SeLnIkraJ - Perl

Reviews
Shared by: selnik raj
Stats
views:
100
rating:
not rated
reviews:
0
posted:
3/7/2009
language:
pages:
0
SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO STORE A DNA SEQUENCE Aim To write a program to store a DNA sequence. Program $dna="ATGC"; print"The DNA sequence is $dna"; Output The DNA sequence is ATGC Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO CONCATENATE DNA FRAGMENTS Aim To write a program to concatenate DNA fragments. Program $DNA1="GTACAAAAAAGCAGAAGGGCCGTCA"; $DNA2="TACTTGGATGACTGTCACCGGAGGT"; $DNA3="TCATCTCCAAGTCCTTCCAGGGCAG"; $DNA=$d1.$d2.$d3; print"The Concatenated DNA Sequence is \n$DNA"; Output The Concatenated DNA Sequence is GTACAAAAAAGCAGAAGGGCCGTCATACTTGGATGACTGTCACCGGGGTTCA TCTCCAAGTCCTTCCAGGGCAG Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO CONVERT DNA TO RNA SEQUENCE Aim To write a program to convert DNA to RNA sequence. Program $dna="CGAGCACTGTTTCCAACAAAAATCTAGGATCTTGGCAGTAACCACTAT; print"The DNA sequence is :\n\t$dna"; $com=$dna; $com=~s/T/U/g; print" The Converted RNA sequence is :\n\t$com"; Output The DNA sequence is : CGAGCACTGTTTCCAACAAAAATCTAGGATCTTGGCAGTAACCACTAT The converted RNA sequence is : CGAGCACUGUUUCCAACAAAAAUCUAGGAUCUUGGCAGUAACCACU Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO CALCULATE REVERSE COMPLEMENT OF A DNA SEQUENCE Aim To write a program to calculate reverse complement of a DNA sequence. Program $dna="ATGCGTA"; print" the Dna sequence = $dna\n"; $reverse=reverse $dna; print"Reversed Dna sequence = $reverse\n"; $reverse=~tr/ATGC/TACG/; print"Reverse complement of Dna = $rev"; Output: The Dna sequence = ATGCGTA Reversed Dna sequence = ATGCGTA Reverse complement of Dna = TACGCAT Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO READ PROTEIN SEQUENCE DATA FROM A FILE. Aim: To write a program to read protein sequence data from a file. Program: #!usr/bin/perl print"Enter the file name:"; $proteinfilename=; open(PROTEINFILE,$proteinfilename); @protein=; print"@protein"; #close PROTEINFILE; #exit; Output: Enter the file name: x:\cat.txt ATGTTCCACTTTATTGTTAACCCAAGTAGTCAAAGCGGAAAAAGCAAATCTCT CTGGAAGCTTATTGAGAGGGAACTAAA GGAGCACCACATCGATTATAAAGTCCACTACACTCGCTATGAGTACCATGCA ATCCAACTTGTCCAAGAGATCTGTAAGG AAAAAGGTTTTAAGACCATCGTTGCACTTGGAGGTGATGGAACCGTTAGTGA GGTAGTTAACGGAATTACAGACTTCGAT AATGTTAAATTTGGTTACATCCCAACAGGGTCAAGTAACGACTTCTCACGTGG TTTAGGACTTCCCACTAAGTTTAAGAA GGCCTTGGATACAGTTTTGTACTCTAAGAATTACAAAGAAATCGATGTTGGCT GCCTTGACTTTGGAAACAACGAAACAC AAAAATTCGGTGTTTCATGCGGCATGGGATTTGACGCTGCCGTTTGCATGGAA GCCTACTCATCACCCATCAAAGACTTC TTAAATCGTATCCATATGGGCTTTTTCACATATACTGTAATCGCAGTCAAGAA CATTTTTACTTACAAGTGTTCTAAGAT Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com CACCATTACATTCGATGATAAGGATACACGCGTTTATGACCGTTGCCTCTTCC TTTCATCACTTAATGGCCCATGTGAAG GTGGTGGCTTGCGCCTTGCTCCACATGCTAACCCATTCGATGAATATCTCGAT GTGTTCGTTCTGAATACAGATAATAAG GTCAAGATTTTATTATTCTTCCCCTTAGCTTATCTGAATTGTCATAGTGCCCTT AACTACTTCGATGAAGTTGATATTGT AAGATGCAAGAAGCTTCACATTGTCTCAGACGTACCTCTTCCTGTCCACAGAG ATGGCGAACCATGCAAATACCGCACAG ATGTTACAATCTCACTTCAAAAGAAGAAGCTCAAAGTTTGCACACCATA Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO PRINT THE ELEMENTS OF AN ARRAY Aim To write a program to print the elements of an array. Program @array=("ATGC","ACTG"); print"Elements of an array = @array"; Output Elements of an array = ATGC ACTG Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO TAKE AN ELEMENT OFF THE END OF AN ARRAY Aim To write a program to take an element off the end of an array. Program @location=(1,2,3,4); print"The elements of an array is @location\n "; $num=pop@location; print"The removed end element of an array is $num\n"; print"The remaining array elements @location"; Output The elements of an array is 1 2 3 4 The removed end element of an array is 4 The remaining array elements 1 2 3 Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO TAKE AN ELEMENT OFF THE BEGINNING OF AN ARRAY Aim To write a program to take an element off the beginning of an array. Program @num=(1,2,3,4); print" The elements of an array is @num\n"; $num=shift@num; print" The removed beginning element of an array is $num\n"; print" The remaining array elements @num"; Output The elements of an array is 1 2 3 4 The removed beginning element of an array is 1 The remaining array elements 2 3 4 Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO PUT AN ELEMENT AT THE BEGINNING OF AN ARRAY. Aim To write a program to put an element at the beginning of an array. Program @num=(2,3); print" The elements of an array is @num\n"; $val=unshift @num,1; print"Inserted element is 1\n"; print" The array with inserted first element is @num\n"; Output The elements of an array is 2 3 Inserted element is 1 The array with inserted first element is 1 2 3 Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO PUT AN ELEMENT AT THE END OF AN ARRAY Aim To write a program to put an element at the end of an array. Program @char=("a","b","c"); print" The elements of an array is @char\n"; push@char,"d"; print" The inserted element is d\n"; print" The array with inserted end element is @char"; Output The elements of an array is a b c The inserted element is d The array with inserted first element is a b c d Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com ADD AN ELEMENT TO THE BEGINING Aim To write a perl program to put an element at the end of the array Program For string: @string= (“AB”,”CD”,”EF”); print “The array before adding is @string; @string1=”FA”; unshift @string,@string1; print “The array after adding is @string”; For numbers: @num= (1, 2, 3, 4, 5); print “The array before adding is @num; @num1=0; unshift @num,@num 1; print “The array after adding is @num”; Output The array before adding is ABCDEF The array after adding is FAABCDEF The array before adding is 12345 The array after adding is 012345 Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO REVERSE AN ARRAY Aim To write a program to reverse an array. Program @num=(1,2,3); print"The array in order is @num"; @rev=reverse @num; print"The array in reversed order @rev"; Output The array in order is 1 2 3 The array in reversed order 3 2 1 Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO GET THE LENGTH OF AN ARRAY Aim To write a program to get the length of an array. Program @Rollno=(1,2,3,4,5,6); print"The array is @ Rollno "; $students=scalar@Rollno; print"The length of an array = $students"; Output The array is 1 2 3 4 5 6 The length of an array = 6 Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO INSERT AN ELEMENT AT A RANDOM POSITION IN AN ARRAY Aim To write a program to insert an element at a random position in an array. Program @dna=('a','t','g','c'); print"The array is "; print"@dna\n"; splice(@dna,2,0,'x'); print"The spliced array is "; print"@dna"; Output The array is a t g c The spliced array is a t x g c Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO FIND MOTIFS IN A PROTEIN SEQUENCE Aim To write a program to find motifs in a protein sequence. Program print"Enter the file name: "; $proteinfile=; chomp $proteinfile; open(PROTEINFILE,$proteinfile); @protein=; $protein=join('',@protein); print"Enter a motif to be searched for: "; $motif=; chomp$motif; if($protein=~/$motif/) { print"The pattern matched is found"; } else { print"The pattern not found"; } Output Enter the file name: x:\insilico\catalase.txt Enter a motif to be searched for: AGLLW The pattern matched is found Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO COUNT NUCLEOTIDES IN A SEQUENCE Aim To write a program to count nucleotides in a sequence. Program print"Enter the file name: "; $dnafile=; open(DNAFILE,$dnafile); @dna=; $dna=join('',@dna); @dna=split('',$dna); $A=0; $T=0; $G=0; $C=0; foreach $base(@dna) { if($base eq 'A') { $A++; } elsif($base eq 'T') { ++$T; } elsif($base eq 'G') { ++$G; } elsif($base eq 'C') Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit { ++$C; } } print"\n",'-'x60,"\n"; www.selnikraj.110mb.com print"Number of Adenine =$A\n"; print"Number of Thymine =$T\n"; Print”Number of Guanine =$G\n"; print"Number of Cytosine =$C\n"; Output Enter the file name: x:\insilico\rat.txt -----------------------------------------------------------Number of Adenine =40 Number of Thymine =73 Number of Guanine =68 Number of Cytosine =54 Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO FIND THE PERCENTAGE OF HYDROPHOBIC AMINO ACIDS IN A SEQUENCE Aim To write a program to find the percentage of hydrophobic amino acids in a sequence. Program print"Enter the file name: "; $pro=; chomp $pro; open(PROTEINFILE,$pro); @ptn=; $ptn=join('',@ptn); $lenprotein=length$ptn; @ptn=split('',$ptn); $count_v=0; { foreach $base(@ptn) { if(($base eq 'V')||($base eq 'I')||($base eq 'F')||($base eq 'L')||($base eq 'M')||($base eq 'W')||($base eq 'C')) { ++$count_V; } } } print"\nLength of protein: $lenprotein"; print"\nHydrophobic amino acids=$count_V"; $per_V=($count_V/$lenprotein)*100; print"\nThe percentage of hydrophobic amino acid is $per_V"; Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit Output www.selnikraj.110mb.com Enter the file name: x:\catalase.txt Length of protein: 499 Hydrophobic amino acids=141 The percentage of hydrophobic amino acid is 28.2565130260521 Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO APPEND ATGC TO A DNA SEQUENCE USING SUBROUTINES Aim To write a program to append ATGC to a DNA sequence using subroutines. Program sub append { $a='ATGC'; $res=$_[0]; $res=$res,$a; } $dna="TTAGTAAT"; print"The DNA sequence is: $dna"; $rna="UAGAAGCG"; print"\nThe RNA sequence is: $rna"; append $dna.$rna; print"\nAfter doing append the sequence is: $res"; Output The DNA sequence is: TTAGTAAT The RNA sequence is: UAGAAGCG After doing append the sequence is: TTAGTAATUAGAAGCG Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO CONCATENATE TWO STRINGS USING SUBROUTINES Aim To write a program to concatenate two strings using subroutines. Program $DNA1='ATTATAAT'; print"The first sequence is $DNA1\n"; $DNA2='GCATTCAT'; print"The second sequence is $DNA2\n"; $DNA3=concat($DNA1,$DNA2); print"The concatenated sequence is $DNA3"; sub concat { $DNA3=$DNA1.$DNA2; return $DNA3; } Output The first sequence is ATTATAAT The second sequence is GCATTCAT The concatenated sequence is ATTATAATGCATTCAT Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO CONVERT DNA TO RNA USING SUBROUTINES Aim To write a program to convert DNA to RNA using subroutines. Program $DNA='ATGACCGCTA'; print"The DNA sequence is $DNA"; $res=convert($DNA); print"\nThe RNA sequence is $res"; sub convert { $res=$DNA; $res=~s/T/U/g; return $res; } Output The DNA sequence is ATGACCGCTA The RNA sequence is AUGACCGCUA Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO FIND IF A DNA IS STABLE OR NOT Aim To write a program to find if a DNA is stable or not. Program print"Enter the file name: "; $dna=; chomp $dna; open(DNAfile,$dna); @dna=; $joindna=join('',@dna); $lendna=length $joindna; @dnafinal=split('',$joindna); $count_A=0; $count_T=0; $count_G=0; $count_C=0; { foreach $base(@dnafinal) { if($base eq 'A') { ++$count_A; } elsif($base eq 'T') { ++$count_T; } elsif($base eq 'G') { Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit ++$count_G; } elsif($base eq 'C') { ++$count_C; } } www.selnikraj.110mb.com print"The length of the dna is $lendna"; print"\nA=$count_A"; print"\nT=$count_T"; print"\nG=$count_G"; print"\nC=$count_C"; $count_AT=$count_A+$count_T; $count_GC=$count_G+$count_C; $per_AT=($count_AT/$lendna)*100; $per_GC=($count_GC/$lendna)*100; print"\nThe length of AT is $count_AT"; print"\nThe length of GC is $count_GC"; print"\nThe percentage of AT is $per_AT"; print"\nThe percentage of GC is $per_GC"; if($per_GC>$per_AT) { print"\nThe dna is stable"; } else { print"\nThe dna is not stable"; } } Output Enter the file name: x:\insilico\cat.txt Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com The length of the dna is 229 A=59 T=39 G=63 C=68 The length of AT is 98 The length of GC is 131 The percentage of AT is 32.8859060402685 The percentage of GC is 43.9597315436242 The dna is stable Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO FIND THE MOTIFS Aim To write a program to find the motifs in a protein sequence Program print"Enter the file name:"; $proteinfile=; open(PROTEINFILE,$proteinfile); @protein=; $joinprot=join('',@protein); $lenprotein=length$joinprot; print"Enter a motif:"; $motif=; chomp$motif; $lenmotif=length$motif; $count=0; for($position=0;$position<$lenprotein;++$position) { $motsearch=($joinprot) if($motsearch eq $motif); { ++$count; } } print"The number of motif=$count"; Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit Output www.selnikraj.110mb.com Enter the file name: x:\nuc1.txt Enter a motif: GCATGTACTGTAC The number of motifs=528 Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO FIND THE PERCENTAGE OF G AND C Aim To write a program to find the percentage of G and C in a given dna sequence Program print"Enter your file containing DNA sequence "; $dnafile=; open(DNAFILE,$dnafile); @dna=; $dna=join('',@dna); @dna=split('',$dna); $GC=0; $length=scalar@dna; foreach $dna(@dna) { if(($dna eq'G')||($dna eq'C')) { $GC++; } } print"The total length of the sequence is $length\n"; print"The total number of G and C present is $GC\n"; $GC1=($GC/$length)*100; print"The percentage of G and C is $GC1\n"; Output Enter your file containing DNA sequence x:\nuc1.txt Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com The total length of the sequence is 528 The total number of G and C present is 106 The percentage of G and C is 20.0757575757576 Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PROGRAM TO CONVERT DNA TO PROTEIN SEQUENCE Aim To write a program to convert dna to protein sequence Program print "This script will convert your DNA sequence to PROTEIN Sequence\n\n"; print "ENTER THE FILENAME OF THE DNA SEQUENCE:= "; $DNAfilename = ; chomp $DNAfilename; unless ( open(DNAFILE, $DNAfilename) ) { print "Cannot open file \"$DNAfilename\"\n\n"; } @DNA = ; close DNAFILE; $DNA = join( '', @DNA); print " \nThe original DNA file is:\n$DNA \n"; $DNA =~ s/\s//g; my $protein=''; my $codon; for(my $i=0;$i<(length($DNA)-2);$i+=3) { $codon=substr($DNA,$i,3); $protein.=&codon2aa($codon); } print "The translated protein is :\n$protein\n"; ; sub codon2aa{ my($codon)=@_; $codon=uc $codon; Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com my(%g)=('TCA'=>'S','TCC'=>'S','TCG'=>'S','TCT'=>'S','TTC'=>'F','TTT'=>'F','TTA'=>'L ','TTG'=>'L','TAC'=>'Y','TAT'=>'Y','TAA'=>'_','TAG'=>'_','TGC'=>'C','TGT'=>'C','TGA' =>'_','TGG'=>'W','CTA'=>'L','CTC'=>'L','CTG'=>'L','CTT'=>'L','CCA'=>'P','CCC'=>'P',' CCG'=>'P','CCT'=>'P','CAC'=>'H','CAT'=>'H','CAA'=>'Q','CAG'=>'Q','CGA'=>'R','CGC' =>'R','CGG'=>'R','CGT'=>'R','ATA'=>'I','ATC'=>'I','ATT'=>'I','ATG'=>'M','ACA'=>'T',' ACC'=>'T','ACG'=>'T','ACT'=>'T','AAC'=>'N','AAT'=>'N','AAA'=>'K','AAG'=>'K','AG C'=>'S','AGT'=>'S','AGA'=>'R','AGG'=>'R','GTA'=>'V','GTC'=>'V','GTG'=>'V','GTT'=>' V','GCA'=>'A','GCC'=>'A','GCG'=>'A','GCT'=>'A','GAC'=>'D','GAT'=>'D','GAA'=>'E',' GAG'=>'E','GGA'=>'G','GGC'=>'G','GGG'=>'G','GGT'=>'G'); if(exists $g{$codon}) { return $g{$codon}; } else { print STDERR "Bad codon \"$codon\"!!\n"; exit; } } Output This script will convert your DNA sequence to PROTEIN Sequence ENTER THE FILENAME OF THE DNA SEQUENCE: = x:\nuc.txt The original DNA file is: TTAAATTCTAATTAGAGATGCAGGAATCAATGATAGGGAGGTTGGACAGCTC AGTTCCCCAGTGCCAGCC CAATAGACGGATGAGTTATTGTCATGTAAAAAGCGCCAGCAATAAGACCAAC CGCTTTGCTATTGTCCAA Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com GTGGAAAGAGCCAAGTTTATTATGAGGACTATATGCTCTAGAGACCTCAGAC AAGGCATCTCATAGGAGG CTTTTTCATAAAACTAGGCTCTGCTGGTAGTAAGGAGGCCAGTTTGGAGGCA GGCGTTGAGCTGTGCACA TCTCCCCACTCCAGCCACCTTCTCCATATCCATCTTTTATTTCATTTTTCCACTT GGCTGAGCCATCCAG AACCTTTTCAATGTATAAAATGGAATATTCTTACCTCAATTCCTCTGCCTACG AGTCCTGTATGGCTGGG ATGGACACCTCGAGCCTGGCTTCAGCCTATGCTGACTTCAGTTCCTGCAGCCA GGCCAGTGGCTTCCAGT ATAACCCGATAAGGACCACTTTTGGGGCCACGTCCGGCTGCCCTTCCCTCACG CCGGGATCCTGCAGCCT GGGCACCCTCAGGGACCACCAGAGCAGTCCGTACGCCGCAGTTCCTTACAAA CTCTTCACGGACCACGGC GGCCTCAACGAGAAGCGCAAGCAGCGGCGCATCCGCACCACTTTCACCAGTG CCCAGCTCAAAGAGCTGG AAAGGGTCTTCGCGGAGACTCACTACCCCGACATCTACACTCGGGAGGAGCT GGCCCTGAAGATCGACCT CACAGAGGCGCGAGTCCAGGTGTGGTTCCAGAACCGCCGCGCCAAGTTTCGC AAGCAGGAGCGCGCAGCG GCAGCCGCAGCGGCCGCGGCCAAGAACGGCTCCTCGGGCAAAAAGTCTGAC TCTTCCAGGGACGACGAGA GCAAAGAGGCCAAGAGCACTGACCCGGACAGCACTGGGGGCCCAGGTCCCA ATCCCAACCCCACCCCCAG CTGCGGGGCGAATGGAGGCGGCGGCGGCGGGCCCAGCCCGGCTGGAGCTCC GGGGGCGGCGGGGCCCGGG GGCCCGGGAGGCGAACCCGGCAAGGGCGGCGCAGCAGCAGCGGCGGCGGCC GCGGCAGCGGCGGCGGCGG CAGCGGCAGCGGCGGCAGCTGGAGGCCTGGCTGCGGCTGGGGGCCCTGGAC AAGGCTGGGCTCCCGGCCC Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com GTCTCATGTTTCGCAACTCTTTTTTTCCCCCTCGCTCCCGCCTACCCCGTCGGC ATTTTCTTCTTCCACC AGCTTTTACTGAACTTTTTGGCACTGCTTTGGATTGGGGTCAATTGCAGTCCA CGTAACTGGCTGCAGAG AAATCTACCGAGCAAGGAAAAGGCACACACACACGTTTGCAGGGGTGTCTCG GTTTGCATTTCTGTTGGA ATGATCCGAACTGGACTCACATCCTGTATGGTGGATGGACTGTATATTGAGG GTTCCATTCTTCGCGCAG TTTAGACATCTCTGTTTTGATTCTTTGTTGTTGTTTTTATTTTAAAAGGCACAA ACTCTAGATATTAGTT GAATGTTGAGGCTTTAACTTTTTCGGTGTCTTTCTACAACTGTGTTCTGTGACT CAATTGTATCGTGTTA The translated protein is: LNSN_RCRNQ__GGWTAQFPSASPIDG_VIVM_KAPAIRPTALLLSKWKEPSLL_G LYALETSDKASHRRLFHKTRLCW_ _GGQFGGRR_AVHISPLQPPSPYPSFISFFHLAEPSRTFSMYKMEYSYLNSSAYESC MAGMDTSSLASAYADFSSCSQAS GFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEK RKQRRIRTTFTSAQLKELERVFAET HYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSG KKSDSSRDDESKEAKSTDPDSTGGPGP NPNPTPSCGANGGGGGGPSPAGAPGAAGPGGPGGEPGKGGAAAAAAAAAAAA AAAAAAAAGGLAAAGGPGQGWAPGPGPI TSIPDSLGGPFASVLSSLQRPNGAKAALVKSSMF_SGILRRRRRRRQRASQGPGGR VGERVGPRLLSSLLPWLFH_GPKV IALRIKGKRRRPHFNPTPTPFLNPQTKQTNFPGFAPAWGLAAGPGLRLLIGGCEQR GLDAGHSQGAVSACQFVSVSGNVC LWPKQVTGRDGGPQPT__LV_KKKTKK_K_KQKSWKAETIKKQKANNPERFKKH KEKKDKLKEGLGEKLQLELKARSCEP LNPLPPNSTDSLGALLQGRVGTPFQPPFLSCPWVRVTAATTCSDCPGGRSDFLAP PCLSHLAEHHPAISASEPHTVATPN Any queries mail me Selnikraj@yahoo.com SeLnIkRaJ Visit www.selnikraj.110mb.com PESLQPFGPERCPIHEMPFHLQTLQNVSHVSQLFFSPSLPPTPSAFSSSTSFY_TFWH CFGLGSIAVHVTGCREIYRARK RHTHTFAGVSRFAFLLE_SELDSHPVWWMDCILRVPFFAQFRHLCFDSLLLFLF_K AQTLDIS_MLRL_LFRCLSTTVFC DSIVSC_YQCRLSPLRDRIMFFSSCSLYGVSLWCNKVLTGSIFCV_RGHGSDNGIY FCYQVHVCLISFFFLLDYVCEHNC HKLCFRFLNLFICVIMNASI_KGNISTCAYSFPRVYH_LDC___KQKASLK Any queries mail me Selnikraj@yahoo.com

Related docs
Selnikraj - UBUNTU
Views: 25  |  Downloads: 2
SeLnIkRaJ - Basic Bioinformatics
Views: 96  |  Downloads: 23
Selnikraj - works on anthrax
Views: 80  |  Downloads: 6
SeLnIkRaJ - Bioinfo
Views: 93  |  Downloads: 5
SeLnikraj - Ligand Scout
Views: 127  |  Downloads: 3
SeLnIkRaJ - Reverse Vaccinology
Views: 108  |  Downloads: 6
selnikraj_hapmap_project
Views: 90  |  Downloads: 4
Selnikraj - Ligand Scout
Views: 155  |  Downloads: 4
Selnikraj Bioinfo software Notes
Views: 385  |  Downloads: 35
Selnik_Hapmap_presentation
Views: 27  |  Downloads: 1
Other docs by selnik raj
Selnikraj - UBUNTU
Views: 25  |  Downloads: 2
SeLnIkRaJ - Reverse Vaccinology
Views: 108  |  Downloads: 6
SeLnIkRaJ - Basic Bioinformatics
Views: 96  |  Downloads: 23
Selnikraj - works on anthrax
Views: 80  |  Downloads: 6
Selnikraj - Ligand Scout
Views: 155  |  Downloads: 4
SeLnIkRaJ - Bioinfo
Views: 93  |  Downloads: 5
SeLnikraj - Ligand Scout
Views: 127  |  Downloads: 3
Selnikraj - Bioinformatics online Protein work
Views: 125  |  Downloads: 14
Selnikraj - Bioinformatics Visualization Tools
Views: 251  |  Downloads: 16
Selnik_Hapmap_presentation
Views: 27  |  Downloads: 1
Selnikraj Bioinfo software Notes
Views: 385  |  Downloads: 35
Reverse Vaccinology
Views: 162  |  Downloads: 8
selnikraj_hapmap_project
Views: 90  |  Downloads: 4