBULAR FOUND
47894 SMART00602 VPS10 DOMAIN.. 47834 SMART00533 DNA-BINDING . 47454 SMART00110 C1Q DOMAIN. C1Q. 'BOU
         DDT DOMAIN IN SMART00227 LAS1. ACTIN. 47367 SMART00017 40 HYDROXYAPATITE. NEBU NEBULIN RE
47870 SMART00571 . 47556 DIFFERENT TRANSCRIPTION CHROMOSOME REMODELING FACTORS 47913 SMART00636
         CSP COLD SHOCK DOMAIN THAT FUNCTIONS AS A IN BACTERIA IS INVOLVED REGULATING TRANSLATIO
47684 SMART00357 RNA-BINDING RNA-CHAPERONE EUKARYOTES. SUB-FAMILY FACTOR. . 47645 SMART00317 3-9 E
         XPGN XERODERMA PIGMENTOSUM G DOMAIN IN NUCLEASES FUNCTION. 47627 SMART00299 47894 SMA
47791 SMART00485 N-REGION . 47401 SMART00052 DUF2 2 EUBACTERIA. UNKNOWN FUNCTION APPARENTLY OCC
         ETS ERYTHROBLAST TRANSFORMATION SPECIFIC 1 (ITS1); 5.8S ribosomal RNA;EGF_LAM EPIDERMAL GR
                   Candida albicans internal transcribed spacer DOMAIN VARIATION MOTIF
                                2E-034
47721 SMART00413 HELIX-TURN-HELIX . 47511 SMART00180 LAMININ-TYPE FACTOR-LIKE 47788 SMART00482 47427
         SEMA SEMAPHORIN DOMAIN 1E-141
47907 SMART00630 . D.melanogaster 18S rRNA, segment 2 of 3
         DOMAIN EIF2B_5 EIF2B EIF5 . 47449 INITIATION FACTOR ANATO ANAPHYLATOXIN HOMOLOGOUS ANAPH
47930 SMART00653PRESENT IN TRANSLATION SMART00104 C3A C4A C5A C3 C4 C5. CONTRACTION. THREE-FOLD F
         DYSFC DYSFERLIN DOMAIN UNKNOWN FUNCTION PRESENT IN YEAST PEROXISOMAL PROTEINS MYOFE
47964 SMART00694 C-TERMINAL REGION. PROTEINS. N-TERMINAL . 47525 SMART00194
         DOMAIN HMG17 MOBILTY . 47893 SMART00597 47874 SMART00575 47802 TRANSPOSASES 2 POLARISAT
47828 SMART00527IN HIGH HMG14 17GROUP PROTEINS HMG ZNF_TTF ZINC FINGER SMART00498 FH2 TRANSCRIPT
         UBQ UBIQUITIN HOMOLOGUES . 47960 SMART00689 DM6 CYSTEINE-RICH DROSOPHILA. 47999 SMART00
47543 SMART00213 UBIQUITIN-MEDIATED PROTEOLYSIS IS INVOLVED IN REGULATED TURNOVER PROTEINS REQU
         PHD ZINC 47500 SMART00164 TRE-2 BUB2P CDC16P. RAB-GAPS. GYP6 THEREBY GIVING RISE TO NOTIO
90500 SMART00249 . FINGER TBC DOMAIN IN PROBABLE WIDESPREAD PRESENT GYP7 GTP-ACTIVATOR RAB-LIKE
         DOMAIN MA3 DAP-5 EIF4G MAY PROTEINS. ALPHA-HELICAL. MIF4G "NOVEL HOMOLOGUES" . 47610 SMA
                   Drosophila melanogaster 5.8S and 2S ribosomal REGIONS SIMILAR TO DOMAINS PONTING TIBS P
                                2E-098
47845 SMART00544IN OTHER HIGHLY MA-3 CONTAIN REPEATS ORrRNA, complete sequence
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES MU
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47922 SMART00645 PEPT_C1
         PINT MOTIF IN NIP-1 TRIP-15 SUBUNITS ALSO CALLED PCI INITIATION FACTOR UNKNOWN AWS ASSOCI
47433 SMART00088 INT-6 PROTEASOMECOP9 3 DOMAIN. FUNCTION. . 47869 SMART00570 47617 SMART00288 VPS-2
         XPGN XERODERMA PIGMENTOSUM G DOMAIN partial sequence; complete genome
                   Anopheles 2E-063          Drosophila yakuba mitochondrion,
                                                          3E-092
47791 SMART00485 N-REGION .funestus 16S ribosomal RNA,IN NUCLEASES mitochondrial
         DNA TOPOISOMERASE SMART00242 GYRA PARC MYSC MOTOR. ACTIN. KINESIN. 47835 SMART00534 47
47741 SMART00434 TOP4C . 47571IV BACTERIAL MYOSIN. ATPASES. LARGE ATPASE MOLECULAR MUSCLE CONTRA
         DOMAIN MYTH4 MYOSIN-VIIA 3 MYOSINS. .
47478 SMART00139IN MYOSIN KINESIN TAILS PRESENT TWICE ALSO OTHER
         RPOLA_N RNA POLYMERASE SUBUNIT A GHB GLYCOPROTEIN HORMONE BETA CHAIN ALSO CALLED H
47938 SMART00663 N-TERMINUS . 47416 ISMART00068 HOMOLOGUES. GONADOTROPINS. TOPOLOGY.
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES 4
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47367 SMART00017 40 HYDROXYAPATITE.MU
         TBOX DOMAIN FIRST FOUND IN MICE LOCUS BRACHYURYPROTEASOME-MEDIATED UBIQUITINATED. P
                   47542 SMART00212 UBIQUITIN-CONJUGATING E2 complete sequence
                                1E-032
47732 SMART00425 . Drosophila melanogaster 5.8STand 2S ribosomal rRNA,UBCC ENZYME CATALYTIC HOMOLOGUES H
         MUTSD DOMAIN DNAmelanogasterREPAIR MUTS FAMILYrRNA, complete sequence
                   Drosophila MISMATCH 5.8S and 2S ribosomal
47834 SMART00533 DNA-BINDING .  2E-080

         DNAJ MOLECULAR CHAPERONE HOMOLOGY DOMAIN LITAF POSSIBLE MOTIF IN TUMOR NECROSIS FAC
47600 SMART00271 . 47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUCED PIG7 PROTEINS. 47363 SMART000
         CHK ABD HLH DOMAIN CONTAINING KINASES 47768 SMART00462 PHOSPHOTYROSINE-BINDING PHOSP
47884 SMART00587 ZNF_C4 . 47359 SMART00003 FAMILY.SUBFAMILY CHOLINE NH NEUROHYPOPHYSIAL HORMONE
         RASGAP GTPASE-ACTIVATOR RAS-LIKE ALPHA-HELICAL "SWITCHING" "OFF" RAS THEREBY IT INTO AN
47651 SMART00323 FOR GTPASES ALL DOMAIN THAT ACCELERATES GTPASE ACTIVITYPOSITION. STRUCTURE. . 4I
         FORMIN FH2 2 POLARISATION. RHO-GTPASES ACTIN-ASSOZIATED PROTEINS. PROLINE-RICH FH1 NUC
47802 SMART00498HOMOLOGY DOMAIN FH PROTEINS CONTROL REARRANGEMENTS ACTIN CYTOSKELETON. ESPE
         SERPIN SERINE SMART00036 INHIBITORS CNH DOMAIN FOUND IN KINASES SMART00082 C-TERMINAL 4
47438 SMART00093 . 47385 PROTEINASE NIK1-LIKE ROM1 ROM2 OBSERVATIONS. 47428MOUSE CITRON YEAST UNP
         LITAF POSSIBLE MOTIF IN TUMOR NECROSIS FACTOR PROTEINS. .
47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUCED PIG7 ALPHA ALSO KNOWN AS OTHER ANIMAL

         ADEAMC RNA ADENOSINE DEAMINASE EDITASE PSI DOMAIN . 47730 IN PLEXINS SEMAPHORINS INTEGR
47853 SMART00552 TRNA-SPECIFIC DOUBLE-STRANDED RNA-SPECIFIC FOUND SMART00423 47531 SMART00201 -LI
         TLC TRAM HOMOLOGY DOMAIN WITH AT LEAST TRANSMEMBRANE ARE ESSENTIAL FOR CERAMIDE SYN
47992 SMART00724 LAG1 CLN8 DOMAINS. 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPENDENT SYNDROME. SE
         TPR TETRATRICOPEPTIDE REPEATS PRESENT IN OR MORE COPIES CONTAIN A SMART00730 1 2 ALZHE
47377 SMART00028 4 PROTEINS. 34 SELF-ASSOCIATE "KNOBS HOLES" MECHANISM. . 47998MINIMUM AMINO ACIDS
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES 4
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47367 SMART00017 40 HYDROXYAPATITE.MU
         ANX ANNEXIN REPEATS SPRT TO HAVE ROLES IN TRANSCRIPTION CONTAINS A CONSERVED HEXXH MO
47662 SMART00335 . 47999 SMART00731 HOMOLOGUES. ELONGATION. FUNCTION. 47879 SMART00581 PROLINE-RI

         SAA SERUM AMYLOID A RESPONSE. PROTEINS. APOLIPOPROTEINS. . 47521 SMART00190 IL4_13 4 13 INT
47527 SMART00197 ACUTE-PHASE PROTEINS ARE INDUCED DURING SECONDARY AMYLOIDOSIS IS CHARACTERIS

         LPD_N LIPOPROTEIN .
47915 SMART00638 N-TERMINALDOMAIN
         ARF SMALL GTPASES FACTOR RAS HOMOLOGUES INVOLVED IN C-TERMINI ACTIVATOR PHOSPHOLIPA
47508 SMART00177 ARF-LIKE ADP-RIBOSYLATION TRANSPORT. ISOFORMS.VESICULAR PRENYLATED. N-TERMINAL
         CYCLIN DOMAIN PRESENT IN CYCLINS TFIIB RETINOBLASTOMA A HELICAL TWICE ONCE RECOGNITION
47698 SMART00385 . CELL-CYCLE CONTROL. 47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY.
         PLAC CYTOPLASMIC PHOSPHOLIPASE CATALYTIC SUBUNIT CYTOSOLIC PHOSPHOLIPASES HYDROLYSE
47372 SMART00022 A2 PHOSPHOLIPIDS. ISOFORMS. .
         EH HOMOLOGY ASN-PRO-PHE SEQUENCES. . 47737 SMART00430
90484 SMART00027 EPS15 DOMAIN PAIR EF HAND MOTIFS THAT RECOGNISE PROTEINS CONTAINING NPF HOLI LIG
         MCM MINICHROMOSOME MAINTENANCE PROTEINS SAND DOMAIN 94 109-118 IN DISHEVELLED PLECKS
47677 SMART00350 . 47587 SMART00258 47398 SMART00049 EGL-10 DOMAINS.DEP FOUND90491 SMART00132 ZINC-
         TSPN THROMBOSPONDIN CELL ADHESION DOMAIN CNH . 47385 IN KINASES MOUSE CITRON YEAST OB
47540 SMART00210 N-TERMINAL -LIKE DOMAINS. HEPARIN-BINDING FOUND SMART00036 NIK1-LIKE ROM1 ROM2UNP
         TOPEUC . 47845 SMART00544 MA3 DAP-5 EIF4G VACCINA VIRUS VARIOLA SHOPE FIBROMA TOPOISOME
47742 SMART00435 DNA TOPOISOMERASE I EUKARYOTA VMA-3 PROTEINS. ALPHA-HELICAL. MIF4G "NOVEL HOMOL

         KISC KINESIN MOTOR CATALYTIC MOLECULAR MOTORS THAT PLAY
47468 SMART00129 DOMAIN. ATPASE. MICROTUBULE-DEPENDENT DIVISION. . IMPORTANT ROLES IN INTRACELLU
         DNA TOPOISOMERASE SMART00730 GYRA PARC PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POL
                                        Drosophila melanogaster mitochondrion, complete genome
                                                      1E-120
47741 SMART00434 TOP4C . 47998IV BACTERIAL 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. 47992 SMART007
         FGF ACIDIC BASIC FIBROBLAST GROWTH FACTOR MITOGENS THAT STIMULATE
47913 SMART00636 GLYCO_18 DOMAIN.. 47749 SMART00442 FAMILY. ORIGIN. ACTIVITIES. . OR DIFFERENTIATION C
         TLC TRAM HOMOLOGY DOMAIN WITH AT LEAST TRANSMEMBRANE ARE ESSENTIAL FOR CERAMIDE SYN
47992 SMART00724 LAG1 CLN8 DOMAINS. 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPENDENT SYNDROME. SE
         PLCYC PHOSPHOLIPASE C CATALYTIC DOMAIN PART Y PHOSPHOLIPASES THESE ENZYMES CONTAIN R
47488 SMART00149 PHOSPHOINOSITIDE-SPECIFIC C. 2 BARREL-LIKE RESIDUES. PI-PLC INOSITOL-1 4 5-TRISPHOSP
         IBR IN BETWEEN RING FINGERS DOMAINS OCCURS PAIRS OG DM DOUBLESEX MOTIF TGFB TRANSFOR
47924 SMART00647 . 47629 SMART00301 DNA-BINDING 47534 SMART00204 FACTOR-BETA TGF-BETA DISULPHIDE-LI
         LITAF POSSIBLE MOTIF IN TUMOR NECROSIS FACTOR PROTEINS. . KNOWN AS OTHER ANIMAL PSN PRE
47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUCED PIG7 ALPHA ALSO 47998 SMART00730 1 2 ALZHEIMER'S
         LITAF POSSIBLE MOTIF IN TUMOR Chrysomya chloropyga PROTEINS. . KNOWN AS OTHER ANIMAL HTH_AS
                                        NECROSIS FACTOR mitochondrion, complete genome
                                                      1E-149
47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUCED PIG7 ALPHA ALSO 47671 SMART00344 47659 SMART003
         ZNF_TAZ TAZ . 47552 SMART00223 FOUR-FOLD XI. 3 PLATELETS. 1 HIGH-MOLECULAR-MASS KININOGEN
47852 SMART00551 P300ZINC FINGER PRESENT IN CBP APPLE DOMAIN REPEAT PLASMA KALLIKREIN COAGULATIO
         LITAF POSSIBLE MOTIF IN TUMOR NECROSIS FACTOR PROTEINS. . KNOWN AS OTHER ANIMAL LAMB LA
47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUCED PIG7 ALPHA ALSO 47610 SMART00281 47998 SMART007
         ZNF_ZZ DOMAIN PRESENT IN DYSTROPHIN PROTEINS ZZ APPEARS TO BIND A MISSENSE MUTATION ON
47946 SMART00672 CAP10 LIPOPOLYSACCHARIDE-MODIFYING ENZYME. . 47620 SMART00291 ZINC-BINDING CREB-
         DWA DOMAIN A SMART00724 LAG1 CLN8 DOMAINS. TRAM HOMOLOGY WITH AT LEAST TRANSMEMBRAN
47824 SMART00523 . 47992IN DWARFIN FAMILY PROTEINS TLC 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPEND
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILYchloropyga mitochondrion, complete genome WHOSE GENES MU
                                        Chrysomya ARE POLYTOPIC MEMBRANE PROTEINS
                                                      3E-012
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47679 SMART00352 PIT-OCT-UNC 47537 SMA
         GLYCOSYL HYDROLASES FAMILY PGRP ANIMAL PEPTIDOGLYCAN RECOGNITION PROTEINS ACTIVITY. T
47917 SMART00640 GLYCO_32 32 . 47970 SMART00701 T3 LYSOZYME. N-ACETYLMURAMOYL-L-ALANINE HOMOLOGO
         FBG DOMAINS FREDS DOMAIN PRESENT AT FIBRINOGEN BETA SMART00245 47933 SMART00657 RPOL4C
47517 SMART00186 FIBRINOGEN-RELATED C-TERMINI SCABROUS. . 47574 GAMMA CHAINS A VARIETY PROTEINS IN
         CALPAIN_III UBX DOMAIN PRESENT IN UBIQUITIN-REGULATORY FAF1 SHP1P. . 47389 SMART00040 CSF2
47988 SMART00720 DOMAIN.. 47502 SMART00166 PROTEINS FACTOR STIMULATES DEVELOPMENT CYTOTOXIC ACT
         CYTOCHROME FERRIC REDUCTASE TRANSMEMBRANE RECYCLES ASCORBATE IRON-REGULATED MU
                                        Ceratitis capitata complete mitochondrial RESIDUES.
                                                      1E-180
47940 SMART00665 B561 B-561 DOMAIN. DOPAMINE-BETA-HYDROXYLASE GLAND. genome FOR GENERATION NOR
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES MU
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47844 SMART00543 MIF4G 4G EIF4G NMD2P
         GLECT GALECTIN LECTIN KNOTTINS REPRESENTING PLANT LECTINS ANTIMICROBIAL PEPTIDES SMART
47605 SMART00276 GALACTOSE-BINDING . 90519 SMART00505 KNOT1 GAMMA-THIONINS DEFENSINS. 47430 PROTE
         CT CYSTINE DOMAIN KNOT-LIKE FACTOR-BETA PLATELET-DERIVED TGFBETA NERVE BONDS. NGF PD
47390 SMART00041 C-TERMINALCTCK STRUCTURES TRANSFORMING GROWTH 2 BETA-STRANDS FACTOR NON-GL
         MYSC LARGE ATPASE MOLECULAR MUSCLE KINESIN. . 47740 SMART00433 TOP2C INTERACTION BETW
                                        Ceratitis capitata complete mitochondrial A CYCLICAL
                                                      5E-041
47571 SMART00242 MYOSIN. ATPASES. MOTOR. ACTIN. CONTRACTION CONSISTS genome
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE genome
                                        Drosophila yakuba mitochondrion, complete PROTEINS WHOSE GENES MU
                                                      0.0
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47552 SMART00223 FOUR-FOLD XI. 3 PLATE
         SPRT TO HAVE ROLES IN TRANSCRIPTION CONTAINS A CONSERVED HEXXH MOTIF INDICATING METALL
47999 SMART00731 HOMOLOGUES. ELONGATION. FUNCTION. . 47525 SMART00194 47821 SMART00518 AP2EC 2 RE
         THN THAUMATIN FAMILY GATHERS PROTEINS RELATED TO PLANT INCLUDES VERY 90496 SMART00199
47535 SMART00205 PATHOGENESIS. LOCALIZATION. SWEET-TASTING PROTEIN. MECHANISM. .BASIC MEMBERS W
         CYTOCHROME FERRIC REDUCTASE TRANSMEMBRANE RECYCLES ASCORBATE FOR GENERATION NOR
                                        Drosophila melanogaster mitochondrion, RESIDUES. IRON-REGULATED MU
                                                      1E-135
47940 SMART00665 B561 B-561 DOMAIN. DOPAMINE-BETA-HYDROXYLASE GLAND. complete genome
         LIPOXYGENASE HOMOLOGY BETA BARREL DOMAIN CURRENTLY SPECIFIC TO
47636 SMART00308 LH2 2 . 47960 SMART00689 DM6 CYSTEINE-RICH DROSOPHILA.
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . MEMBRANE PROTEINS WHOSE GENES MU

         GRAN GRANULIN DOMAIN UNKNOWN FUNCTION IN OTHER
47606 SMART00277 . 47902 SMART00611 SEC63 SEC63P BRR2P PROTEINS.
         TFIIE TRANSCRIPTION INITIATION FACTOR IIE PASTA
47832 SMART00531 . 48007 SMART00740 DOMAIN..

         AAA ATPASES ASSOCIATED WITH A VARIETY CELLULAR 47409 SMART00061
47696 SMART00382 ACTIVITIES. FAMILY. N-TERMINAL ALIGNMENT. .ACTIVITIES THIS PROFILE ALIGNMENT ONLY DE



         EGF_LAM EPIDERMAL GROWTH DOMAI ZP ZONA PELLUCIDA DOMAIN PROTEINS ARE RESPONSIBLE FOR
47511 SMART00180 LAMININ-TYPE FACTOR-LIKE . 47570 SMART00241 SPERM-ADHESION PELLUCIDA. GP2 TGF-BET
         TLC TRAM HOMOLOGY DOMAIN WITH AT LEAST TRANSMEMBRANE ARE ESSENTIAL FOR CERAMIDE SYN
47992 SMART00724 LAG1 CLN8 DOMAINS. 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPENDENT SYNDROME. SE
         PBD DOMAIN SMALL DOMAINS THAT BIND OR ALSO KNOWN AS RAC INTERACTIVE BINDING CRIB LITAF P
47913 SMART00636 GLYCO_18 DOMAIN.. 47614 SMART00285 P21-RHO-BINDING CDC42P- RHO-LIKE GTPASES. CDC4

         EXONUCLEASE ZINC . 47711 SMART00399 ZNF_C4 C4 47893 SMART00597 90508 SMART00337 TRANSCRI
47781 SMART00475 53EXOC 5'-3'FINGER IN NUCLEAR HORMONE RECEPTORS ZNF_TTF TRANSPOSASES B-CELL BH

         MYSC LARGE ATPASE MOLECULAR MUSCLE KINESIN. . 47894 SMART00602 VPS10 DOMAIN.. 47712 BETW
47571 SMART00242 MYOSIN. ATPASES. MOTOR. ACTIN. CONTRACTION CONSISTS A CYCLICAL INTERACTION SMAR
         RING FINGER LIGASE ACTIVITY IS INTRINSIC TO DOMAIN LIKELY BE A GENERAL FUNCTION THIS VARIOU
47515 SMART00184 E3 UBIQUITIN-PROTEIN C-CBL E2 UBIQUITIN-CONJUGATING UBC' . 47558 SMART00229 RAS-LIKE

         GGL G GAMMA MOTIFS . 47422 HYDROPHOBINS PHD ZINC FINGER TR_FER TRANSFERRIN SPRT TO HAV
47553 SMART00224 SUBUNIT-LIKE HYDRO SMART00075 90500 SMART00249 47439 SMART00094 47999 SMART00731 H
         TR_FER . 47536 SMART00206 FAMILY. THEM. 47929 SMART00652 EIF1A 1A
47439 SMART00094TRANSFERRIN NTR TISSUE INHIBITOR METALLOPROTEINASE FORM COMPLEXES WITH METALL
         RAB SUBFAMILY SMALL GTPASES ARE IMPLICATED IN VESICLE RAS 47505 SMART00174 RAS-LIKE CDC4
47506 SMART00175 TRAFFICKING. . 47504 SMART00173 EF-TU GTPASE. P21RASSIMILAR FOLD FUNCTION TO BACTE
         TLC TRAM HOMOLOGY DOMAIN WITH AT LEAST TRANSMEMBRANE ARE ESSENTIAL FOR CERAMIDE SYN
47992 SMART00724 LAG1 CLN8 DOMAINS. 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPENDENT SYNDROME. SE
         TLC TRAM HOMOLOGY DOMAIN WITH AT LEAST TRANSMEMBRANE ARE ESSENTIAL FOR CERAMIDE SYN
47992 SMART00724 LAG1 CLN8 DOMAINS. 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPENDENT SYNDROME. SE

         LITAF POSSIBLE MOTIF IN TUMOR NECROSIS FACTOR PROTEINS. . KNOWN AS OTHER
47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUCED PIG7 ALPHA ALSO 47737 SMART00430 ANIMAL HOLI LIG
         DOMAIN SEC14 S. SEC14P NF1 . LIPID-BINDING DOMAIN. SUBUNITS. 90519 SMART00505 KNOT1 GAMMA-
47819 SMART00516IN HOMOLOGUES A CEREVISIAE PHOSPHATIDYLINOSITOL TRANSFER RHOGAPS RHOGEFS RAS

         ELONGATOR MIAB FAMILY RADICAL SAM THIS SUPERFAMILY CONTAINS MOAA NIFB PQQE COPROPORP
47997 SMART00729 ELP3 3 ELP-3. METHYLTRANSFERASES. . 47983 SMART00714 MEMBRANE-ASSOCIATED LPS-IND
         PIPKC PHOSPHATIDYLINOSITOL PHOSPHATE KINASES TGC TRANSGLUTAMINASE HOMOLOGUES TRANS
47658 SMART00330 . 47766 SMART00460 PROTEASE-LIKE PROTEINS. BONDS. EVENTS.
         HATPASE_C HISTIDINE ATPASES PHYTOCHROME-LIKE ATPASES. . 47422
90511 SMART00387 KINASE-LIKE KINASE- B- DNA GYRASE HYDRO HYDROPHOBINS SMART00075
         PROCESSING APPR-1"-P AL. PSI-BLAST & . 48000 SMART00732 FOLD. LOW-GC GRAM-POSITIVE BACTER
47810 SMART00506 A1PPENZYME FUNCTION DETERMINED BY MARTZEN ET EXTENDED FAMILY DETECTED RECIPR
         TLC TRAM HOMOLOGY DOMAIN WITH AT LEAST TRANSMEMBRANE ARE ESSENTIAL FOR CERAMIDE SYN
47992 SMART00724 LAG1 CLN8 DOMAINS. 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPENDENT SYNDROME. SE
         LITAF POSSIBLE MOTIF IN TUMOR NECROSIS FACTOR PROTEINS. . KNOWN AS OTHER ANIMAL BBOX ZI
                   Sus scrofa 28S rRNA, partial sequence
                               1E-068
47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUCED PIG7 ALPHA ALSO 47663 SMART00336 B-BOX-TYPE 478
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES MU
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47960 SMART00689 DM6 CYSTEINE-RICH DR

         LITAF POSSIBLE MOTIF IN TUMOR NECROSIS FACTOR PROTEINS. . KNOWN AS OTHER ANIMAL HTTM HO
47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUCED PIG7 ALPHA ALSO 48019 SMART00752 GAMMA-CARBOX
         ZINC FINGER PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHO
47683 SMART00356 ZNF_C3H1 . 47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. 47894 SMART
         DOMAIN SEC63 SEC63P BRR2P PROTEINS. . 47755 SMART00449 RECEPTOR. FUNCTION. HOMOLOGUES.
47902 SMART00611UNKNOWN FUNCTION IN OTHER SPRY SPLA RYANODINE DISTANT HOMOLOGUES ARE DOMAIN
         FRI FRIZZLED N-TERMINAL MELANOGASTER MEDIATES SIGNALLING THAT POLARISES A PRECURSOR C
47411 SMART00063 AXIS.DROSOPHILA MOLECULES. FACTORS. . 47910 SMART00633 GLYCO_10 10 47801 SMART004

         ZINC FINGER FRI FRIZZLED SMART00063 MELANOGASTER MOLECULES. FACTORS. 47517 SMART00186
47670 SMART00343 ZNF_C2HC . 47411 DROSOPHILAAXIS. N-TERMINALMEDIATES SIGNALLING THAT POLARISES A P



         TLC TRAM HOMOLOGY DOMAIN WITH AT LEAST TRANSMEMBRANE ARE ESSENTIAL FOR CERAMIDE SYN
47992 SMART00724 LAG1 CLN8 DOMAINS. 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPENDENT SYNDROME. SE
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES MU
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47740 SMART00433 TOP2C 47940 SMART006




         AP ENDONUCLEASE FAMILY THESE ENDONUCLEASES PLAY A ROLE IN DNA
47821 SMART00518 AP2EC 2 REPAIR. . 47935 SMART00659 47740 SMART00433 TOP2C CLEAVE PHOSPHODIESTER
         CYTOCHROME FERRIC REDUCTASE TRANSMEMBRANE RECYCLES ASCORBATE FOR GENERATION NOR
47940 SMART00665 B561 B-561 DOMAIN. DOPAMINE-BETA-HYDROXYLASE GLAND. RESIDUES. IRON-REGULATED MU
         CASC CASPASE BETA CONVERTING ENZYME ICE HOMOLOGUES CYSTEINE ASPARTASES THAT MEDIATE
47459 SMART00115 INTERLEUKIN-1 . ASPARTATE. 2 2-TETRAMER ENZYME. HOMOLOGUES. 47891 SMART00595 4785
         FBD DOMAIN IN SMART00665 B561 B-561 PLANT PROTEINS CYTOCHROME FERRIC GLAND. RESIDUES.
47877 SMART00579 . 47940FBOX BRCT CONTAINING DOMAIN. DOPAMINE-BETA-HYDROXYLASEREDUCTASE TRANSM
         DYNC DYNAMIN GTPASE LARGE GTPASES THAT MEDIATE VESICLE PARTICIPATES IN ENDOCYTIC UPTA
47913 SMART00636 GLYCO_18 DOMAIN.. 47402 SMART00053 TRAFFICKING. EVENT. . 47604 SMART00275
         HTTM HORIZONTALLY TRANSFERRED TRANSMEMBRANE DOMAIN SEQUENCE ANALYSIS VITAMIN K DEP
48019 SMART00752 GAMMA-CARBOXYLASES N-TERMINUS. REGIONS. INVENTION. MEMBERS. . 47983 SMART00714
         HTTM HORIZONTALLY TRANSFERRED TRANSMEMBRANE DOMAIN SEQUENCE ANALYSIS VITAMIN K DEP
48019 SMART00752 GAMMA-CARBOXYLASES N-TERMINUS. REGIONS. INVENTION. MEMBERS. . 47985 SMART00717
         IB INSULIN GROWTH HOMOLOGUES HIGH AFFINITY . 47819 SMART00516 SEC14 S. SEC14P NF1 LIPID-BIN
47463 SMART00121 FACTOR-BINDING INSULIN-LIKE FACTORS. BINDING PARTNERS DOMAIN IN A CEREVISIAE PHOS
         KISC KINESIN MOTOR CATALYTIC MOLECULAR MOTORS THAT PLAY
47468 SMART00129 DOMAIN. ATPASE. MICROTUBULE-DEPENDENT DIVISION. . IMPORTANT ROLES IN INTRACELLU
         KNOTTINS REPRESENTING PLANT DEFENSINS. . 47998 SMART00730 1 PROTEINASE AMYLASE INHIBITO
90519 SMART00505 KNOT1 GAMMA-THIONINSLECTINS ANTIMICROBIAL PEPTIDES 2 ALZHEIMER'S DISEASE. CATALY
         LIM DOMAIN PRESENT LIN-11 ISL-1 MEC-3. FAMILY. TYROSINE-CONTAINING MOTIFS. PATHWAYS. . 4737
90491 SMART00132 ZINC-BINDINGIN SOME DOMAINS BIND PARTNERS VIA ARE FOUND MANY KEY REGULATORS DE
         LMWPC LOW MOLECULAR WEIGHT PHOSPHATASE FAMILY DCX TUBULIN. X-LINKED DEFECTS. 47870 SM
47555 SMART00226 . 90521 SMART00537 TANDEMLY-REPEATED PRODUCT. DOMAIN IN DOUBLECORTIN GENE PROD
         NUC DNA RNA ENDONUCLEASE PROKARYOTIC EUKARYOTIC ENDONUCLEASES ALSO PRESENT IN PHOS
47783 SMART00477 NON-SPECIFIC DOUBLE- SINGLE-STRANDED . 47559 SMART00230 CALPAIN-LIKE FAMILY. C2 478
         PHOSPHOINOSITIDE REGION POSTULATED TO CONTAIN DOMAIN OUTLIER METRC METHYLTRANSFERA
47481 SMART00142 PI3K_C2 3-KINASE C2 FAMILY. . 47477 SMART00138 METHYL-ACCEPTING GAMMA-GLUTAMYL RE
         PLAC CYTOPLASMIC PHOSPHOLIPASE CATALYTIC SUBUNIT CYTOSOLIC PHOSPHOLIPASES HYDROLYSE
47372 SMART00022 A2 PHOSPHOLIPIDS. ISOFORMS. . 47859 SMART00559 KU78 KU70 KU80 70KDA 80KDA DNA- ATP-
         PHOSPHATASE 2A DOMAIN. PP1 PP2A PP2B MEMBERS. . 47932 SMART00656 DOMAIN..
47495 SMART00156 PP2ACHOMOLOGUES CATALYTIC LARGE FAMILY SERINE THREONINE PHOSPHATASES THAT IN
         PRP MAJOR PRION IS A COMPONENT FIBRILS IN DISEASE KURU SYNDROME BOVINE SPONGIFORM RAS
47496 SMART00157 SCRAPIE-ASSOCIATED CREUTZFELDT-JAKOB GERSTMANN-STRAUSSLER ENCEPHALOPATHY.
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES MU
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 48008 SMART00741 SURFACTANT-ASSOCIAT
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES MU
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47517 SMART00186 FIBRINOGEN-RELATED C
         PTX PENTRAXIN PENTAXIN FAMILY CALCIUM-MEDIATED LIGAND-BINDING. . 48019 SMART00752 GAMMA-
47497 SMART00159 C-REACTIVE STRUCTURE. THIS FORM A DOSCOID PENTAMERIC HUMAN SERUM AMYLOID P DE
         RGS REGULATOR G SIGNALLING DOMAIN FAMILY MEMBERS ARE PROTEINS FOR HETEROTRIMERIC
47643 SMART00315 GTPASE-ACTIVATING G-PROTEIN ALPHA-SUBUNITS. .
         RIBOSOMAL PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOS
47926 SMART00649 RL11 L11 L12 . 47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. 47435 SMA
         S_TKC SERINE THREONINE KINASES CATALYTIC DOMAIN OR KINASE CY 47392 SMART00043 CYSTATIN-
47550 SMART00220 PHOSPHOTRANSFERASES. THREONINE-SPECIFIC SUBFAMILY. .CYSTATINS ARE A FAMILY CYS
         TLC TRAM HOMOLOGY DOMAIN WITH AT LEAST TRANSMEMBRANE ARE ESSENTIAL FOR CERAMIDE SYN
47992 SMART00724 LAG1 CLN8 DOMAINS. 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPENDENT SYNDROME. SE
         TLC TRAM HOMOLOGY DOMAIN WITH AT LEAST TRANSMEMBRANE ARE ESSENTIAL FOR CERAMIDE SYN
47992 SMART00724 LAG1 CLN8 DOMAINS. 5 ALPHA-HELICES. LAG1P LAC1P ACYL-COA-DEPENDENT SYNDROME. SE
         VWC VON WILLEBRAND FACTOR VWF TYPE C DOMAIN RICIN FORMED FROM PRESUMED GENE POLBC D
47544 SMART00214 . 47764 SMART00458 RICIN-TYPE BETA-TREFOIL CARBOHYDRATE-BINDING TRIPLICATION. 4779
         ZINC FINGER S_TKC 47550 SMART00220 KINASES CATALYTIC DOMAIN OR KINASE
47670 SMART00343 ZNF_C2HC .SERINE THREONINE PHOSPHOTRANSFERASES. THREONINE-SPECIFIC SUBFAMILY.
         OSTEO OSTEOPONTIN IS AN ACIDIC PHOSPHORYLATED GLYCOPROTEIN ABOUT KD WHICH ABUNDANT
47367 SMART00017 40 HYDROXYAPATITE. . 47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. 4
         OSTEO OSTEOPONTIN IS AN ACIDIC PHOSPHORYLATED GLYCOPROTEIN ABOUT KD WHICH PIG7 PROT
47367 SMART00017 40 HYDROXYAPATITE. . 47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUCEDABUNDANT
         VWC VON WILLEBRAND FACTOR MOTIF. AMINOACYL-TRNA
47544 SMART00214 . 47777 SMART00471 'HD'VWF TYPE C DOMAIN HDC METAL DEPENDENT PHOSPHOHYDROLASES
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES MU
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 48019 SMART00752 GAMMA-CARBOXYLASES
         AMB_ALL GRAN GRANULIN HTTM HORIZONTALLY TRANSFERRED TRANSMEMBRANE DOMAIN SEQUENC
47932 SMART00656 DOMAIN.. 47606 SMART00277 . 48019 SMART00752 GAMMA-CARBOXYLASES N-TERMINUS. REGI
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES MU
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 48019 SMART00752 GAMMA-CARBOXYLASES
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS CLN8 DOMAINS. 5
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47992 SMART00724 LAG1 WHOSE GENES MU
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS CLN8 DOMAINS. 5
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47992 SMART00724 LAG1 WHOSE GENES MU
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS WHOSE GENES MU
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47597 SMART00268 HSP70 47983 SMART007
         PSN PRESENILIN SIGNAL PEPTIDASE FAMILY ARE POLYTOPIC MEMBRANE PROTEINS CLN8 DOMAINS. 5
47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. . 47992 SMART00724 LAG1 WHOSE GENES MU
         NGN IN THIS DOMAIN MAY CONFER AFFINITY FOR IT POSSESSES A ZINC FINGER NUCLEAR HORMONE R
48005 SMART00738 SPT5P SPT4P. RNP-LIKE FOLD. SPT4P.SPT4P . 47711 SMART00399 ZNF_C4 C4 47983 SMART0071

         LITAF POSSIBLE MOTIF IN TUMOR NECROSIS FACTOR PROTEINS. . KNOWN AS OTHER ANIMAL RING FIN
47983 SMART00714 MEMBRANE-ASSOCIATED LPS-INDUCED PIG7 ALPHA ALSO 47515 SMART00184 E3 UBIQUITIN-PR
         HINTN HINT HEDGEHOG INTEIN DOMAIN REGION HAS
47634 SMART00306 N-TERMINAL REGION. ENDONUCLEASES. . BEEN SPLIT TO ACCOMMODATE LARGE INSERTIO
         DOMAIN DM5 DROSOPHILA. . 47998 SMART00730 1 2 ALZHEIMER'S DISEASE. CATALYSIS. ACTIVITY. 4760
47961 SMART00690UNKNOWN FUNCTION CURRENTLY PECULIAR TO PSN PRESENILIN SIGNAL PEPTIDASE FAMILY
         TBOX DOMAIN FIRST FOUND IN MICE T LOCUS BRACHYURY
47732 SMART00425 .

								
To top