Biotechnologie_Pharmaceutique_AG

Document Sample
Biotechnologie_Pharmaceutique_AG Powered By Docstoc
					            BIOTECHNOLOGIE
            PHARMACEUTIQUE
           De l’éprouvette au produit final



        PHA 2501: Sciences Pharmaceutiques II

 Alain Garnier, Laboratoire d’optimisation des bioprocédés (LOB), génie
                    chimique, PROTEO, Hiver 2010

La totalité du matériel présenté est disponible à l’adresse web:
                     http://www.gch.ulaval.ca/agarnier/
      Définition et contexte

   Biotechnologie: l’application de la science et de la
    technologie aux organismes vivants, à d’autres
    matériaux vivants ou non vivants, pour la production
    de savoir, biens et services. (source: OCDE)

   Traditionnelle: Utilisation de micro-organismes et
    d’enzymes sélectionnés pour produire des agents
    d’intérêt; Isolation d'agents à partir de sources
    biologiques.

   Contemporaine: Utilisation de micro-organismes et
    d’enzymes modifiés, directement ou non, pour
    produire des agents d’intérêt.
Les médicaments d'origine biologique

   Traditionnels:
      D'origine animale: produits sanguins, hormones,

       stéroïdes, catécholamines, prostaglandines,
       anticorps, insuline, vaccins…
      D'origine végétale: alcaloïdes, flavonoïdes,

       méthylxanthines, terpénoïdes, glycosides
       cardiotoniques et coumarines, ac salicylique…
      D'origine microbienne: antibiotiques, enzymes,

       protéases, vaccins, …
      D'origine virale: vaccins
    Les médicaments d'origine biologique (suite)

    Biopharmaceutique: substance utilisée à des fins thérapeutiques
     ou diagnostiques, à base d'acides nucléiques ou de protéines,
     produites par des moyens autre que l'extraction directe d'une
     source biologique non-modifiée.
    Exemples:
         Facteurs sanguins (facteurs VIII et Factor IX)
         Agents trombolytiques (activateur tissulaire du plasminogène)
         Hormones (insuline, hormone de croissance, gonadotrophine, etc)
         Facteurs de croissance (cytokines, interférons (IFN), interleukines
          (IL), érythropoïétine (EPO), facteur de croissance des colonies, …)
         Vaccins (méningocoque, influenza, antigène de surface de
          l'hépatite B, …)
         Anticorps monoclonaux
         Autres (facteur de nécrose tumorale, plasmides, vecteurs viraux,
          microARN, ARNi, …)
          Seulement 12% des nouveaux médicaments
          sont produits par synthèse/extraction


         35%      34%
         30%
         25%
                              21%         22%
         20%
     %
         15%
                                                      12%           12%
         10%
         5%
         0%
               Cell. Mam.   Microbe     Vaccins   Extr/Synthèse   Thérapie
                                                                  génique

% de médicaments approuvés ou en essais cliniques en 2000 (Odum, Pharma. Eng., 2001)
Plan
   Cibles
   Sources
   Produits/caractérisques
   Méthodes analytiques
   Développement de systèmes de production
      Construction/sélection

      Procédés de production

      Procédés de séparation
       Cibles des biopharmaceutiques
                                                      DIAGNOSTIC/THÉRAPIE

                                       ADN                Dépistage/
                                                          thérapie génique




                                                         Transcriptome/
                                        ARN
                                                         ARNi

                                     traduction

                                                          Protéome/
                                     PROTÉINE             Anticorps,
                                                          hormones…
                                            Syst immunitaire/vaccin
Francis Crick, 1958 (source: NCBI)          Métabolisme/ Thérapie cellulaire
Sources de biopharmaceutiques
   Virus
   Bactéries
   Levures
   Moisissures
   Cellules animales
       Invertébrés
       Mammifères
       Primates non-humains
       Humaines
       Lignées établies
       Cultures primaires
       Cellules souches
                Les virus

       Vaccins ou vecteurs de
         thérapie génique



Vaccins - exemples:                                          Influenza
• Influenza (GSK)
• Adénovirus 4 & 7 (Wyeth Pharma
  pour DoD, 105-106 doses
• Aussi: variole, rubéole, rougeole, oreillons,
  varicelle, hépatite, polio, rage, fièvre jaune,
  encéphalite japonaise, cancer, etc
                                                    Herpes               Adenovirus
Maladies traitées par thérapie génique
Vecteurs utilisés
Type de gènes employés
Phases cliniques
             La thérapie génique




                                                                 Rétrovirus
   Adénovirus




La thérapie génique consiste à traiter une maladie par le transfert de matériel
génétique. Les virus sont particulièrement bien adaptés pour accomplir cette tâche.
Adénovirus: cycle d’infection
Adénovirus: les gènes




  B Massie, IRB
Adénovirus: évolution des vecteurs




B Massie, IRB
Adénovirus: construction




R. Gilbert, IRB
Adénovirus: production et utilisation




 B Massie, IRB
   Rétrovirus




- Rétrovirus s’insère dans le génome de la cellule hôte
- 3 familles de gènes: gag = capside, pol = polymérase, env = enveloppe
- On manipule la protéine d’enveloppe pour altérer le tropisme du virus
Rétrovirus: cycle de réplication
Rétrovirus: construction de lignée
de production
     Les autres outils génétiques

   Diagnostic
       Patron de digestion par enzymes de restriction
       Séquençage
       Hybridation
       FISH
       Gene chip
       qRT-PCR
   Autres phénomènes
       Épigénétique
       ARNi
               Techniques analytiques:
               L’identification de séquences d'ADN




                                La digestion de l'ADN avec des enzymes de
                                restriction, suivi d'une électrophorèse permet une
                                identification par la différence de taille des
Tiré de Microbiology 101, WSU   fragments
L’identification de séquences (suite)



                        En réalisant des PCR sur des
                        fragments d'ADN en
                        présence de
                        désoxynucléotides et une
                        alternance de
                        didésoxynucléotides, on
                        parvient à complètement
                        séquencer l'ADN
       Hybridation fluorescente in situ (FISH)

LE FISH est une technique de
biologie moléculaire d'hybridation in
situ utilisant des sondes marquées à
l'aide d'un marqueur fluorescent et
utilisées sur des coupes en
microscopie.

Ces sondes peuvent être utilisées
sur de l'ADN ou de l'ARN (sonde
ADN), ou sur des protéines (sonde
anticorps). Le FISH est une
technique de cytogénétique
permettant de voir des éléments à
l'intérieur de la cellule.
        L'expression des gènes: les biopuces

1- Comparaison de l’expression
   génétique de 2 échantillons
   cellulaires
2- Extraction de l ’ARN
3- Réverse transcription avec des
   nucléotides marqués par des
   fluorochromes différents
4- Hybridation compétitive sur des
   lamelles contenant des milliers
   d’oligonucléotides différents
   connus
5- Lecture des lamelles
6- Analyse des résultats
Les biopuces (suite)




Joe DeRisi et al., Stanford U., 6116 gènes (cliquez sur les images
pour une explication détaillée).
quantitative (RT)-PCR (qRT-PCR)




Cliquez sur l'image pour un lien vers une simulation de la PCR
quantitative (RT)-PCR (qRT-PCR)
     Épigénétique
• Le terme épigénétique définit les modifications
                                                                  Phénomènes
  transmissibles et réversibles de l'expression des gènes ne
  s'accompagnant pas de changements des séquences                 épigénétiques
  nucléotidiques. Les changements peuvent se produire
  spontanément, en réponse à l'environnement, à la                •Paramutations
  présence d'un allèle particulier, même si celui-ci n'est plus   •Bookmarking
  présent dans les descendants                                    •Imprinting
• Certains caractères épigénétiques hérités pouvaient être        •Gene silencing
  transmis lors de la réplication cellulaire (méiose), voire      •X chromosome
  subsister d'une génération à l'autre pour des organismes
                                                                   inactivation
  multicellulaires.
• Les phénomènes épigénétiques constituent un                     •Position effect
  programme qui déciderait quels gènes activer ou inhiber.        •Reprogramming
  L’environnement influence ces signaux épigénétiques qui         •Transvection
  peuvent ainsi subir de petits changements. Ces                  •Effet maternel
  épimutations sont plus fréquentes que les mutations
  classiques de l’ADN.
L’ARN anti-sens, interférent, micro-ARN




                       (Pour plus de détails, cliquez ici)
     Exemple 1: Infectio Diagnostic


   Originalement Infectio Diagnostic, puis GeneOhm
    Sciences et maintenant Becton Dickinson (BD)
    Diagnostics à Québec:
      Identification génétique de bactéries pathogènes,

       de gènes de toxines et de gènes de résistance
       (Strep B, SARM, …)
      Basé sur la sensibilité, la spécificité et l'ubiquité de

       l'amorce PCR
      Temps du test ≈1 hr
            Exemple 2: Diagnocure

La plate-forme technologique PCA3, un gène dont l'ARN messager est détecté dans la majorité des
    cancers de la prostate chez l'humain. Le même ARN messager n'est exprimé qu'à un très faible
    niveau dans la prostate normale et est absent des autres tissus normaux. PCA3 peut donc servir
    de marqueur tumoral et les molécules dérivées de sa séquence, ARN messager ou peptide,
    peuvent servir à la mise au point de divers produits de diagnostic ou de thérapie. La découverte
    du gène PCA3 est le fruit d'une collaboration entre DiagnoCure et l'Université de Nijmegen et
    DiagnoCure détient des droits mondiaux sur cette plate-forme technologique.

La technologie DiagnoGeneMC est l'association de technologies pour la détection d'acides nucléiques
    et de séquences de gènes spécifiques au cancer. Les produits dérivés de cette plate-forme
    technologique contiennent trois trousses utilisées selon un protocole en trois phases. Une trousse
    contient des billes de silice pour la purification des acides nucléiques de la préparation cellulaire
    analysée. Une autre trousse contient des amorces, des séquences d'acides nucléiques spécifiques
    au cancer investigué, et les réactifs nécessaires à l'amplification isothermique des ARNs
    messagers isolés avec la première trousse et complémentaires aux amorces fournies. La
    troisième trousse sert à la détection immunoenzymatique du produit amplifié. Cette plate-forme
    technologique peut donc servir à la mise au point de trousses de détection de tout cancer pour
    lequel on connaît une séquence spécifique. Dans le cadre de l'accord de licence avec Organon
    Teknika, DiagnoCure détient des droits mondiaux sur les technologies Boom et NASBA, pour tous
    les cancers.
Les protéines recombinantes (PR)
   1ère: insuline dans E. coli (1982, Ely Lilly)
   73 sur le marché en 2004, >80 en essais
    cliniques
   Croissance de 65% entre 2004 et 2010
    (52G$/2010)
   Insuline+EPO+IFN = 57% du marché
   Protéines glycosylées = 60% du marché des
    PR, principalement mAb
          Les anticorps




Les anticorps sont des protéines produites par le système immunitaire pour réagir avec
un antigène donné. Ce sont des molécules de 150kDa, composées de 2 paires de
polypeptides, l’une de 25kD (chaîne courte, domaine variable), l’autre de 50 kDa
(chaîne longue, domaine constant). La chaîne courte est responsable de la spécificité de
l’anticorps pour son antigène
    Anticorps monoclonaux - applications

   37% des nouvelles molécules thérapeutiques
    biologiques
   Identification/diagnostic
   Thérapeutique:
       Contre cancer, Crohn, Asthme, Psoriasis, SIDA,...
       Dirigés contre une protéine spécifique, ils peuvent
        bloquer une interaction récepteur-ligand ou
        déclencher une réponse immunitaire.
       Ils peuvent aussi être liés à un agent
        chemothérapeutique, radioactif ou autre pour
        augmenter leur effet.
     Exemple: Agent anti-angiogénétique
     (Laboratoires Aeterna)




Le processus de l’angiogénèse, soit la formation de nouveaux
vaisseaux, joue un rôle important dans le développement de la
tumeur cancéreuse. Certains agents peuvent inhiber ce
processus. Les agents isolés par Aeterna proviennent de l’aileron
de requin. La prochaine étape consiste à isoler les gènes
responsables de la synthèse de ces agents et de les cloner dans des
micro-organismes.
        Les cellules thérapeutiques

   Cellules du sang: cellules souches hématopoïétiques, Lymphocytes,
    Mégakaryocytes, plaquettes (Hema-Québec)
   Cellules musculaires (myoblastes, Jacques Tremblay, CHUL)
   Cellules épithéliales (peau, vaisseaux sanguins, Hopital du Saint-
    Sacrement, LOEX)
   Cellules souches d'adulte et embryonnaire (Réseau canadien sur les
    cellules souches, http://www.stemcellnet.ca): travaux sur le
    traitement du diabète, la maladie de Parkinson, l'insuffisance
     cardiaque, la dystrophie musculaire, la cécité, etc
Les cellules souches hématopoïétiques
Les cellules souches embryonnaires
Les cellules souches adultes
Dystrophie Musculaire de Duchenne (DMD)

                       • Prévalence: 1 garçon/3500
                       • Espérance de vie ≈ 20 ans
Thérapie cellulaire de la DMD
                         Essais cliniques phase 1
                         3x1010 cellules/kg à traiter
                         Équivalent: 100g muscle donneur /kg à
                          traiter
                         Multiplication in vitro incontournable
                         Volumes de culture: 30L/kg à traiter
                         Prérequis:
                              Milieu de culture efficace et sécuritaire
                              Bioprocédé à grande échelle (en
                               développement)
     Caractéristiques des protéines: épissage




                                Exemple: Nyman et al (1998), "Identification of
                                nine interferon-a subtypes produced by Sendai
                                virus induced human peripheral blood
                                leucocytes". Biochem J, 329:295-302.
Source: U Miami, cours BIL150
Caractéristiques des protéines: structure




                                  Thèse PhD, François
                                  GUILLONNEAU, 2002
Caractéristiques des protéines: les
modifications post-traductionnelles
                       •Clivage
                       •Pont S
                       •méthylation, phosphorylation,
                       glycosilation
                       •conformation
                       •ajout de ligands spécifiques (lipid
                       anchor)




                                                       Tiré de PHK
Analyses protéique et cellulaire
    Analyse de protéines
         activité
         ELISA
         Électrophorèse 1D, 2D, capillaire
         Chromatographie liquide (HPLC)
         Spectrométrie de masse
    Analyse cellulaire:
         Immuno-histo-chimie
         Cytométrie en flux
         Imagerie cellulaire en temps réel
         Systèmes robotisés
Enzyme-linked immunosorbent assay (ELISA)
  Électrophorèse sur gel

SDS-PAGE
                           Transfert sur
                           membrane de
                           nitrocellulose et
                           révélation avec
                           marqueur spécifique:

                           Western: EP +
                           anticorps spécifiques
                           à protéines

                           Southern: EP + ADN
                           marqué

                           Northern: EP + ARN
                           marqué
  Électrophorèse SDS-PAGE
Tiré de Segura, Garnier et al
(2007). Figure 2. Fractionation of
purified         retroviral       vector
preparations         by      1D       Gel
            Electrophoresis
Purified virus preparations with (a) and
without (b) subtilisin treatment were
fractionated on a 4-12% Tris-Glycine
polyacrylamide gel (Invitrogen) run
under reducing conditions and visualized
by silver staining. Protein bands from
gel b were excised and subjected to in-
gel tryptic digestion prior to MS/MS
analysis. Bands containing statistically
significant peptide identifications (A-L)
are indicated on gel b. Figure 2c shows
the protein profiles of samples a (green)
and b (blue) superimposed. The
theoretical migration positions of all
MoMLV viral-encoded proteins are
indicated in figure c.
Gel d’électrophorèse 2-D




              (Échantillon de sérum sanguin, Gygi et al., 2000)
    High Pressure Liquid Chromatography (HPLC)

                        •Automatique                       •Échange d’ions
                        •Réfrigéré                         •Tamis moléculaire
                                                           •Interaction hydrophobe
                                                           •Phase inverse
                            Échantilloneur                 •Électrophorèse
Réservoir de        Pompe                     Colonne              Détecteur
Phase mobile



                              Échantillon                  Collecteur de fraction

    •En fonction                   •UV/visible
                                   •Fluorescence
    de la colonne                  •Infra-rouge
    •Gradient                      •Indice de réfraction
                                   •Conductivité
                                   •Spectrométrie de
                                   masse
Hydrolysat trypsique de la BSA
    Spectrométrie de masse (MS) - interface

   L'électro-atomisation (electro-spray ionisation, ESI)




       "Make elephants fly", Prix Nobel de Chimie 2002: John B Fenn
               MS – domaines d'application




L'électro-atomisation à pression atmosphérique (API-electrospray) permet l'analyse de protéines
MS - analyseurs

                     Constitué de:
                     1) une source d'ionisation
                     2) un ou plusieurs
                         analyseurs qui séparent
                         les ions produits selon
                         leur rapport m/z
                     3) un détecteur qui compte
                         les ions et amplifie le
                         signal
                     4) un système informatique
                         pour traiter le signal




Secteur magnétique
MS - Quadrupole


                     m/z 10-4000
                     Précision :~m/z 0.1-0.2
                     Vitesse de balayage: 5000 m/z
                      par sec
                     Le temps de vie d’un ion de sa
                      formation à sa détection ~40-
                      100 μs.




                                        www.bris.ac.uk
                MS - Temps d’envol (TOF)


       L’incorporation d’un
        réflectron dans le tube du
        TOF ou une extraction
        ionique délayée (Cornish et Cotter, 1994;
        Cotter et al., 2004)

       TOF est communément
        employé avec MALDI, il peut
        aussi être utilisé avec un ESI
        (Boyle et Whitehouse, 1992)




www.chemistry.adelaide.edu.au
LCMS – exemple d'appareil




Agilent 1100 MSD: API-ES, quadrupole
MS – exemple de résultat

                       •Myoglobine, MM= 16951 Da
                       •Le résultat obtenu est un spectre
                       de masse représentant les rapports
                       m/z des ions détectés sur l'abscisse
                       et l'abondance relative de ces ions
                       sur l'ordonnée
                       •Le spectre est le résultat de la
                       distribution de charges sur la
                       population moléculaire
                       •Permet d'analyser qualitativement
                       et quantitativement la protéine
                       d'intérêt
              Analyse de protéines par MSMS




                             Nomenclature de la dissociation en
MS spectrum                  fragments proposée par Roepstorff, 1984

                      m/z



MS/MS ion
spectrum

                      m/z

                     (Yates, 1998; Westermeier et Naven, 2002; Graves, 2002)
Exemple d'analyse MSMS

   Albumine




Protéine majeure du sérum sanguin (20-30 g/L), souvent utilisée en
milieu de culture de cellules de mammifères
    Exemple d'analyse MSMS

       Albumine

    >P02769|ALBU_BOVIN Serum albumin - Bos taurus (Bovine).
    MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF
    DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP
    ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY
    ANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA
    RLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE
    CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR
    HPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK
    LGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL
    NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP
    DTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV STQTALA


Number of amino acids: 594 Molecular weight: 68026.9 Theoretical pI: 5.77



    Informations obtenues sur Expasy (www.expasy.org)
                                                Albumine: fragments trypsiques
position   mass              peptide sequence           position   mass               peptide sequence

25-28             500,2463   DTHK                       300-309           1177,5591   ECCDKPLLEK

29-34             712,3736   SEIAHR                     310-318           1015,4877   SHCIAEVEK

37-44             974,4577   DLGEEHFK                   319-336           1955,9596   DAIPENLPPLTADFAEDK

45-65         2435,2427      GLVLIAFSQYLQQCPFDEHVK      341-346            752,3573   NYQEAK

66-75         1163,6306      LVNELTEFAK                 347-359           1567,7427   DAFLGSFLYEYSR

76-88             1349,546   TCVADESHAGCEK              361-371           1283,7106   HPEYAVSVLLR

89-100        1362,6722      SLHTLFGDELCK               375-386           1388,5708   EYEATLEECCAK

101-105           545,3405   VASLR                      387-399           1497,6314   DDPHACYSTVFDK

106-117       1364,4803      ETYGDMADCCEK               402-412           1305,7161   HLVDEPQNLIK

118-122           658,3155   QEPER                      413-420             1011,42   QNCDQFEK

123-130           977,4509   NECFLSHK                   421-433           1479,7954   LGEYGFQNALIVR

131-138           886,4152   DDSPDLPK                   438-451           1511,8427   VPQVSTPTLVEVSR

139-151       1519,7461      LKPDPNTLCDEFK              460-468           1052,4499   CCTKPESER

157-160            537,282   FWGK                       469-482           1667,8131   MPCTEDYLSLILNR

161-167           927,4934   YLYEIAR                    483-489              841,46   LCVLHEK

169-183       1888,9268      HPYFYAPELLYYANK            490-495            660,3563   TPVSEK

184-197       1633,6621      YNGVFQECCQAEDK             499-507            1024,455   CCTESLVNR

198-204           701,4014   GACLLPK                    508-523           1823,8996   RPCFSALTPDETYVPK

205-209           649,3338   IETMR                      524-528            609,2878   AFDEK

212-218           703,4097   VLASSAR                    529-544           1850,8993   LFTFHADICTLPDTEK

223-228           649,3338   CASIQK                     549-557           1014,6193   QTALVELLK

229-232           508,2514   FGER                       558-561            509,3194   HKPK

236-241           689,3729   AWSVAR                     562-568            818,4254   ATEEQLK

249-256            922,488   AEFVEVTK                   569-580           1399,6926   TVMENFVAFVDK

257-263           789,4716   LVTDLTK                    581-587            725,2593   CCAADDK

267-280       1578,5981      ECCHGDLLECADDR             588-597           1050,4924   EACFAVEGPK

281-285            517,298   ADLAK                      598-607            1002,583   LVVSTQTALA

286-297       1386,6206      YICDNQDTISSK
Analyse LC et MS1 de l'albumine trypsique
               ANALYSE MS2,   Identification de
               cliquez ici    protéine, cliquez ici
                              (Logiciel Mascot, Matrix Science)
        Protéomique du sérum sanguin

•60 à 80 g/L de protéine
(Tirumalai et al., 2003)
•10 000 protéines différentes
•22 protéines = 99% de la
quantité protéinique du
sérum (Zhang et al., 2005)
•12 log de variation de
concentration (Anderson et
Anderson, 2002; Zhang et
al., 2005)
•325 protéines identifiées en
2003 (Pieper et al.,
Proteomics, 3: 1345-1364)
•3020 protéines identifiées en
2005 (Omenn et al.,
Proteomics, 5:…)
                                 Tirumalai et al., 2003
Protéomique du sérum sanguin




                        Anderson et Anderson, 2002
     Analyse cellulaire
Le compteur de Coulter enregistre un signal provoqué par une
modification du champ électrique établi au travers d’un orifice au travers
duquel un fluide contenant les particules est aspiré. Ce signal est
proportionnel au volume des particules.




                                      Exemple: distribution de tailles de particules
                                      pour deux échantillons différents
       Immuno-histo-chimie

                                                               Technique utilisant des
                                                               anticorps spécifiques liés à
                                                               des fluorochromes pour
                                                               mettre en évidence une
                                                               protéine présente sur une
                                                               cellule ou un tissu.
                                                               L'échantillon est par la suite
                                                               observé en microscopie à
                                                               fluorescence




Distribution d'histones, de peroxisomes, et d'actine dans une culture de cellules
Vero, Olympus
Cytométrie en flux

                     Technique permettant
                     d'analyser des cellules à
                     grande vitesse en les faisant
                     passer une à une dans le
                     faisceau d'un laser. La
                     lumière ré-émise (par
                     diffusion ou fluorescence)
                     permet de classer la
                     population suivant plusieurs
                     critères et de les trier.

                     En anglais: Flow cytometry
                     ou Fluorescence Assisted Cell
                     Sorting (FACS)
Exemple de cytométrie en flux
Imagerie cellulaire en temps réel

                         Chambre thermostatée,
                         humidifiée et à
                         concentration en CO2
                         controlée, montée sur la
                         platine du microscope



                         Exemple: suivi de la
                         division et de la
                         polyploïdisation de cellules
                         mégakaryocytaires sur 12
                         hrs (cliquez ici)
    Sytèmes robotisés

   Composés:
       D'unités de gestion des liquides (Liquid
        handling stations)
       De bras robotisés
       D'incubateurs automatisés
       De lecteurs
           (Système Xiril, cliquez ici)
Développement de systèmes de production

     Établissement de lignées cellulaires
     Construction/sélection
     Procédés de production
     Procédés de séparation
Types de cellules animales
   Culture primaire: Culture initiale de cellules qui
    viennent d’être prélevées d’un tissu. Différenciée.
    Généralement à attachement obligatoire (ADC).
   Culture secondaire: Propagation d’une culture
    primaire. Création d’une lignée cellulaire. Peut être
    cultivé en suspension. Peut être indifférencié. Durée
    de vie limitée (30-50 divisions).
   Lignée immortelle ou stable. Lignée cellulaire
    transformée. Peut être cultivée en suspension. Durée
    de vie illimitée.
Différentes lignées

   MRC5, W138: secondaires, fibroblastes, poumons humains,
    adhérentes, vaccins
   HeLa: cancer cervical humain (Helen La...), stable, adhérentes,
    recherche
   CHO: ovaire de hamster chinois, stable, adhérente/suspension,
    versatile
   Vero: reins de singe verts africains, stable, adhérente, versatile
   Sf9, Spodoptera frugiperda, stable, système d’expression
    baculovirus
   HEK-293: embryon de rein humain, transformée par fragment
    d’adénovirus, stable, hôte d’adénovirus, adaptée à la suspension
    (293S)
Exemple: historique du développement de
la lignée HEK-293




Graham, et al., J. Gen. Virol., 36:59-72, 1977
 La construction d'un système d'expression
 – transformation/transfection/transduction
                      • Introduction d'ADN exogène sous la forme
                        d'un plasmide dans des cellules procaryotes
                        (transformation) ou eucaryotes (transfection)
                      •
                        Les cellules manipulées pour accepter un
                        ADN étranger sont dites compétentes

                      • Différentes méthodes:
                            • Phosphate de Calcium
                            • Liposomes
                            • Polycations (ex: polyéthylène imine,
                              PEI; DEAE-Dextran)
                            • Électroporation
                            • Gene gun
                      • Transduction: introduction d'ADN exogène
                        par le biais d'un virus (procaryote)


                      •STABLE OU TRANSITOIRE


Access Excellence
La cassette d'expression

• Composé de un ou plusieurs gènes et des séquences
  contrôlant leur expression
   • Promoteur (constitutif; inductible: lac, cumate, T,
     etc; tissu spécifique)
   • Phase ouverte de lecture (Open reading frame)
   • Séquence de polyadénylation (PolyA)
   • Transactivateurs
   • Gènes de résistance ou reporteur (LacZ, GFP, …)
Des Internal Ribosome Entry Sites (IRES) peuvent être
intercalés entre plusieurs ORFs
Autre exemple: la co-transfection d’un plasmide et d’un
adénovirus dans la lignée cellulaire 293 pour produire un
adénovirus recombinant:




B. Massie, IRB
Sélection (Screening)


• Commencer par une expression transitoire
• Sélectionner en fonction:
    • Résistance à l'agent de sélection
    • Le niveau d'expression du gène reporteur ou de la
      protéine d'intérêt
    • La stabilité de l'expression
    • La qualité du produit (analyse crystalographique, RMN,
      MS, patrons de glycosylation, activité, stabilité,
      pharmacocinétique)
         Les systèmes d’expression

                                       • Modifications post-
   Bactéries (1-3 um)                   traductionnelles + poussées
   Levures                            • Produit plus stable
                                       • Milieu de culture +
   Fungi
                                         complexe
   Cellules animales    (10-20 um)    • + grande fragilité des
                                         cellules
                                       • Coûts + élevés
                                       • Produits à + haute valeur
                                         ajoutée
          Critère de sélection: choisir le système le plus
                  simple qui va faire le travail!
              Exemple de milieu de culture de cellules de mammifères:
              Dulbecco Modified Eagle medium (DMEM)

         Sels (mg/L)                                Méthionine              30.00
                                                     Phenylalanine           66.00
              CaCl2                 200.00
                                                     Serine                  42.00
              Fe(NO3)3.9H2O           0.10
                                                     Thréonine               95.00
              KCl                   400.00
                                                     Tryptophane             16.00
              MgSO4                  97.67
                                                     Tyrosine.2Na.2H2O      104.00
              NaCl                 6400.00
                                                     Valine                  94.00
              NaHCO3               3700.00
              NaH2PO4.H2O           125.00      Vitamines (mg/L)
         Acides aminés (mg/L)                       Ca.pantothénate          4.00
                                                     Chlorure de choline      4.00
              Arginine               84.00
                                                     Acide folique            4.00
              Cystine.2HCl           63.00
                                                     Inositol                 7.20
              Glutamine             584.00
                                                     Niacinamide              4.00
              Glycine                30.00
                                                     Riboflavine              0.40
              Histidine              42.00
                                                     Thiamine.HCl             4.00
              Isoleucine            105.00
                                                     Pyridoxine.HCl           4.00
              Leucine               105.00
              Lysine.HCl            146.00      Autres (mg/L)
              Méthionine             30.00          Glucose               4500.00
              Phenylalanine          66.00          Rouge de phénol         15.00
              Sérine                 42.00          Na.Pyruvate            110.00
+ composants non-définis: sérum sanguin (5-15%), cocktail de facteurs de croissance, etc.
            Comparaison des différents
            systèmes d’expression


               X (densité         Oxygen          Vitesse     Coût du milieu
               cellulaire)     respiration rate d’agitation
                                (OUR, mM/L)
Bactéries      5-50 gMS/L          50-500       500-700 rpm      1-5$/L

Cellules        1-50 x106         0.1-10       20-120 rpm      25-1500$/L
animales         cells/mL
             (≈0,2-10 gMS/L)
       Difficulté supplémentaire
   Temps de division augmente avec la taille:
      Les cellules animales nécessitent des conditions d’asepsie très

       strictes
   Adhésion obligatoire:
      Certaines lignées de cellules de mammifères nécessitent un

       support pour être viables. Cela:
                  pose un problème de mise à l ’échelle
                  les rend particulièrement susceptibles au cisaillement




    Ex: tapis cellulaire de myoblastes         Culture sur microporteurs
                     Exemple: Culture de myoblastes
                      - test de différents microporteurs

                           Comparaison de différents types de microporteurs

                2,00E+06
# cellules/ml




                                                                                        Cytodex 1
                1,50E+06
                                                                                        Cytodex 3
                1,00E+06                                                                Texcel
                                                                                        Autosuture
                5,00E+05

                0,00E+00
                           0   2    4     6     8     10     12   14    16     18
                                              Temps (jour)


                    Boudreault, P., Tremblay, J.P., Pépin, M.F.,Garnier, A. (2001),
                    "Scale-Up of a Myoblast Cell Culture Process". J. Biotechnol., 91
                    (1):63-74.
Culture de myoblastes - transfert
de particule à particule
                                              1.0

           Myoblast density [x 10 cells/mL]
           6




                                              0.5




                                                         100-mL spinner flasks
                                                         500-mL spinner flasks
                                              0.0
                                                    0   5              10
                                                        Time [d]

Boudreault, P., Tremblay, J.P., Pépin, M.F.,Garnier, A. (2001),
"Scale-Up of a Myoblast Cell Culture Process". J. Biotechnol., 91
(1):63-74.
La production


   Le bioréacteur
   Les paramètres
   Les cinétiques de croissance des
    micro-organismes et de production
   Les modes de production
              Bioréacteurs




Laboratoire d’optimisation des bioprocédés (LOB, U. Laval)   Gracieuseté B.Braun
Bioréaction: les paramètres


   Température
   pH
   composition du milieu
   Agitation
   Aération
   Asepsie
Contrôle des paramètres

                                 F
                           p
                           H      O
                                     2
                                  N
                                   2
                                 CO2
                  T              Air
             pH
         O
         2
                      Lecture
           T
         RPM          Contrôle
Optimisation des paramètres
Effet de la température sur la production
d’adénovirus recombinant en 293S

                  100

                   80

                   60
 Relative titer




                   40

                   20

                    0

                        0       20         40           60            80


                                      time (hpi)
                            T=32°C    T=35°C       T=37°C    T=39°C

            Jardon et Garnier, 2000
                   Les cinétiques de croissance et de
                   production
              Le modèle le plus simple:
              dX
                 X                         (bilan sur les cellules)
              dt
                      S
                MAX                         (cinétique de Monod)
                  Ks  S
              dS     
                         X                  (bilan sur le substrat)
              dt    Yx / s
               dP      dX                     (modèle de Luedeking-Piret pour le produit)
                       X
               dt      dt
        K S  YX / S  X MAX   X   K S  YX / S   ( X MAX  X ) 
                               ln 
                                      
                                                      ln 
                                                                         MAX  t
                                                                                                        La solution
               X MAX           X 0   X MAX   ( X MAX  X 0 ) 

                                                                                                             X    X 
                                                           P  P0              X  X 0  K S  Yx / s  ln  MAX
                                                                                                              X               X  X 0 
                                                                       MAX                                   MAX  X 0 
                                                                                                                          
X: concentration cellulaire; S: concentration en substrat limitant; P: concentration en produit d’intérêt; : taux spécifique de
croissance; max et Ks: paramètres de l ’expression de Monod; Yx/s: coefficient de rendement cellule/substrat; , : coefficient de la
relation de Luedeking-Piret. S0 et X0, sont les concentrations en substrat et en cellules initialement. Xmax = Yx/s * S0+X0.
 Simulation à partir d’un modèle simple

                                      X, S et P vs t
   concentration (g/L)




                         25
                         20                                            X
                         15
                                                                       S
                         10
                          5                                            P
                          0
                              0   2         4          6     8
                                       temps (h)

Cuvée, MAX = 1,16h-1, KS = 4 g/L, YX/S = 0,5 g/g,  = 0,4 g/g,  = g/(g.h)
    Autres cinétiques

   Inhibition par le substrat:
                    MAX  S
          
                KS  S  S2
                               Ki

   Inhibition par le produit:
                    MAX  S
          
               K S  S 1  P 
                       
                            Ki 
                                


   ...
        Les modes d’opération



Cuvée (batch)

                Cuvée-alimentée
                  (fedbatch)

                                  Chemostat               filtrat



                  X, P
                                              Perfusion
Culture en perfusion
                                         1000




            Relative Fluorescence Unit
                                         800




                      [ RFU ]
                                         600

                                         400

                                         200

                                            0
                                                0       20           40       60   80
                                                               Time [ hpi ]

                                         Figure 4. Fluorescence of 293S cells during
                                         infection with adenovirus: , Control; ,
                                         B1 Perfusion 35oC; , B2 Perfusion 35oC; ,
                                         B3 Perfusion 37oC; X, T-flask.
                                         Cortin et al., 2002
Le traitement en aval (downstream processing)


    Les étapes
        séparation
        homogénéisation
        concentration
        purification
        Séparation/Clarification

Objectif: séparer les cellules du surnageant et conserver la
fraction d’intérêt selon que le produit est intracellulaire ou
extracellulaire
Les méthodes usuelles:
          centrifugation
          micro-filtration (0,1-0,45 um)




                                                      Filtres à fibres creuses (AG tech)



                                            Grande échelle = filtration tangentielle

Principe de centrifugation en continu
         Homogénéisation

   Objectif: briser les cellules pour récupérer un
    produit intra-cellulaire
   Moyen:
       Gel/dégel
       Ultrason
       contraintes (stress) hydrodynamiques
    Concentration


Objectif: réduire le volume

Moyens:
  Précipitation
  Ultra-centrifugation
  Ultra-filtration (5kDa - 500kDa)



                                      AG technologies
    Purification


Objectif: Isoler le
 produit d’intérêt

Moyen:
 chromatographie




                       Access Excellence
     Purification (suite)
    3 types de chromatographie:




Access Excellence
      Le contrôle de qualité

   Les molécules biopharmaceutiques sont soumises aux
    mêmes normes que la fabrication de molécules de
    synthèse:
      Bonnes pratiques de fabrication (GMP)

           Protocoles d’opération normalisés (SOP)
           Validation des procédés
           Documentation
   Ces normes sont appliquées de façon encore plus stricte
    pour les produits biologiques étant donné que les
    réactions menant à la formation du produit (le
    métabolisme cellulaire) ne sont pas bien définies.
             Le contrôle de qualité (suite)

   Toute une série de normes, lignes directrices et de «points à
    considérer » sont émis par le « Center for Biologics Evaluation
    and Research » (CBER) de la Food &Drug Administration »
    (FDA) http://www.fda.gov/cber/
   Les sections 210, 211 et 600 du titre 21 du "Code of Federal
    Regulations" (CFR)
   "Guidelines" et "point to consider » particulièrement pertinents:
           "Guidance for Human Somatic Cell Therapy and Gene Therapy"
           "Point to consider on Plasmid DNA Vaccines for Preventative
            Infectious Disease Indications"
           A proposed Approach to the Regulation of Cellular and Tissue-
            based Products
    Le contrôle de qualité (suite)

   Classent le processus de production GMP en 7
    catégories:

        Installation
        Équipement
        Personnel
        Matériels
        Protocoles
        Tests
        Documentation

				
DOCUMENT INFO
Shared By:
Categories:
Tags:
Stats:
views:0
posted:1/1/2013
language:Unknown
pages:108