Docstoc

LP thypoid

Document Sample
LP thypoid Powered By Docstoc
					Pengertian

       Typhoid          adalahpenyakitinfeksisistemikakut     yang   disebabkaninfeksi       salmonella
Thypi.Organismeinimasukmelaluimakanandanminuman yang sudahterkontaminasiolehfaesesdan
urine dari orang yang terinfeksikuman salmonella.( Bruner and Sudart, 1994 ).

       Typhoid adalahpenyakitinfeksiakutusushalus yang disebabkanolehkuman salmonella
Thypi (AriefMaeyer, 1999).

       Typhoid adalahpenyakitinfeksiakutusushalus yang disebabkanolehkuman salmonella
thypidan salmonella parathypi A,B,C. sinonimdaripenyakitiniadalah Typhoid dan paratyphoid
abdominalis, ( SyaifullahNoer, 1996 ).

       Typhoid adalahpenyakitinfeksipadausushalus, typhoid disebutjuga paratyphoid fever,
enteric fever, typhus danpara typhus abdominalis (.Seoparman, 1996).

       Typhoid adalahsuatupenyakitpadausus yang menimbulkangejala-gejalasistemik yang
disebabkanoleh salmonella typhosa, salmonella type A.B.C. penularanterjadisecarapecal, oral
melaluimakanandanminuman yang terkontaminasi (MansoerOrief.M. 1999).

       Dari beberapapengertiandiatasisdapatdisimpulkansebagaiberikut, Typhoid
adalahsuatupenyakitinfeksiusushalus yang disebabkanoleh salmonella type A. B dan C yang
dapatmenularmelalui oral, fecal, makanandanminuman yang terkontaminasi.

2. Etiologi

Etiologi      typhoid     adalah   salmonella    typhi.Salmonella    paratyphi   A.      B    dan   C.
adaduasumberpenularan               salmonella        typhiyaitupasiendengandemam              typhoid
danpasiendengancarier.Carieradalah           orang          yang     sembuhdaridemam           typhoid
danmasihterusmengekresi salmonella typhidalamtinjadan air kemihselamalebihdari 1 tahun.




3. Patofisiologi



http://www.submitlist.info
            Penularan salmonella thypidapatditularkanmelaluiberbagaicara, yang dikenaldengan 5F
   yaituFood(makanan), Fingers(jaritangan/kuku), Fomitus (muntah), Fly(lalat), danmelaluiFeses.

            Fesesdanmuntahpadapenderita typhoid dapatmenularkankuman salmonella thypikepada
   orang                  lain.                     Kumantersebutdapatditularkanmelaluiperantaralalat,
   dimanalalatakanhinggapdimakanan yang akandikonsumsioleh orang yang sehat. Apabila orang
   tersebutkurangmemperhatikankebersihandirinyasepertimencucitangandanmakanan                    yang
   tercemarkuman                salmonella           thypimasukketubuh            orang          yang
   sehatmelaluimulut.Kemudiankumanmasukkedalamlambung,
   sebagiankumanakandimusnahkanolehasamlambungdansebagianlagimasukkeusushalusbagian
   distal     danmencapaijaringanlimpoid.     Di       dalamjaringanlimpoidinikumanberkembangbiak,
   lalumasukkealirandarahdanmencapaisel-selretikuloendotelial.                                    Sel-
   selretikuloendotelialinikemudianmelepaskankumankedalamsirkulasidarahdanmenimbulkanbakte
   rimia, kumanselanjutnyamasuklimpa, usushalusdankandungempedu.

            Semuladisangkademamdangejalatoksemiapada                                          typhoid
   disebabkanolehendotoksemia.Tetapiberdasarkanpenelitianeksperimentaldisimpulkanbahwaendot
   oksemiabukanmerupakanpenyebabutamademampada
   typhoid.Endotoksemiaberperanpadapatogenesis              typhoid,     karenamembantu        proses
   inflamasilokalpadausushalus.                     Demamdisebabkankarena                  salmonella
   thypidanendotoksinnyamerangsangsintetisdanpelepasanzatpirogenolehleukositpadajaringan yang
   meradang.



   4. ManifestasiKlinik

   Masatunas typhoid 10 – 14 hari

a) Minggu I
   padaumumnyademamberangsurnaik, terutama sore haridanmalamhari.
   Dengankeluhandangejalademam, nyeriotot, nyerikepala, anorexia danmual, batuk, epitaksis,
   obstipasi / diare, perasaantidakenak di perut.




   http://www.submitlist.info
b) Minggu II
    padaminggu II gejalasudahjelasdapatberupademam, bradikardi, lidah yang khas (putih, kotor,
    pinggirnyahiperemi), hepatomegali, meteorismus, penurunankesadaran.

    5. Komplikasi

a) Komplikasi intestinal
             1. Perdarahanusus
             2. Perporasiusus
             3.Iliusparalitik

b) Komplikasi extra intestinal
            1. Komplikasikardiovaskuler :kegagalansirkulasi (renjatan sepsis), miokarditis,
                 trombosis, tromboplebitis.
            2. Komplikasidarah : anemia hemolitik, trobositopenia, dansyndroma uremia hemolitik.
            3. Komplikasiparu : pneumonia, empiema, danpleuritis.
            4. Komplikasipadahepardankandungempedu : hepatitis, kolesistitis.
            5. Komplikasiginjal : glomerulus nefritis, pyelonepritisdanperinepritis.
            6. Komplikasipadatulang :osteomyolitis, osteoporosis, spondilitisdan arthritis.
            7. Komplikasineuropsikiatrik : delirium, meningiusmus, meningitis, polineuritisperifer,
                 sindromaGuillain bare dansidromakatatonia.

    6. Penatalaksanaan

a. Perawatan.
            1.         Kliendiistirahatkan         7          harisampaidemamtulangatau           14
                 hariuntukmencegahkomplikasiperdarahanusus.
            2.                                                   Mobilisasibertahapbilatidakadapanas,
                 sesuaidenganpulihnyatranfusibilaadakomplikasiperdarahan.

b. Diet.
            1. Diet yang sesuai ,cukupkaloridantinggi protein.
            2. Padapenderita yang akutdapatdiberibubursaring.


    http://www.submitlist.info
           3. Setelahbebasdemamdiberibuburkasarselama 2 harilalunasitim.
           4. Dilanjutkandengannasibiasasetelahpenderitabebasdaridemamselama 7 hari.

c. Obat-obatan.
           1. Klorampenikol
           2. Tiampenikol
           3. Kotrimoxazol
           4. Amoxilindan ampicillin

   7. Pencegahan

   Cara pencegahan yang dilakukanpadademam typhoid adalahcucitangansetelahdari toilet
   dankhususnyasebelummakanataumempersiapkanmakanan,         hindariminumsusumentah    (yang
   belumdipsteurisasi),         hindariminum        air        mentah,        rebus      air
   sampaimendidihdanhindarimakananpedas
   http://hidayat2.wordpress.com




   http://www.submitlist.info

				
DOCUMENT INFO
Shared By:
Categories:
Tags:
Stats:
views:13
posted:12/31/2012
language:Indonesian
pages:4