Docstoc

Contoh Format Resume Panduan Penggunaan Aplikasi

Document Sample
Contoh Format Resume Panduan Penggunaan Aplikasi Powered By Docstoc
					Panduan Penggunaan Aplikasi Paralel Melalui
inGRID Grid Portal
                                                                                                                       v0.3


DAFTAR ISI

I. Aplikasi mpiBLAST....................................................................................................... 1
   A. Sekilas Mengenai mpiBLAST.....................................................................................1
   B. Penggunaan mpiBLAST.............................................................................................. 2
   C. Rangkuman Ringkas Penggunaan mpiBLAST............................................................5
   D. Informasi Lebih Lanjut................................................................................................7
II. Aplikasi GROMACS.................................................................................................... 8
   A. Sekilas Mengenai GROMACS....................................................................................8
   B. Petunjuk Penggunaan GROMACS..............................................................................8
   C. Rangkuman Ringkas Penggunaan GROMACS...........................................................8
   D. Informasi Lebih Lanjut..............................................................................................12
III. Apikasi MPI-POV-Ray............................................................................................. 13
   A. Sekilas Mengenai POV-Ray......................................................................................13
   B. Penggunaan MPI-POV-Ray.......................................................................................13
   C. Rangkuman Ringkas Penggunaan MPI-POV-Ray.................................................... 15
   D. Informasi Lebih Lanjut..............................................................................................17




I.Aplikasi mpiBLAST
A.Sekilas Mengenai mpiBLAST

mpiBLAST merupakan sebuah versi paralel dari algoritma BLAST (Basic Local
Alignment Search Tool) yang dikembangkan oleh National Center for Biotechnology
Information (NCBI) yang mampu memanfaatkan pengeksekusian di banyak simpul
komputer. Algoritma BLAST ini akan membantu pengguna dalam pencarian kemiripan
antara input rantai protein dengan basis data rantai protein yang tersedia untuk keperluan
analisis bioinformatik (proses pencarian ini sering disebut querying).

Ada dua keuntungan penggunaan mpiBLAST jika dibandingkan dengan BLAST
tradisional. Pertama, mpiBLAST akan membagi basis data rantai protein menjadi
beberapa segmen untuk masing-masing simpul komputer. Hal ini dapat memotong waktu
eksekusi I/O yang berdampak pada penambahan kecepatan. Kedua, mpiBLAST
menggunakan teknik komunikasi antar-prosesor sehingga memungkinkan bekerja secara
paralel.




                                                             1
B.Penggunaan mpiBLAST

Sub-bab ini akan menjabarkan langkah-langkah penggunaan mpiBLAST melalui I-GRID
Grid Portal Universitas Indonesia:

   1. Sebelum memulai penggunaan mpiBLAST, dibutuhkan berkas input rantai protein
      (dapat berupa asam nukleotida ataupun asam peptida) di dalam direktori /home
      Anda. Cara mengetahuinya adalah dengan memilih tab Data Manager pada
      tampilan antarmuka I-GRID Grid Portal lalu pada drop-down menu pilih riset-
      c-3208-50.riset.ui.ac.id sebagai direktori layanan home Anda.
      Gambar 1 memperlihatkan isi direktori /home seorang pengguna setelah menekan
      tombol ‘Go’ sebelumnya.




                          Gambar 1 Tampilan isi direktori /home


      Format FASTA

      Berkas input rantai protein tersebut harus berformat FASTA (*.fasta) dan dibagi
      berdasarkan jenis rantai protein yaitu: rantai protein asam nukleotida dan rantai
      protein asam peptide. Berikut ini diperlihatkan contoh penulisan rantai protein
      asam nukleotida (dapat Anda temukan dalam direktori
      /home/xxx/sample1.fasta):

      >lclBOB1ONE
      CATGGATTCAGCAGCAGCGAACTCGCCAATGTAGTGGGTGGCACAGCCAG
      GGTCTTGACTCTGGCTCTGCAGTAGCACAGTCTGGAAAAGCTCTGAGGGG
      AGAGAGACCCCCACTGGTCCGAGGGTCTGGCACAGAGCCAGAAATGGGGG
      GGAAGGTATGAGGCTGGGTCGCCTCTGACCTCTCAGGTACCATCCAGGAG
      GCCCTGGCCTCTCACTGAACCCGGCCACTCCTCTTTGGCATGGCCTCTTC




                                           2
   Dan contoh lainnya berupa penulisan rantai protein asam peptida (dapat Anda
   temukan dalam direktori /home/xxx/sample2.fasta):

   >gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
   LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
   EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
   LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
   GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
   IENY


   Perbedaan keduanya terletak pada penulisan kode dan arti yang mengikutinya.
   Informasi lebih lanjut dapat Anda baca di
   http://en.wikipedia.org/wiki/FASTA_format.

2. Selanjutnya pilih tab Job Services  User Applications yang akan
   menampilkan daftar dari user application yang telah kami persiapkan sebelumnya.
   Pilih mpiblast-sample1 dimana akan memunculkan tampilan seperti Gambar
   2. Di dalam user application ini, sudah diatur pengisiannya sehingga Anda dapat
   langsung ‘Submit Job’ ke layanan Grid. Atau Anda dapat pula mengganti atau
   menambahkan opsi-opsi lain pada isian Arguments, Number of Processors,
   Maximum Memory (MB), Maximum Time (in minutes) untuk keperluan
   pengetesan. Opsi-opsi yang ditawarkan untuk pengisian isian Arguments dapat
   Anda simak pada penjelasan selanjutnya dari sub-bab ini (merujuk penggunaan
   Tabel 1 dan Tabel 2 halaman 5).

     PENTING UNTUK DIPERHATIKAN!
     • Semua isian dapat diubah/ditambah kecuali isian Executable yang harus
       menunjuk pada berkas binari mpiblast yang terdapat pada
       /export/bin/mpiblast.
     • Sampai saat ini besar Number of Processors yang dapat diisi maksimum
       hanya lima karena keterbatasan sumber daya.




                                      3
         Gambar 2 Tampilan Antarmuka dari ‘User Applications’ untuk mpiBLAST


3. Setelah pekerjaan berhasil submit, Anda dapat memonitor status pekerjaan
   tersebut dengan memilih di Job Status, masih di tab yang sama (Job
   Services) seperti yang tampak pada Gambar 3.




            Gambar 3 Tampilan Antarmuka untuk Memonitor Status Pekerjaan


4. Apabila tidak terdapat kesalahan dan status pekerjaan Done maka akan diperoleh
   berkas output di dalam direktori /home Anda. Untuk contoh awal mpiblast-
   sample1, Anda akan memperoleh berkas result1.txt yang dapat dilihat di



                                         4
       Data Manager. Pilih berkas result1.txt, kemudian pilih Edit untuk
       memperlihatkan isi berkas tersebut seperti pada Gambar 4.




                    Gambar 4 Tampilan Isi Berkas Output result1.txt



C.Rangkuman Ringkas Penggunaan mpiBLAST

Untuk membantu pemahaman Anda mengenai penggunaan mpiBLAST akan diberikan
penjelasan lebih detail mengenai pengerjaan mpiblast memakai baris perintah
konvensional dalam lingkungan UNIX.

Berikut ini adalah contoh baris perintah penggunaan mpiBLAST secara umum:

 mpirun -np 6 mpiblast -p blastn -d nt -i sample1.fasta –o results1.txt

Baris perintah di atas mengartikan pengeksekusian proses query terhadap rantai protein
nukleotida di dalam berkas sample1.fasta dengan rantai protein nukleotida di dalam
basis data nt, tanpa dilakukan translasi (karena memakai operasi blastn). Untuk
perhitungan banyak simpul digunakan rumus: yy + 2, dimana yy adalah banyak simpul
komputer yang dijadikan sebagai pekerja, ditambah satu untuk proses output dan
ditambah satu lagi untuk proses scheduler. Jadi dalam contoh baris perintah di atas
menandakan bahwa hanya dipakai 4 simpul komputer sebagai pekerja. Dan terakhir, hasil


                                          5
query akan ditulis ke dalam berkas results1.txt. Rangkuman fungsi opsi-opsi tadi
ditunjukkan oleh Tabel 1 berikut ini.

Tabel 1 Opsi-Opsi Umum mpiblast

            Opsi                                                 Deskripsi
-p= [blastn|tblastn|          Nama metode pencarian yang akan digunakan dalam
blastx| blastp|tblastx]       mpiBLAST.
                                  Pencarian      Jenis Input       Jenis Basis Data            Translasi
                                  blastn         Nukleotida           Nukleotida       -
                                  tblastn           Peptida           Nukleotida       Basis Data
                                  blastx         Nukleotida             Peptida        Input
                                  blastp            Peptida             Peptida        -
                                  tblastx        Nukleotida           Nukleotida       Input dan Basis Data
                               (Sumber: The Design, Implementation, and Evaluation of mpiBLAST. Aaron E, et. al.)

-d=<database_name>            Nama basis data yang digunakan sebagai referensi pencarian
                              (query).
-i=<filename>                 Nama berkas input (dalam format FASTA).
-o=<filename>                 Nama berkas output.

Ada beberapa opsi lagi yang dapat ditambahkan pada mpiblast seperti yang disajikan
dalam Tabel 2 berikut.

Tabel 2 Opsi-Opsi Tambahan mpiblast

            Opsi                                                 Deskripsi
--debug[=filename]            Menghasilkan output pesan proses (verbose) masing-masing
                              simpul, secara opsional dapat dicatat ke dalam suatu berkas.
--scheduler-rank=<number>     Mengatur ranking proses scheduler (berawal nilai 1). Opsi ini
                              berguna untuk mendesak proses scheduler bekerja di mesin
                              yang sama dengan mesin pekerja (rank 0).
--altschul-reference          Mencetak laporan berdasarkan standard NCBI-BLAST.
--removedb                    Menghapus data lokal yang dipakai pada masing-masing simpul
                              ketika pekerjaan selesai tereksekusi.
--copy-via=[cp|rcp|scp|       Mengatur metode penyalinan data yang digunakan di tiap
mpi|none]                     simpul komputer. Default = ‘cp’
--concurrent=                 Mengatur banyak pengaksesan yang bersamaan terhadap shared
                              storage. Default bernilai 1.
--mpi-size=                   Mengatur ukuran maksimum buffer untuk keperluan transfer
                              data oleh MPI. Default bernilai 65536 bytes.
--lock[=on|off]               Mengatur mekanisme penguncian berkas (file-locking) untuk
                              pengaturan daftar berkas segmentasi. Default bernilai off, dan
                              apabila --concurrent > 1 maka secara otomatis bernilai
                              on.
--disable-mpi-db              Apabila digunakan, komputer pekerja akan menggunakan basis


                                                6
                             data pada shared storage untuk pencarian. Hal ini dapat
                             menimbulkan overhead untuk pencarian ‘blastn’.
--nice=<number>              Mengatur nilai nice untuk pengaturan prioritas proses dalam
                             UNIX. Baca di manual man nice untuk keterangan lebih
                             lanjut.
--resume-run                 Apabila digunakan, mpiblast akan membaca dari berkas
                             output dan meneruskan pengerjaan yang sebelumnya tertunda.
                             Opsi ini masih dalam tahap percobaan.
--version                    Mencetak versi mpiBLAST.


D.Informasi Lebih Lanjut

Berikut ini beberapa URL artikel relevan yang dapat Anda baca melalui Internet.
• http://en.wikipedia.org/wiki/BLAST - Artikel tentang algoritma BLAST.
• http://en.wikipedia.org/wiki/FASTA - Artikel tentang algoritma FASTA.
• http://en.wikipedia.org/wiki/FASTA_format - Artikel tentang format FASTA yang
   dipakai dalam algoritma FASTA.
• http://mpiblast.lanl.gov - Situs resmi Opend-Source mpiBLAST
• ftp://ftp.ncbi.nlm.nih.gov/blast/db - Kumpulan resource basis data BLAST berupa
   rantai protein yang selalu ter-update setiap harinya.




                                           7
II.Aplikasi GROMACS
A.Sekilas Mengenai GROMACS

Groningen Machine for Chemical Simulations atau disingkat GROMACS merupakan
suatu program simulasi Molecular Dynamics (MD) yang dirintis oleh Universitas
Groningen. MD sendiri merupakan suatu kaedah untuk mengkaji pergerakan suatu sistem
molekul sesuai hukum fisika dengan berbagai metodologi numerik. Secara umum,
GROMACS akan mensimulasikan suatu persamaan pergerakan Newton terhadap suatu
sistem yang mengandung ratusan hingga jutaan molekul. Program simulasi ini digunakan
dalam bidang biokimia dan non-biologi seperti penelitian polimer.


B.Petunjuk Penggunaan GROMACS

Sub-bab ini akan menjabarkan langkah-langkah penggunaan‡ GROMACS melalui I-
GRID Grid Portal Universitas Indonesia:

    1. Sebelum memulai penggunaan GROMACS, dibutuhkan berkas input yang
       menunjukkan topologi, parameter, koordinat dan kecepatan sistem di dalam
       direktori /home Anda (umumnya memakai ekstensi .tpr, contoh:
       cpeptide.tpr).

    2. Selanjutnya pilih tab Job Services  User Applications kemudian klik di
       mpigromacs-sample untuk memunculkan tampilan Gambar 6. Sama seperti
       user application sebelumnya dimana pengisiannya sudah diatur sedemikian rupa
       sehingga Anda dapat langsung ‘Submit Job’ ke layanan Grid; atau Anda dapat
       mengganti atau menambahkan opsi-opsi lain.

    3. Setelah pekerjaan berhasil submit, Anda dapat memonitor status pekerjaan
       tersebut dengan memilih di Job Status seperti yang tampak pada Gambar 7.

    4. Apabila tidak ada kesalahan dan status pekerjaan Done maka akan diperoleh
       berkas output trayektori (.trr) di dalam direktori /home Anda. Pada contoh awal
       mpigromacs-sample, Anda akan memperoleh berkas cpeptide.trr yang
       dapat di-download dari Data Manager. Pilih berkas cpeptide.trr, kemudian
       pilih Download untuk mengambil berkas gambar tersebut untuk disimpan di
       komputer lokal Anda untuk keperluan anlisis dan visualisasi.


C.Rangkuman Ringkas Penggunaan GROMACS

Seperti yang telah disebutkan sebelumnya, penggunaan GROMACS memerlukan
beberapa tahapan untuk mempersiapkan berkas input yang akan disimulasikan. Tahapan
tersebut diperlihatkan oleh Gambar 5 sebagai diagram alir berikut. Pada gambar tersebut
‡
 Catatan: pada prakteknya penggunaan aplikasi GROMACS terdiri dari beberapa tahapan untuk
mempersiapkan berkas input sebelum disimulasikan. Akan tetapi dalam petunjuk penggunaan I-GRID Grid
Portal ini diasumsikan telah melewati tahapan-tahapan itu dan hanya ditunjukkan satu tahapan saja dimana
komputasi grid dapat sangat membantu kinerja dan mempercepat waktu eksekusi. Untuk detail penggunaan
akan dijabarkan dalam sub-bab lain.


                                                   8
diperlihatkan berkas input yang harus dipersiapkan oleh pengguna adalah berkas protein
dalam format Brookhaven Protein DataBank (.pdb) dan berkas parameter (.mdp). Dalam
alur ini menggunakan beberapa program bantu (ditunjukkan oleh kotak abu-abu) yang
termasuk dalam paket distribusi GROMACS.




         Gambar 5 Diagram Alir dari Tahapan Persiapan Berkas Input GROMACS (sumber:
             http://www.gromacs.org/documentation/reference/online/flow.html)


Untuk membantu mengerti Gambar 5 di atas akan diberikan contoh kasus simulasi
peptida (sumber:
http://www.psc.edu/general/software/packages/gromacs/examples/rachel/index.html).
Langkah-langkah yang harus dikerjakan untuk melakukan simulasi tersebut antara lain:

1. Ubah berkas .pdb menjadi berkas struktur GROMACS (.gro) dan berkas topologi
   GROMACS (.top). Hal ini dapat dilakukan menggunakan program pdb2gmx.

   % echo 0 | pdb2gmx –f cpeptide.pdb –p cpeptide.top –o cpeptide.gro

   Berkas input: cpeptide.pdb
   Berkas output: cpeptide.top, cpeptide.gro


                                             9
2. Untuk membuat simulasi mendekati kondisi nyata, peptida tersebut akan dilarutkan
   dalam air. Gunakan genbox untuk melakukannya.

   Tetapi sebelumnya gunakan editconf untuk mendefinisikan ukuran kotak air dalam
   sistem.

   % editconf -f cpeptide.gro -o cpeptide.gro -d 0.5

   Berkas input: cpeptide.gro
   Berkas output: cpeptide.gro

   Program genbox akan membaca berkas struktur peptida dengan ukuran kotak air.
   Hasil dari genbox ini berupa berkas struktur peptida yang terlarut dalam air dan juga
   akan merubah berkas topologi peptida dimana menyertakan air.

   % genbox -cp cpeptide.gro -cs cpeptide_b4em.gro -p peptide.top

   Berkas input: cpeptide.gro
   Berkas output: cpeptide_b4em.gro, cpeptide.top

3. Lakukan ‘Penyusutan Energi’ (Energy Minimization/EM) tahap 1 dari molekul
   peptida di dalam larutan sebagai langkah proses awal mempersiapkan berkas input.

   % grompp -np 4 -f em.mdp -c cpeptide_b4em.gro -p cpeptide.top -o
   cpeptide_em.tpr

   Berkas input: em.mdp, cpeptide_b4em.gro, cpeptide.top
   Berkas output: cpeptide_em.tpr

4. Lakukan ‘Penyusutan Energi’ (EM) tahap 2 untuk memulai proses simulasi.

   % mpirun -np 4 mdrun_mpi -np 4 -s cpeptide_em.tpr -o cpeptide_em.trr
   -c cpeptide_b4pr.gro -g cpeptide_em.log -v

   Berkas input: cpeptide_em.tpr
   Berkas output: cpeptide_em.trr, cpeptide_b4pr.gro, cpeptide_em0.log,
   cpeptide_em1.log, cpeptide_em2.log, cpeptide_em3.log

5. Lakukan Penahanan Posisi (Position Restrained/PR) tahap 1 untuk menjaga molekul
   peptida pada posisi tetap dan membiarkan molekul air mengisi di sekeliling peptida
   sebagai langkah awal mempersiapkan berkas input.

   % grompp -np 4 -f pr.mdp -c cpeptide_b4pr.gro -r cpeptide_b4pr.gro -p
   cpeptide.top -o cpeptide_pr.tpr

   Berkas input: pr.md, cpeptide_b4pr.gro, cpeptide.top
   Berkas output: cpeptide_pr.tpr

6. Lakukan Penahanan Posisi (PR) tahap 2 untuk memulai proses simulasi.




                                          10
   % mpirun -np 4 mdrun_mpi -np 4 -s cpeptide_pr.tpr -o cpeptide_pr.trr
   -c cpeptide_b4md.gro -g cpeptide_pr.log –v

   Berkas input: cpeptide_pr.tpr
   Berkas output: cpeptide_pr.trr, cpeptide_b4md.gro, cpeptide_pr0.log,
   cpeptide_pr1.log, cpeptide_pr2.log, cpeptide_pr3.log

7. Lakukan Simulasi Kedinamisan Molekular (Molecular Dynamics/MD) tahap 1 untuk
   mempersiapkan berkas input.

   % grompp -np 4 -f md.mdp -c cpeptide_b4md.gro -p cpeptide.top -o
   cpeptide_md.tpr

   Berkas input: md.mdp, cpeptide_b4md.gro, cpeptide.top
   Berkas output: cpeptide_md.tpr

8. Lakukan Simulasi Kedinamisan Molekular (MD) tahap 2 untuk memulai proses
   simulasi.

   % mpirun -np 4 mdrun_mpi -np 4 -s cpeptide_md.tpr -o cpeptide_md.trr
   -c cpeptide_after_md.gro -g cpeptide_md.log –v

   Berkas input: cpeptide_md.tpr
   Berkas output: cpeptide_md.trr, cpeptide_after_md.gro,
   cpeptide_md0.log, cpeptide_md1.log, cpeptide_md2.log,
   cpeptide_md3.log

9. Terakhir, Anda dapat melakukan berbagai macam analisis menggunakan program
   bantu yang disertakan dalam paket GROMACS.

     •   Melihat visualisasi trayektori di layar monitor (program ngmx).
     •   Memantau energi menggunakan g_energy.
     •   Menghitung akar kuadrat deviasi dari struktur kristal (program g_rms).
     •   Mengukur besar radius Gyration (program g_gyrate).
     •   Memplot Ramachandran (program g_rama).
     •   Melakukan analisis Salt Bridge (program g_saltbr).


PENTING UNTUK DIPERHATIKAN!
• Apabila Anda perhatikan pada panduan pemakaian GROMACS di sub-bab
  sebelumnya, contoh mpigromacs-sample hanya merujuk pada langkah ke-8 dari
  petunjuk detail di atas. Tujuan dari pembatasan ini dimaksudkan selain untuk
  menyederhanakan contoh juga untuk menunjukkan bahwa proses yang paling
  membutuhkan sumber daya komputasi terbesar adalah ketika melakukan simulasi
  (termasuk juga untuk langkah 4 dan langkah 6) dimana layanan grid dapat dijadikan
  solusi untuk pemenuhan kebutuhan komputasi tersebut.
• Pemasukan parameter -np yy harus sama ketika menggunakan program grompp
  dan mdrun_mpi agar sesuai pemecahan bobot masalah.
• Untuk semua program bantu GROMACS yang terinstal di I-GRID memiliki akhiran
  “_d” yang mengartikan tingkat ketelitian double.



                                          11
•   Layanan I-GRID dapat melayani semua program bantu GROMACS hanya saja jenis
    pekerjaannya adalah single job (bukan jenis paralel/MPI) kecuali mdrun_mpi yang
    dapat berjalan secara paralel. Program lainnya yang tidak dapat dieksekusi adalah
    ngmx yang membutuhkan library x-windows lokal dimana tidak disediakan oleh I-
    GRID Grid Portal.


D.Informasi Lebih Lanjut

Berikut ini beberapa URL artikel relevan yang dapat Anda baca melalui Internet.

http://en.wikipedia.org/wiki/Gromacs - Artikel mengenai GROMACS.
http://en.wikipedia.org/wiki/Molecular_dynamics - Artikel mengenai Molecular
Dynamics.
http://www.gromacs.org - Situs resmi GROMACS.
http://www.gromacs.org/external/online-reference-manual.html - Referensi online
mengenai GROMACS, mulai dari petunjuk penggunaan, keterangan format berkas,
diagram alir, penjelasan mengenai program bantu dan FAQ.




                                          12
III.Apikasi MPI-POV-Ray
A.Sekilas Mengenai POV-Ray

Persistence of Vision Raytracer atau disingkat POV-Ray merupakan sebuah program
penjejakan-sinar (ray-tracing), yaitu suatu teknik pemodelan optik terhadap jejak sinar
suatu sumber cahaya ketika bersentuhan dengan permukaan suatu obyek. Algoritma
penjejakan-sinar ini mengambil ide dari alam saat suatu sinar berinteraksi terhadap suatu
obyek. Ketika sinar tersebut mengenai permukaan obyek akan dihasilkan 3 jenis sinar
baru yaitu: refleksi, refraksi dan bayangan. Sinar refleksi akan menghasilkan bayangan-
cermin pada suatu permukaan yang berkilat. Ketika sinar ini berpotongan dengan obyek-
obyek disekitarnya maka obyek yang terdekat yang akan menjadi bayangan refleksi itu.
Sinar refraksi bekerja pada materi yang bersifat transparan dimana sinar tersebut dapat
masuk atau keluar dari materi obyek. Dan terakhir, sinar bayangan akan menentukan
apakah suatu permukaan terlihat dari sumber cahaya atau tidak.

Algoritma ini dapat menghasilkan suatu gambar/visualisasi pemandangan yang mampu
mendekati kondisi sebenarnya (photorealistic). Keburukan dari algoritma ini adalah
membutuhkan sumber daya komputasi yang sangat tinggi untuk mendapat hasil kinerja
yang baik. Oleh karena itu MPI-POV-Ray dapat menjadi solusi untuk mendistribusikan
pekerjaan ray-tracing ke beberapa simpul komputer.


B.Penggunaan MPI-POV-Ray

Sub-bab ini akan menjabarkan langkah-langkah penggunaan MPI-POV-Ray melalui I-
GRID Grid Portal Universitas Indonesia:

   1. Sebelum memulai penggunaan MPI-POV-Ray, dibutuhkan berkas kode sumber
      input POV-Ray (contoh: chess2.pov) di dalam direktori /home Anda.

   2. Selanjutnya pilih tab Job Services  User Applications kemudian klik di
      mpipovray-sample1 untuk memunculkan tampilan Gambar 6. Sama seperti
      user application mpiBLAST dimana pengisiannya sudah diatur sedemikian rupa
      sehingga Anda dapat langsung ‘Submit Job’ ke layanan Grid atau Anda dapat
      mengganti atau menambahkan opsi-opsi lain. Opsi-opsi yang ditawarkan untuk
      pengisian isian Arguments dapat Anda simak pada penjelasan selanjutnya dari
      sub-bab ini (merujuk pada penggunaan ).

        PENTING UNTUK DIPERHATIKAN!
        Semua isian dapat diubah/ditambah kecuali isian Executable dan argumen
        +L/export/share/povray3.1.




                                           13
       Gambar 6 Tampilan Antarmuka dari ‘User Applications’ untuk MPI-POV-Ray


3. Setelah pekerjaan berhasil submit, Anda dapat memonitor status pekerjaan
   tersebut dengan memilih di Job Status seperti yang tampak pada Gambar 7.




            Gambar 7 Tampilan Antarmuka untuk Memonitor Status Pekerjaan
4. Apabila tidak ada kesalahan dan status pekerjaan Done maka akan diperoleh
   berkas gambar output di dalam direktori /home Anda. Pada contoh awal
   mpipovray-sample1, Anda akan memperoleh berkas chess2.tga yang dapat



                                        14
       di-download di Data Manager. Pilih berkas chess2.tga, kemudian pilih
       Download untuk mengambil berkas gambar tersebut untuk disimpan di komputer
       lokal Anda seperti yang ditunjukkan oleh Gambar 7 berikut.




            Gambar 8 Tampilan Download chess2.tga




C.Rangkuman Ringkas Penggunaan MPI-POV-Ray

Untuk membantu pemahaman Anda mengenai MPI-POV-Ray, akan diberikan penjelasan
lebih detail mengenai pengerjaan mpi-x-povray memakai baris perintah konvensional
dalam lingkungan UNIX.

Berikut ini adalah contoh baris perintah penggunaan MPI-POV-Ray secara umum:

           mpirun -np 5 mpi-x-povray +Ichess2.pov +A +W800 +H600
                       +L/export/share/povray3.1 +FN

Baris perintah di atas akan mengeksekusi MPI-POV-Ray ke dalam 5 simpul komputasi
dimana mengambil berkas chess2.pov sebagai input, menggunakan anti-aliasing,
mengatur ukuran gambar yang ingin dihasilkan 800x600 pixels dan merujuk pada library
path: /export/share/povray3.1. Berkas gambar output yang dihasilkan akan
menggunakan format PNG. berikut akan merangkum opsi-opsi yang dapat digunakan
oleh mpi-x-povray.




                                         15
Tabel 3 Opsi-Opsi Umum mpi-x-povray (sumber acuan:
http://library.advanced.org/3285/language/cmdln.html).

        Opsi                                             Deskripsi
+A[0.0…3.0]            Mengatur opsi anti-aliasing. Secara default bernilai –A yang berarti tanpa
                       anti-aliasing. Dan apabila digunakan +A maka secara default bernilai
-A
                       +A0.3
+C                     Mengatur agar POV-Ray dapat melanjutkan pekerjaan yang terinterupsi
                       (dengan sebelumnya menggunakan opsi +X). Secara default bernilai –C
-C
                       dimana berarti ‘mulai dari awal lagi’.
+F[x][n]               Mengatur jenis berkas gambar yang dihasilkan dengan format x dan
                       kedalaman bit (bit depth) n.
                       +FC
                         Compressed Targa-24 (TGA)
                       +FN
                         Portable Network Graphics (PNG)
                       +FP
                         Unix PPM
                       +FS
                         System-specific (Mac Pict atau Windows BMP)
                       +FT
                         Uncompressed Targa-24 (TGA)
+H[1…32767]            Mengatur opsi tinggi gambar dalam pixel. Default bernilai 100.
+I atau -I             Mengatur nama berkas input (*.pov)
+J[0.0…1.0]            Mengatur opsi jitter ketika melakukan anti-aliasing.
-J
+L<path>               Mengatur lokasi library path.
+O atau -O             Mengatur nama berkas output.
+Q[0…9]                Mengatur kualitas render gambar output. Default bernilai 9.
                       +Q0, +Q1
                         Menggunakan grayscale untuk mewarnai obyek. Hanya menggunakan
                         sumber cahaya keliling (ambient light). Tanpa bayangan, tanpa
                         shading, tanpa refleksi, tanpa transmisi, tanpa refraksi dan wilayah
                         pencahayaan di-render sebagai titik-titik cahaya.
                       +Q2, +Q3
                         Menggunakan sumber cahaya tersebar (diffuse lighting) dan shading
                         obyek.
                       +Q4
                         Menggunakan kalkulasi pembentukan bayangan.
                       +Q5
                         Menggunakan wilayah pencahayaan.
                       +Q6, +Q7
                         Menggunakan pewarnaan obyek berdasarkan teksturnya.
                       +Q8, +Q9
                         Menggunakan refleksi dan kalkulasi transparansi (termasuk refraksi).




                                               16
+R[1…n]              Mengatur opsi banyak sinar yang dipakai POV-Ray (supersampling)
                     ketika digunakan anti-aliasing. Secara default bernilai 3, yang berarti
                     POV-Ray menggunakan sinar berkisi 3x3. Semakin tinggi nilai yang
                     diberikan akan berdampak besar pada lama eksekusi.
+V                   Mengatur opsi mencetak pelaporan statistik selama rendering. Secara
-V                   default bernilai -V
+W[1…32767]          Mengatur opsi lebar gambar dalam pixel. Default bernilai 100.
+X                   Mengatur opsi interupsi. Apabila digunakan +X maka proses eksekusi
                     dapat diinterupsi dengan menekan suatu tombol dan dapat dilanjutkan
-X                   kembali menggunakan +C. Apabila digunakan –X maka proses tidak dapat
                     diinterupsi kecuali komputer di restart ulang.


D.Informasi Lebih Lanjut

Berikut ini beberapa URL artikel yang dapat dibaca melalui Internet.
• http://en.wikipedia.org/wiki/Povray - Artikel tentang program Povray
• http://en.wikipedia.org/wiki/Ray_tracing - Artikel tentang penjejakan sinar
• http://www.povray.org - Situs resmi Povray




                                             17

				
DOCUMENT INFO
Description: Contoh Format Resume document sample