Docstoc

molecules-list-2009-05-26

Document Sample
molecules-list-2009-05-26 Powered By Docstoc
					Molecule name      PDB ID   Molecule type
ACTAGARDINE        1aj1     Antibiotics, MH
ACTINOMYCIN        1unj     Antibiotics, MH
ACTINOMYCIN        1unm     Antibiotics, MH
ACTINOMYCIN        1qfi     Antibiotics, MH
ACTINOMYCIN        1l1v     Antibiotics, MH
ACTINOMYCIN        1mnv     Antibiotics, MH
ACTINOMYCIN        1ovf     Antibiotics, MH
ACTINOMYCIN        1dsc     Antibiotics, MH
ACTINOMYCIN        1dsd     Antibiotics, MH
ACTINOMYCIN        1fja     Antibiotics, MH
ACTINOMYCIN        1i3w     Antibiotics, MH
ACTINOMYCIN        1cwm     Antibiotics, MH
ACTINOMYCIN        1cwj     Antibiotics, MH
ACTINOMYCIN        1a7y     Antibiotics, MH
ACTINOMYCIN        1a7z     Antibiotics, MH
ACTINOMYCIN        173d     Antibiotics, MH
ACTINOMYCIN        2d55     Antibiotics, MH
ACTINOMYCIN        316d     Antibiotics, MH
AMPHOMYCIN         1w3w     Antibiotics, MH
BACILLOMYCIN       2ih0     Antibiotics, MH
BACILLOMYCIN       2igz     Antibiotics, MH
CALICHEAMICIN      1qms     Antibiotics, MH
CALICHEAMICIN      2pik     Antibiotics, MH
CEPHAIBOL          1ob7     Antibiotics, MH
CEPHAIBOL          1ob4     Antibiotics, MH
CEPHAIBOL          1ob6     Antibiotics, MH
ANTIAMOEBIN        1gq0     Antibiotics, MH
ANTIAMOEBIN        1joh     Antibiotics, MH
ZERVAMICIN         1dlz     Antibiotics, MH
ZERVAMICIN         1ih9     Antibiotics, MH
ZERVAMICIN         1r9u     Antibiotics, MH
CHRYSOSPERMIN-C    1ee7     Antibiotics, MH
ALAMETHICIN        1amt     Antibiotics, MH
TRICHOTOXIN_A50E   1m24     Antibiotics, MH
CHROMOMYCIN        1d83     Antibiotics, MH
CHROMOMYCIN        1vaq     Antibiotics, MH
CHROMOMYCIN        1ekh     Antibiotics, MH
CHROMOMYCIN        1eki     Antibiotics, MH
CINNAMYCIN         2dde     Antibiotics, MH
Cyclo-RRWWRF       1skl     Antibiotics, MH
Cyclo-RRWWRF       1ski     Antibiotics, MH
Cyclo-RRWWRF       1qvk     Antibiotics, MH
Cyclo-RRWWRF       1qvl     Antibiotics, MH
CYCLOSPORIN        3cys     Antibiotics, MH
CYCLOSPORIN        1cwa     Antibiotics, MH
CYCLOSPORIN        1m63     Antibiotics, MH
CYCLOSPORIN        1mik     Antibiotics, MH
CYCLOSPORIN        1cwh     Antibiotics, MH
CYCLOSPORIN        1cwl     Antibiotics, MH
CYCLOSPORIN        1csa     Antibiotics, MH
CYCLOSPORIN        1cya     Antibiotics, MH
CYCLOSPORIN       1cyb   Antibiotics, MH
CYCLOSPORIN       2rma   Antibiotics, MH
CYCLOSPORIN       2rmc   Antibiotics, MH
CYCLOSPORIN       3cys   Antibiotics, MH
CYCLOSPORIN       1c5f   Antibiotics, MH
CYCLOSPORIN       1cyn   Antibiotics, MH
CYCLOSPORIN       1mf8   Antibiotics, MH
CYCLOSPORIN       1qng   Antibiotics, MH
CYCLOSPORIN       1qnh   Antibiotics, MH
CYCLOSPORIN       1xq7   Antibiotics, MH
CYCLOSPORIN       2esl   Antibiotics, MH
CYCLOSPORIN       2oju   Antibiotics, MH
CYCLOSPORIN       2poy   Antibiotics, MH
CYCLOSPORIN       2z6w   Antibiotics, MH
CYCLOSPORIN       3bo7   Antibiotics, MH
CYCLOSPORIN       1cwc   Antibiotics, MH
CYCLOSPORIN       1cwo   Antibiotics, MH
CYCLOSPORIN       1bck   Antibiotics, MH
CYCLOSPORIN       1cwi   Antibiotics, MH
CYCLOSPORIN       1cwf   Antibiotics, MH
CYCLOSPORIN       1ikf   Antibiotics, MH
CYCLOSPORIN       1cwb   Antibiotics, MH
CYCLOSPORIN       2rmb   Antibiotics, MH
CYCLOSPORIN       1cwm   Antibiotics, MH
CYCLOSPORIN       1cwj   Antibiotics, MH
CYCLOSPORIN       1cwk   Antibiotics, MH
DAPTOMYCIN        1xt7   Antibiotics, MH
DAPTOMYCIN        1t5m   Antibiotics, MH
DAPTOMYCIN        1t5n   Antibiotics, MH
DE NOVO PROTEIN   1r9v   Antibiotics, MH
DESIGNER          1o9m   Antibiotics, MH
ECHINOMYCIN       2adw   Antibiotics, MH
ECHINOMYCIN       1xvn   Antibiotics, MH
ECHINOMYCIN       1xvr   Antibiotics, MH
ECHINOMYCIN       1xvk   Antibiotics, MH
ECHINOMYCIN       1pfe   Antibiotics, MH
ENFRAPEPTIN       1efr   Antibiotics, MH
EPILANCIN         1w9n   Antibiotics, MH
ESPERAMICIN       1pik   Antibiotics, MH
FEGLYMYCIN        1w7r   Antibiotics, MH
FEGLYMYCIN        1w7q   Antibiotics, MH
GENTAMICIN        1byj   Antibiotics, MH
GRAMICIDIN        1kqe   Antibiotics, MH
GRAMICIDIN        1nt5   Antibiotics, MH
GRAMICIDIN        1nt6   Antibiotics, MH
GRAMICIDIN        1al4   Antibiotics, MH
GRAMICIDIN        1alz   Antibiotics, MH
GRAMICIDIN        1tkq   Antibiotics, MH
GRAMICIDIN        1jo3   Antibiotics, MH
GRAMICIDIN        1ng8   Antibiotics, MH
GRAMICIDIN        1c4d   Antibiotics, MH
GRAMICIDIN        2izq   Antibiotics, MH
GRAMICIDIN         1alx   Antibiotics, MH
GRAMICIDIN         1av2   Antibiotics, MH
GRAMICIDIN         1bdw   Antibiotics, MH
GRAMICIDIN         1gmk   Antibiotics, MH
GRAMICIDIN         1jno   Antibiotics, MH
GRAMICIDIN         1mag   Antibiotics, MH
GRAMICIDIN         1mic   Antibiotics, MH
GRAMICIDIN         1nrm   Antibiotics, MH
GRAMICIDIN         1nru   Antibiotics, MH
GRAMICIDIN         1w5u   Antibiotics, MH
GRAMICIDIN         1jo4   Antibiotics, MH
GRAMICIDIN         1tk2   Antibiotics, MH
KALATA-B1          2jue   Antibiotics, MH
LIPOPEPTIDE        1t7d   Antibiotics, MH
LIPOPEPTIDE        1xt7   Antibiotics, MH
LIPOPEPTIDE        1w3m   Antibiotics, MH
LIPOPEPTIDE        2igz   Antibiotics, MH
LIPOPEPTIDE        1xz0   Antibiotics, MH
LIPOPEPTIDE        2npv   Antibiotics, MH
LIPOPEPTIDE        2z7x   Antibiotics, MH
LIPOPEPTIDE        2z81   Antibiotics, MH
LIPOPEPTIDE        2z82   Antibiotics, MH
LIPOPEPTIDE        1t5m   Antibiotics, MH
LIPOPEPTIDE        1t5n   Antibiotics, MH
NOSIHEPTIDE        2zjp   Antibiotics, MH
MERSACIDIN         1qow   Antibiotics, MH
MERSACIDIN         1mqx   Antibiotics, MH
MERSACIDIN         1mqy   Antibiotics, MH
MERSACIDIN         1mqz   Antibiotics, MH
MITHRAMYCIN        146d   Antibiotics, MH
MITHRAMYCIN        1bp8   Antibiotics, MH
MITHRAMYCIN        207d   Antibiotics, MH
NISIN              1wco   Antibiotics, MH
QUINOMYCIN         193d   Antibiotics, MH
SURFACTIN          2npv   Antibiotics, MH
RAMOPLANIN         1dsr   Antibiotics, MH
GEA2270a           1d8t   Antibiotics, MH
GEA2270a           2c77   Antibiotics, MH
THIOSTREPTON       1oln   Antibiotics, MH
THIOSTREPTON       2jq7   Antibiotics, MH
THIOSTREPTON       1e9w   Antibiotics, MH
THIOSTREPTON       3cf5   Antibiotics, MH
TOBRAMYCIN         2tob   Antibiotics, MH
TOBRAMYCIN         1tob   Antibiotics, MH
TOBRAMYCIN         1lc4   Antibiotics, MH
TOBRAMYCIN         1m4d   Antibiotics, MH
TRICHOTOXIN_A50E   1m24   Antibiotics, MH
TRIOSTIN           1vs2   Antibiotics, MH
TRIOSTIN           185d   Antibiotics, MH
TANDEM             2da8   Antibiotics, MH
UCH9               1cp8   Antibiotics, MH
TSUSHIMYCIN        1w3m   Antibiotics, MH
ALPHA-AMANITIN      2vum   Antibiotics, MH
ALPHA-AMANITIN      1k83   Antibiotics, MH
VANCOMYCIN          1qd8   Antibiotics, MH
VANCOMYCIN          1c0r   Antibiotics, MH
VANCOMYCIN          1aa5   Antibiotics, MH
VANCOMYCIN          1fvm   Antibiotics, MH
VANCOMYCIN          1c0q   Antibiotics, MH
VANCOMYCIN          1pnv   Antibiotics, MH
VANCOMYCIN          1sho   Antibiotics, MH
VANCOMYCIN          1van   Antibiotics, MH
VANCOMYCIN          2pte   Antibiotics, MH
VANCOMYCIN          1rrv   Antibiotics, MH
VANCOMYCIN          1pn3   Antibiotics, MH
VANCOMYCIN          1gac   Antibiotics, MH
VANCOMYCIN          1ghg   Antibiotics, MH
DEGLUCOBALHIMYCIN   1hhz   Antibiotics, MH
DEGLUCOBALHIMYCIN   1hhy   Antibiotics, MH
BALHIMYCIN          1go6   Antibiotics, MH
pdb_id   Molecule name (SD)   ligand synonym (HS) molecule type pdbx_seq_one_letter_code

                                                 was already
                                                 combined, add
2bed     piperazine deriv.                       annotation    736

                                                 was already
                                                 combined, add
1cow     Aurovertin B                            annotation    AUR

                                                 was already
                                                 combined, add
2q8g     AZD7545                                 annotation    AZX

                                                 was already
                                                 combined, add
1gw6     bestatin                                annotation    BES

                                                 was already
                                                 combined, add
1hs6     bestatin                                annotation    BES

                                                 was already
                                                 combined, add
1txr     bestatin                                annotation    BES

                                                 was already
                                                 combined, add
1xry     bestatin                                annotation    BES

                                                 was already
                                                 combined, add
2dqm     bestatin                                annotation    BES

                                                 was already
                                                 combined, add
2ek9     bestatin                                annotation    BES

                                                 was already
                                                 combined, add
2hpt     bestatin                                annotation    BES

                                                 was already
                                                 combined, add
2zof     bestatin                                annotation    BES

                                                 was already
                                                 combined, add
2zog     bestatin                                annotation    BES
                       was already
                       combined, add
1blc   clavulanate     annotation    CEM

                       was already
                       combined, add
1d43   PIPERAZINE      annotation    HT

                       was already
                       combined, add
1d44   PIPERAZINE      annotation    HT

                       was already
                       combined, add
1d45   PIPERAZINE      annotation    HT

                       was already
                       combined, add
1d46   PIPERAZINE      annotation    HT

                       was already
                       combined, add
1e7u   wortmanin       annotation    KWT

                       was already
                       combined, add
1e7v   LY294002        annotation    LY2

                       was already
                       combined, add
1yi3   LY294003        annotation    LY3

                       was already
                       combined, add
2chw   quinazolinone   annotation          39

                       was already
                       combined, add
1ouk   quinazolinone   annotation    085

                       was already
                       combined, add
2chx   quinazolinone   annotation    090

                       was already
                       combined, add
2chz   quinazolinone   annotation    093

                       was already
                       combined, add
1ouy   quinazolinone   annotation    094
                                                        was already
                                                        combined, add
1ove   quinazolinone                                    annotation    358

                                                        was already
                                                        combined, add
1wok   quinazolinone                                    annotation    cnq

                                                        was already
                                                        combined, add
1uk1   quinazolinone                                    annotation      FRQ
1jaq   inhibitor                                        inhib-comb      HMI--ASP--GMI
1RHK   Ac-DEVD-CHO             inhibitor2               inhib-comb      (ACE)DEVD
1JAO   inhibitor                                        inhib-comb      BTP ASP GM1
                               Ac-
                               (Cha)RAM(CAcm)SL-
1D5M                           NH2               inhib-comb             (ACE)(ALC)RAM(CY1)S(CLE)
2iae                           Microcystin-LR    inhib-comb             y
1MEM   inhibitor               APC3328           inhib-comb             BZP LEU NFP BNS
       Ac-Leu-Ala-Ala-
2Z3D   cycloGln                                         inhib-comb      (ACE)LAA
                                PEPTIDYL
                                ALPHA,ALPHA-
       peptidyl a,a-difluoro-0- DIFLUORO-BETA-
4EST   keto amide               KETO AMIDE              inhib-comb      (ACE)APV
2je4                            JG-365                  inhib-comb
2j9j                            JG-365                  inhib-comb
        N-(1-(2(RS)-
       CARBOXY-4-               CCT; N-( 1 -(2(R,S)-
       FNYLBUTYL)               carboxy-4-
       CYCLOPENTYLCAR phenylbutyl)-
       BONYL)-(S)-              cyclopentylcarbonyl)-
1thl   TRYPTOPHAN               (S)-tryptophan          inhib-comb      CLT-CCM-TRP
2J30                            AC-deVD-Cho             inhib-comb
2j31                            AC-deVD-Cho             inhib-comb
2j32                            AC-deVD-Cho             inhib-comb
                                Ac-DEVD-cmk; N-
                                acetyl-Asp-Glu-Val-
                                Asp-chloromethyl-
1M72   Ac-DEVD-CMK              ketone                  inhib-comb      (ACE)DEV(ASK)
                                Acetyl-Asp-Val-Ala-
                                Asp Fluoromethyl
1CP3   Ac-DVAD-FMK              Ketone                  inhib-comb      (ACE)DVA(ASK)
                                B-IAF;B-IPF; Ac-IPF-
1GTL   Ac-IPF-CHO               CHO                     inhib-comb      ACE ILE PRO PHE
                                B-IAF;B-IPF; Ac-IPF-
1SIO   Ac-IPF                   CHO                     inhib-comb      (ACE)IPF
1PYO   Ac-LDESD-CHO             Ac-LDESD-cho            inhib-comb      (ACE)LDESD
2HAL   Ac-LFFE-FMK              Ac-LFFE-FMK             inhib-comb      (ACE)LFF(MKE)(EKE)
       Ac-NA-Val-Leu-Ala-       Ac-NA-Val-Leu-Ala-
3FIV   Glu-NA-NH2               Glu-NA-NH2              inhib-comb      (ACE)(NAL)VLAE(NAM)
1IDB   inhibitor                inhibitor7               inhib-comb   DBA PHM PPL SPY
2SEM                            YEVPPPVPPRRR             inhib-comb   (ACE)PPPV(IPG)PRR
2id4   Ac-RERK-CMK              Ac-R-E-R-K-CMK           inhib-comb   ACE R E R LYM
                                 N-(R-carboxy-ethyl)-
                                a-(S)-(2-phenylethyl)-
                                glycyl-L-arginine-N-
1UMT   inhibitor                phenyl amide             inhib-comb   HAE MOP LEU PHE NH2
2wpo   inhibitor                BILC 821                 inhib-comb   DTG - TBG - ASM
       Ac-T-I-Nle-r-Nle-Q-R
       amide (r is the
       reduced peptide
1FGC   bond)                    p2-NC inhibitor          inhib-comb   (ACE)TI(NLE)(NLE)QR
       Ac-T-I-Nle-r-Nle-Q-R
       amide (r is the
       reduced peptide
1FEJ   bond)                    p2-NC inhibitor          inhib-comb   (ACE)TI(NLE)(NLE)QR
       Ac-T-I-Nle-r-Nle-Q-R
       amide (r is the
       reduced peptide
1FFI   bond)                    p2-NC inhibitor          inhib-comb   (ACE)TI(NLE)(NLE)QR
       Ac-T-I-Nle-r-Nle-Q-R
       amide (r is the
       reduced peptide
1FF0   bond)                    p2-NC inhibitor          inhib-comb   (ACE)TI(NLE)(NLE)QR
       Ac-T-I-Nle-r-Nle-Q-R
       amide (r is the
       reduced peptide
1FG6   bond)                    p2-NC inhibitor          inhib-comb   (ACE)TI(NLE)(NLE)QR
       HONH-iBM-Asn-            HONH-iBM-Asn-
1a85   NHBn(m-NH2)              NHBn(m-NH2)              inhib-comb   HMI DSG DBP

       Ac-Val-Benzyl Thr-
2Z3C   Leu-cycloGln inhibitor inhibitor (a)              inhib-comb   (ACE)VTL

       Ac-Val-Benzyl Thr-
2Z3C   Leu-cycloGln inhibitor inhibitor (a)              inhib-comb   (ACE)VTL

       Ac-Val-Benzyl Thr-     inhibitor (a), inhibitor
2Z3E   Leu-cycloGln inhibitor (a)                        inhib-comb   (ACE)VTL
1ICE   Ac-YVAD-CHO                                       inhib-comb   (ACE)YVAD
                              benzyloxycarbonyl-
                              Arg-Ser(O-Bzl)
1THE   Z-R-Ser(O-Bzl)-CMK chloromethylketone             inhib-comb   CBZ ARG SEM
       4-guanidino butyryl-
       Phe-alloThr-Phe-O-
1HDT   CH3                    BMS-183507                 inhib-comb   (ALG)F(ALO)(0A9)
1odw   inhibitor              BMS-182193                 inhib-comb   BOC HPH BOC
1odx   inhibitor              BMS-182193                 inhib-comb   BOC HPH HPH BOC
                             A-74704// 1,5-
                             DANSYL-GLU-GLY-
                             ARG-
                             CHLOROMETHYL
9hvp   Z-inhibitor           KETONE          inhib-comb           PHQ -- VAL -- PHQ
7kme   inhibitor                             inhib-comb           BNN CHG PRR

1cgl   Z-inhibitor            collagenase inhibitor inhib-comb    PHQ ABU L F EMR
2qlj   AC-WEHD-CHO                                   inhib-comb   W E H ASA
                              N-(TERT-
       tert-                  BUTOXYCARBONYL-
       butoxycarbonyl)alanyl ALANYL-PROLYL-
       prolylphenylalanyl)-O- PHENYLALANYL)-O-
       nitrobenzoy            BENZOYL
1SCN   lhydroxylamine         HYDROXYLAMINE inhib-comb            (BOC)AP(APE)
                              N-tert-
                              butyloxycarbonylalan
                              ylprolylvaline boronic
1p01   inhibitor              acid                   inhib-comb   BOC A P B2V
5er2   inhibitor              CP-69,799              inhib-comb   BOC F H AHS K F
3er3   inhibitor                                     inhib-comb   BOC F H CAL K F
1gvw   pd- 130328             PD-130,328             inhib-comb   BOC F H PTA DCI
1ENT   pd- 130328             PD-130,328             inhib-comb   (BOC)FH(PTA)(DCI)
1eed   inhibitor              PD125754               inhib-comb   BOC FOG CHS L
1OEX                                                 inhib-comb   (BOC)HPFA(LOV)IH
       t-Boc-His-Pro-Phe-His-
       LeuOHVal-Ile-His
1gkt   (inhibitor H261)       INHIBITOR H261         inhib-comb   BOC H P F H LOV I H
       t-Boc-His-Pro-Phe-His-
       LeuOHVal-Ile-His
2er7   (inhibitor H261)       INHIBITOR H261         inhib-comb   BOC H P F H LOV I H
2ER9                                                 inhib-comb   (BOC)HPFH(STA)LF(NH2)
1mtr   inhibitor              compound 6             inhib-comb   BOC PR0 Y I G
1mhw   inhibitor              compound 13            inhib-comb   BP4 C DAR Y PEA
1DY8                                                 inhib-comb   (CBZ)IL(FKI)
                              Cbz-dehydro-Leu-Val-
1tg1   Z-LVRY                 Arg-Tyr                inhib-comb   CBZ-DEHYDRO-L-V-R-Y
                              Phosphoramidate N-
                              phosphoryl-L-
                              leucinamide; P-Leu-
2TMN   inhibitor              NH2                    inhib-comb   PHO LEU NH2
                              PHOSPHORAMIDAT
2TMN                          ES                     inhib-comb

                               ?? // GLUTATHIONE
                               MEISENHEIMER
1AQX   inhibitor, intermediate COMPLEX              inhib-comb    (ILG)(TNB)G
1qz0   inhibitor                DADE-pY-L-NH2       inhib-comb    D A D E FTY CLE
3bv9   inhibitor               FM19                 inhib-comb    DAR OIC P DAL 4PH
2cjx   Z-DEVD-CMK              Z-DEVD-CMK           inhib-comb    DEV(AKL)
2cjy   Z-DEVD-CMK              Z-DEVD-CMK           inhib-comb    DEV(AKL)
2DKO   Z-DEVD-CMK              Z-DEVD-CMK           inhib-comb    DEV(AKL)
       RVKR-CMK, inhibitor;
1P8J   DKA deriv                                inhib-comb    (DKA) ARG VAL LYS (MAI)
1AFQ                                            inhib-comb   (DLE)F(FBA)
                                                             DLY DLY G DAL DCY DGL DSN
                                                             DPR DGL DTR DGN DTR DLE
2r3c   inhibitor                                inhib-comb   DCY DAL DAL
                                                             DLY G DAL DCY DAS DTY DPR
                                                             DGL DTR DGN DTR DLE DCY
2r5d   inhibitor                                inhib-comb   DAL DAL
                                                             DLY G DAL DCY DAS DTY DPR
                                                             DGL DTR DGN DTR DLE DCY
2r5b   inhibitor                                inhib-comb   DAL DAL
2qlf   AC-DNLD-CHO            AC-DNLD-CHO       inhib-comb   D N L ASA
1nkm   BILC 408               inhibitor 2       inhib-comb   DNL TBG TBG DMH A
1jq7   BILC 408               inhibitor 2       inhib-comb   DNL TBG TBG DMH A
1nju   BILC 408               inhibitor 2       inhib-comb   DNL TBG TBG DMH A
       PPACK (D-FPR-
1tmt   CMK)                                     inhib-comb   ARG+PRO+PHE
       PPACK (D-FPR-
1aut   CMK)                   FFRCK; PPACK II   inhib-comb   DPN P MAI (--SER)
       PPACK (D-FPR-
1thp   CMK)                   FFRCK; PPACK II   inhib-comb
       PPACK (D-FPR-
1SHH   CMK)                   FFRCK; PPACK II   inhib-comb   (DPN)P(MAI)
       PPACK (D-FPR-
1Z8I   CMK)                   FFRCK; PPACK II   inhib-comb   FP(ARM)
       PPACK (D-FPR-
1Z8J   CMK)                   FFRCK; PPACK II   inhib-comb   FP(ARM)
       PPACK (D-FPR-
2a1d   CMK)                   FFRCK; PPACK II   inhib-comb   DPN P ARM
       PPACK (D-FPR-
1tmu   CMK)                   PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
       PPACK (D-FPR-
1TQ7   CMK)                   FFRCK; PPACK II   inhib-comb   (DPN)PR
       PPACK (D-FPR-
1XMN   CMK)                   FFRCK; PPACK II   inhib-comb   (DPN)P(MAI)
       PPACK (D-FPR-
2a45   CMK)                   FFRCK; PPACK II   inhib-comb   DPN P ARM
       PPACK (D-FPR-
2od3   CMK)                   FFRCK; PPACK II   inhib-comb   DPN P ARM
       PPACK (D-FPR-
2pgq   CMK)                   FFRCK; PPACK II   inhib-comb   DPN P ARM
       PPACK (D-FPR-
2THF   CMK)                   PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
       PPACK (D-FPR-
2FIR   CMK)                   FFRCK; PPACK II   inhib-comb   (DPN)P(ACL)
       PPACK (D-FPR-
2hpp   CMK)                   PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
       PPACK (D-FPR-
1a0h   CMK)                   FFRCK; PPACK II   inhib-comb   DPN P R
       PPACK (D-FPR-
1hai   CMK)                   PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
       PPACK (D-FPR-
1hao   CMK)                    PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
       PPACK (D-FPR-
1hap   CMK)                    PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
       PPACK (D-FPR-
1abj   CMK)                    PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
       PPACK (D-FPR-
1dwe   CMK)                    PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
       PPACK (D-FPR-
1fxy   CMK)                    FFRCK; PPACK II   inhib-comb   DPN P R
       PPACK (D-FPR-
1orf   CMK)                    FFRCK; PPACK II   inhib-comb   DPN P MAI
       PPACK (D-FPR-
1ppb   CMK)                    PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
       PPACK (D-FPR-
1SFQ   CMK)                    FFRCK; PPACK II   inhib-comb   (DPN)P(MAI)
       PPACK (D-FPR-
1hlt   CMK)                    PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
       PPACK (D-FPR-
1hut   CMK)                    PPACK, or FPRCK   inhib-comb   DPN PRO ARG CH2
       PPACK (D-FPR-
2hpq   CMK)                    PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
       PPACK (D-FPR-
1nrr   CMK)                    PPACK, or FPRCK   inhib-comb   PHE PRO ARG CH2
1QVH                           fFRCK; PPACK II   inhib-comb
3f6u                           fFRCK; PPACK II   inhib-comb
2ql9   AC-DQMD-CHO             AC-DQMD-CHO       inhib-comb   D Q M ASA
2puq   inhibitor                                 inhib-comb   DTR Y T R
1S4V   DVA-LK-CMK                                inhib-comb   (DVA)L(LYM)
       EGR-CMK, inhibitor
1cvw   (dansyl deriv at E)                       inhib-comb   E G ARM
1dx5   EGR-CMK, inhibitor      EGR-CMK           inhib-comb   E G ARM
1A5I   EGR-CMK, inhibitor      EGR-CMK           inhib-comb   GLU GLY ARG CH2
2B8O   EGR-CMK, inhibitor      EGR-CMK           inhib-comb   EG(ACL)
1lmw   EGR-CMK, inhibitor      EGR-CMK           inhib-comb   E G MAI
1bqy   EGR-CMK, inhibitor      EGR-CMK           inhib-comb   E G MAI
1bui   EGR-CMK, inhibitor      EGR-CMK           inhib-comb   E G MAI
1M4H   inhibitor               OM00-3            inhib-comb   ELD(LOL)(ALQ)VEF
2qlb   AC-ESMD-CHO             AC-ESMD-CHO       inhib-comb   E S M ASA
1GVV                           CP-129,541        inhib-comb   E(STA)L(TRJ)
       Ala-Ala-Phe-psi-[(S)-
       CH(OH)CH2]-Gly-Val-
1HEG   Val-Ome                                   inhib-comb   AA(PS0)GV(0AB)
1JXQ   Z-EVD-Dcbmk                               inhib-comb   EV(ASK)

       Z-EVD-
1QDU   dichloromethylketone Z-EVD-Dcbmk          inhib-comb   EV(ASK)
1E80                                             inhib-comb   F(BAL)(CHS)I(NSP)
       dipeptide, inhib,
2aig   Pol647               Pol647               inhib-comb   FLE--TRP
       reduced peptide bond
3APR   inhibitor                                 inhib-comb   HPFH(FRD)FVY
1kdv   inhibitor                AcIAF                  inhib-comb   I A PHA
2ql7   AC-IEPD-CHO              AC-IEPD-CHO            inhib-comb   I E P ASA
1iau   AC-IEPD-CHO              AC-IEPD-CHO            inhib-comb   I E P ASA
1qtn   Ac-IETD-CHO              Ac-IETD-CHO            inhib-comb   I E T ASA
2GSR   GST-inhibitor            GSTP1-1                inhib-comb   (ILG)(OCS)G
       GST-inhibitor, S-(rho-
       bromobenzyl)-
1AQV   glutathione                                     inhib-comb   (ILG)(PBB)G
12GS   modified glutathione                            inhib-comb   E(GT9)G
1kdy   inhibitor                AcIPF                  inhib-comb   I P PHA
2r9b   inhibitor                                       inhib-comb   K P F S DCL L Q F
       KQLR-CMK, inhibitor,
1Z8G   ACE deriv                Ac-KQLR-AMC            inhib-comb   (ACE)KQL(MAI)
5ER1   inhibitor                                       inhib-comb   (LEM)VI(0A9)
       ZLFG-DAM
1KHQ   (diazomethyl)                                   inhib-comb   LF(GLM)

                                N-benzyloxycarbonyl-
                                leucyl-phenylalanyl-
                                glycine methyl ester
       ZLFG-DAM                 (Z-Leu-Phe-Gly-
1KHP   (diazomethyl)            OMe)                 inhib-comb     LF(GLM)
       epoxysuccinyl-Ile-Pro-
1CSB   OH                     CA030                    inhib-comb   (EPO)IP
                              CI-4; [cyclo-(l-Arg-d-
1O6I   inhibitor              Pro)]                    inhib-comb   DPR-ARG
1ewp   inhibitor                                       inhib-comb   MOR L HPQ
       methoxysuccinyl-AAP- MeOSuc-Ala-Ala-Pro-
1P04   boroIle                boroIle                  inhib-comb   AAP(B2I)
       methoxysuccinyl-AAP-
1gbb   boroAla                                         inhib-comb   MSU A A P B2A
       methoxysuccinyl-AAP-
1gbf   boroAla                                         inhib-comb   MSU A A P B2A
       methoxysuccinyl-AAP-
1gbk   boroAla                                         inhib-comb   MSU A A P B2A
       methoxysuccinyl-AAP-
5lpr   boroAla                                         inhib-comb   MSU A A P B2A
       methoxysuccinyl-AAP-
1P02   boroAla                                         inhib-comb   AAP(B2A)
       methoxysuccinyl-AAP-
1gbd   boroPhe                                         inhib-comb   MSU A A P B2F
       methoxysuccinyl-AAP-
1gbi   boroPhe                                         inhib-comb   MSU A A P B2F
       methoxysuccinyl-AAP-
1gbm   boroPhe                                         inhib-comb   MSU A A P B2F
       methoxysuccinyl-AAP-
8lpr   boroPhe                                         inhib-comb   MSU A A P B2F
       methoxysuccinyl-AAP-
1P06   boroPhe                                         inhib-comb   AAP(B2F)
                              METHOXYSUCCINY
                              L-ALA-ALA-PRO-
       methoxysuccinyl-AAP-   VALINE BORONIC
2lpr   boroVal                ACID                inhib-comb   MSU A A P B2V
                              METHOXYSUCCINY
                              L-ALA-ALA-PRO-
       methoxysuccinyl-AAP-   VALINE BORONIC
1P03   boroVal                ACID                inhib-comb   AAP(B2V)
                              METHOXYSUCCINY
                              L-ALA-ALA-PRO-
       methoxysuccinyl-AAP-   VALINE BORONIC
1P10   boroVal                ACID                inhib-comb   AAP(B2V)
                              METHOXYSUCCINY
                              L-ALA-ALA-PRO-
       methoxysuccinyl-AAP-   VALINE BORONIC
2h5d   boroVal                ACID                inhib-comb   MSU A A P B2V
       methoxysuccinyl-AAP-
1gbc   boroLeu                                    inhib-comb   MSU A A P BLE
       methoxysuccinyl-AAP-
1gbh   boroLeu                                    inhib-comb   MSU A A P BLE
       methoxysuccinyl-AAP-
1gbl   boroLeu                                    inhib-comb   MSU A A P BLE
       methoxysuccinyl-AAP-
7lpr   boroLeu                                    inhib-comb   MSU A A P BLE
       methoxysuccinyl-AAP-
9lpr   boroLeu                                    inhib-comb   MSU A A P BLE
       methoxysuccinyl-AAP-
3lpr   boroNorleu                                 inhib-comb   MSU A A P BNO
       methoxysuccinyl-AAP-
6lpr   boroNorleu                                 inhib-comb   MSU A A P BNO
       methoxysuccinyl-AAP-
1P05   boroNorleu                                 inhib-comb   AAP(BNO)
       Ala-Ala-Phe-psi-[(S)-
       CH(OH)CH2]-Phe-Val-
1HEF   Val-Ome               SKF 108738           inhib-comb   AA(PS0)FV(0AA)
       NLL-gem-diol-TQI;
       tetrahedral reaction
3B80   intermediate                               inhib-comb   NL(LNT)QI
       NLL-gem-diol-TQI;
       tetrahedral reaction
3B7V   intermediate          NLLTQI               inhib-comb   NL(LNT)QI
1BA8   CVS1578                                    inhib-comb   PMS NVA GLY ARG

                              P2-P3 butanediamide
1BIL   inhibitor              renin inhibitor (1) inhib-comb   DMF PHC HII CHA IP3
1ca8   CVS1695                                    inhib-comb   PMS NVA GLY
1yyy   CVS1695                                    inhib-comb    BNS NVA G
1bb0   CVS1694                                    inhib-comb   PMS NVA GLY 3GA
1ZZZ   CVS1694                                    inhib-comb   (NVA)G(1PI)
                                4-Methylpiperazine-1-
                                carboxylic acid [1-[(3-
                                benzenesulfonyl-1-
                                phenethylallyl)carba
                                moyl]-2-
                                phenylethyl]amide
1FH0                            (APC-3316)                inhib-comb   (ODS)F(NFP)
2axi   inhibitor                inhibitor                 inhib-comb   P F E 6CW L D W E F DPR
1AQW   glutathione              glutathione               inhib-comb   (ILG)CG
                                Cbz-Ala-Ala-Leu(P)-
1PPM   Z-inhibitor              (O)-Phe-OMe               inhib-comb   (PHQ)AA(PLE)(OPH)
5est   Z-inhibitor                                        inhib-comb   PHQ A B2I

       (1S,2R,3R,4S)-1,4-
       diamino-1,4-dibenzyl-
       2,3-butanediol core
       (P1 and P1′ residues);   TL-3;
       valine as P2 and P2′     [[PHENYLMETHYLO
       residues; alanine as     XY-CARBONYL]-
       P3 and P3′ residues;     ALANINYL]-VALINYL-
       and a carboxy-benzyl     [PHENYL-1-
       moiety at the P4 and     HYDROXYPROP-2-
2az8   P4′ positions            YL]-AMINE          inhib-comb          PHQ A V F

       (1S,2R,3R,4S)-1,4-
       diamino-1,4-dibenzyl-
       2,3-butanediol core
       (P1 and P1′ residues);   TL-3;
       valine as P2 and P2′     [[PHENYLMETHYLO
       residues; alanine as     XY-CARBONYL]-
       P3 and P3′ residues;     ALANINYL]-VALINYL-
       and a carboxy-benzyl     [PHENYL-1-
       moiety at the P4 and     HYDROXYPROP-2-
2az9   P4′ positions            YL]-AMINE          inhib-comb          PHQ A V F

       (1S,2R,3R,4S)-1,4-
       diamino-1,4-dibenzyl-
       2,3-butanediol core
       (P1 and P1′ residues);   TL-3;
       valine as P2 and P2′     [[PHENYLMETHYLO
       residues; alanine as     XY-CARBONYL]-
       P3 and P3′ residues;     ALANINYL]-VALINYL-
       and a carboxy-benzyl     [PHENYL-1-
       moiety at the P4 and     HYDROXYPROP-2-
2azc   P4′ positions            YL]-AMINE          inhib-comb          PHQ A V F
       (1S,2R,3R,4S)-1,4-
       diamino-1,4-dibenzyl-
       2,3-butanediol core
       (P1 and P1′ residues);   TL-3;
       valine as P2 and P2′     [[PHENYLMETHYLO
       residues; alanine as     XY-CARBONYL]-
       P3 and P3′ residues;     ALANINYL]-VALINYL-
       and a carboxy-benzyl     [PHENYL-1-
       moiety at the P4 and     HYDROXYPROP-2-
2azb   P4′ positions            YL]-AMINE          inhib-comb        PHQ A V F
2c2k   Z-inhibitor                                 inhib-comb        PHQ D E V AA1
2c2k   Z-inhibitor                                 inhib-comb        PHQ--ASP
2c1e   Z-inhibitor              inhibitor 18h      inhib-comb        PHQ--ASP
                                CASPASE-8-Z-
1f9e   Z-DEVD-CHO               DEVD-CHO           inhib-comb        PHQ D E V D
2c2m   Z-inhibitor                                 inhib-comb        PHQ D E V MX4
2c2o   Z-inhibitor              inhibitor 18o      inhib-comb        PHQ D E V MX3
6pad   Z-FA-CMK                 ZPACK              inhib-comb        PHQ F ALM
5pad   Z-inhibitor              ZGPGCK             inhib-comb        PHQ G F GLM
       Z-IARS; Dehydro-Ile-
1SQZ   Ala-Arg-Ser                                      inhib-comb   (PHQ)IARS
       Z-IARS; Dehydro-Ile-
2g58   Ala-Arg-Ser                                      inhib-comb   PHQ--ILE
2c2z   Z-inhibitor              inhibitor 21t           inhib-comb   PHQ L E T MX5
1gec   Z-LVG-CH2                Z-Leu-Val-Gly-CHN2      inhib-comb   PHQ L V GLM
6tmn   Z-inhibitor              ZGP(O)LL                inhib-comb   PHQ PGL 1LU L
5tmn   Z-inhibitor              ZGPLL                   inhib-comb   PHQ PGL L L
4tmn   Z-inhibitor              ZFPLA                   inhib-comb   PHQ PPH L A
1X3Z   Z-VAD-FMK                Z-VAD-FMK               inhib-comb   VA(ASK)
2f4o   Z-VAD-FMK                Z-VAD-FMK               inhib-comb   PHQ V A ASK
                                carbobenzoxy-
                                dehydro-Val-Ala-Arg-
1TJQ   Z-VARS                   Ser                     inhib-comb   (PHQ)VARS
1IDA   inhibitor                inhibitor 2             inhib-comb   QND VAL HPB PPL PY2
                                inhibitor for complex
1jld   inhibitor                23                      inhib-comb   QNC--THR
1os0   inhibitor                inhibitor 1             inhib-comb   PPH DPH PHE
1AHG   inhibitor                                        inhib-comb   (PLP)Y
1czi   inhibitor                CP-113972               inhib-comb   P PHI SMC NOR
                                Ac-pTyr-Glu-Glu-Ile-
1IS0   inhibitor                OH (pYEEI)           inhib-comb      PTC GLU GLU ILE
                                                                     PRO THR GLU PHE PHE ARG
2ER6   inhibitor                H256                    inhib-comb   GLU
1GVX                                                    inhib-comb   PTE(FRF)RE
2pbk   inhibitor                                        inhib-comb   P V Y TBG Q
1IVQ                            U75875                  inhib-comb   (QNC)N(CPV)(NPT)
       CA-p2 reduced            Inhibitor analogues of
1BAI   peptide inhibitor        CA-p2                  inhib-comb    RVLFEA(NLE)(NH2)
       CA-p2 reduced            Inhibitor analogues of
1A94   peptide inhibitor        CA-p2                  inhib-comb    RVLFEA(NLE)(NH2)
       CA-p2 reduced          Inhibitor analogues of
1A8K   peptide inhibitor      CA-p2                    inhib-comb   RVLFEA(NLE)(NH2)
       CA-p2 reduced          Inhibitor analogues of
2aoe   peptide inhibitor      CA-p2                    inhib-comb   R V DCL F E A NLN
       CA-p2 reduced          Inhibitor analogues of
1FFF   peptide inhibitor      CA-p2                    inhib-comb   RV(DCL)FEA(NLE)(NH2)
       CA-p2 reduced          Inhibitor analogues of
1FG8   peptide inhibitor      CA-p2                    inhib-comb   RV(DCL)FEA(NLE)(NH2)
       CA-p2 reduced          Inhibitor analogues of
1K2C   peptide inhibitor      CA-p2                    inhib-comb   RV(DCL)FEA(NLE)(NH2)
       CA-p2 reduced          Inhibitor analogues of
1K2B   peptide inhibitor      CA-p2                    inhib-comb   RV(DCL)FEA(NLE)(NH2)
       CA-p2 reduced          Inhibitor analogues of
1k1u   peptide inhibitor      CA-p2                    inhib-comb   R V DCL F E A NLE
       CA-p2 reduced          Inhibitor analogues of
1k1t   peptide inhibitor      CA-p2                    inhib-comb   R V DCL F E A NLE
       CA-p2 reduced          Inhibitor analogues of
1daz   peptide inhibitor      CA-p2                    inhib-comb   R V DCL F E A NLE
       CA-p2 reduced          Inhibitor analogues of
1ebk   peptide inhibitor      CA-p2                    inhib-comb   R V DCL F E A NLN
       CA-p2 reduced          Inhibitor analogues of
1dw6   peptide inhibitor      CA-p2                    inhib-comb   R V DCL F E A NLN
       inhibitor, substrate
2agg   intermediate           suc-AAPK                 inhib-comb   SIN A A P K
       inhibitor, substrate
2age   intermediate           suc-AAPR                 inhib-comb   SIN A A P R
       inhibitor, substrate
2ixp   intermediate           suc-AAPK-pNa             inhib-comb   SIN-ALA-LYS-NIT ?

                              P2-P3 butanediamide
1BIM   inhibitor              renin inhibitor (3)      inhib-comb   DMF PHC HII CHA IP4
                              PAPAIN-SUCCINYL-
                              GLN-VAL-VAL-ALA-
                              ALA-P-
1pip   inhibitor              NITROANILIDE             inhib-comb   SIN Q V V A A NIT
8kme   inhibitor              SEL2770                  inhib-comb   BNN CUC MLY L P
                              SMO-PHE-ETS-
1epq   inhibitor              ACDMH                    inhib-comb   SOT F G XAO
2ajb   inhibitor              (tBu-GPI)                inhib-comb   TBG P I
1BMA   inhibitor              inhibitor                inhib-comb   TFA LEU MBH ISO
1ATL   inhibitor              inhibitor 2              inhib-comb   SLE TYR CH3
1ele                                                   inhib-comb   TFA VAL ALA ANI
2j9k   inhibitor                                       inhib-comb   T I NLE NLE Q R
2o40   inhibitor                                       inhib-comb   T I NLE NLE Q AAR
1OD1                          PD-135,040               inhib-comb   (TSM)(DPH)H(CHF)(EMR)
2vs2   inhibitor                                       inhib-comb   TSM - DPH - HIS - CHF - EMR
1EPR   inhibitor                                       inhib-comb   TSM DPH HIS CHF EMR
8hvp   inhibitor              U-85548e                 inhib-comb   V S Q N LOV I V
       Ac-LEALFQ-             Ace-LEALFQ-
2B0F   ethylpropionate        ethylpropionate          inhib-comb   (ACE)LEALFQ
1eld                          TFAP                     inhib-comb   TFA PHE ALA ANI
                             TRIFLUOROACETY
                             L-L-LYSYL-L-
                             PROLYL -P-
1ela                         ISOPROPYLANILID inhib-comb         TFA LYS PRO ISO

       trifluoroacetyl-Leu-Ala-
       (p-
7est   trifluoromethylanilide) TFLA                inhib-comb   TFA LEU ALA ANI

                             TRIFLUOROACETY
                             L-L-PHENYLALANYL
                             -P-
1elc                         ISOPROPYLANILID inhib-comb         TFA LYS PHE ISO

                             TRIFLUOROACETY
                             L-L- LYSYL-L-
                             LEUCYL-P-
1elb                         ISOPROPYLANILID inhib-comb         TFA LYS LEU ISO
       PPACK (D-FPR-
1dva   CMK)                  FFRCK; PPACK II       inhib-comb   DPN F R CH2

1dan   D-FFR-CMK, inhibitor FFRCK; PPACK II        inhib-comb   DPN PHE ARG CH2

1cvr   D-FFR-CMK, inhibitor FFRCK; PPACK II        inhib-comb   DPN F ACL

1qfk   D-FFR-CMK, inhibitor FFRCK; PPACK II        inhib-comb   DPN F R

1j9c   D-FFR-CMK, inhibitor FFRCK; PPACK II        inhib-comb   DPN F ARM
1AF0                                               inhib-comb   L(HMA)
       HONH-iBM-Asp-
1A86   NHBn                                        inhib-comb   (HMI)D(BNN)
                             Furoyl-LeusycloTrp;
3aig                         Po1656                inhib-comb   FLE TCR
1B5G                         MOL-168               inhib-comb   (BCC)R(THZ)
1etr                         MQPA                  inhib-comb   MCP MQI ARG
1ett                         4-TAPAP               inhib-comb   TOS APH PIP
1pph                         4-TAPAP               inhib-comb   TOS PIP APM
1fpc                         DAPA                  inhib-comb   ANS+ARG+EPI
       PPACK, mercapto-      ATA-FPR-CH2Cl;
1nu9   acetic-D-FPR-CMK      ATA-PPACK             inhib-comb   (MCR)(DPN) PRO (ARM)
       PPACK, mercapto-      ATA-FPR-CH2Cl;
1nu7   acetic-D-FPR-CMK      ATA-PPACK             inhib-comb   (MCR)(DPN) PRO (ARM)
1ets                         NAPAP                 inhib-comb   NAS GLY PIP APH
1ppc                         NAPAP                 inhib-comb   NAS GLY PIP APH
                                                                (ETO)LL(XAO)/// new_legacy:
1PSA                                               inhib-comb   (0AG) L (XAO)
       Ac-DFLAEGGGVR-                                           (ACE)ASP PHE LEU ALA GLU
1fph   MeCL (CMK?)                                 inhib-comb   GLY GLY GLY VAL ARG CH2
1TMN                                               inhib-comb   (CLT)LW
1PJP   succinyl-AAPF-CMK                           inhib-comb   AAP(PHM)
4ER1                         PD125967              inhib-comb   (BNA)H(CAL)(DCI)
       Boc-Phe-
       [CH2CH2NH]-Phe-
1LZQ   Glu-Phe-NH2                           inhib-comb   (BOC)(PO0)FEF(NH2)
       BOC-PHE-
       PSI[CH2CH2NH]-
1M0B   PHE-GLU-PHE-NH2                       inhib-comb   (BOC)(PO0)FEF(NH2)
       Boc-Phe-Psi[(S)-
       CH(OH)CH2NH]-Phe-
1ZLF   Gln-Phe-NH2         inHIBITOR         inhib-comb   (BOC)(PS0)FQF(NH2)
       Boc-Phe-Psi[(S)-
       CH(OH)CH2NH]-Phe-
1IIQ   Gln-Phe-NH2         inHIBITOR         inhib-comb   (BOC)(PS0)FQF(NH2)
       BOC-PHE-PSI[R-
       CH(OH)CH2NH]-PHE-
1Z8C   GLU-PHE-NH2                           inhib-comb   (BOC)(PR0)FEF(NH2)
       BOC-PHE-PSI[R-
       CH(OH)CH2NH]-PHE-
1ZSF   GLU-PHE-NH2                           inhib-comb   (BOC)(PR0)FEF(NH2)
       BOC-PHE-PSI[R-
       CH(OH)CH2NH]-PHE-
1ZBG   GLU-PHE-NH2                           inhib-comb   (BOC)(PR0)FEF(NH2)
       BOC-PHE-PSI[R-
       CH(OH)CH2NH]-PHE-
1ZPK   GLU-PHE-NH2                           inhib-comb   (BOC)(PR0)FEF(NH2)
       BOC-PHE-PSI[S-
       CH(OH)CH2NH]-PHE-
1FQX   GLU-PHE-NH2                           inhib-comb   (BOC)(PS0)FEF(NH2)
       BOC-PHE-PSI[S-
       CH(OH)CH2NH]-PHE-
1ZSR   GLU-PHE-NH2                           inhib-comb   (BOC)(PS0)FEF(NH2)
       BOC-PHE-PSI[S-
       CH(OH)CH2NH]-PHE-
1ZJ7   GLU-PHE-NH2                           inhib-comb   (BOC)(PS0)FEF(NH2)
       Boc-Ala-Ala-Pro-Val
       phosphonate phenyl
1P11   ester-lactate-Ala                     inhib-comb   (BOC)AAP(PVA)(LAC)A
       Boc-Ala-Ala-Pro-Val
       phosphonate phenyl PHOSPHONATE
1P12   ester-lactate-Ala   ESTER INHIBITOR   inhib-comb   (BOC)AAP(PVA)(LAC)A
       Boc-Ala-Ala-Pro-Val
       phosphonate phenyl
1P11   ester-lactate-Ala                     inhib-comb   (BOC)AAP(PVA)
1BTW                                         inhib-comb   (BOC)AV(BLY)(PDO)
1BTX                                         inhib-comb   (BOC)AV(BLY)(0AY)
                         T-BUTOXY-ALA-VAL-
                         BORO-LYS METHYL
1BTZ                     ESTER             inhib-comb     (BOC)AV(BLY)(CH3)
1rhq                     inhibitor5        inhib-comb     (BOP)(ACE)(VAL)D(PTF)
1DOJ                     RWJ-51438         inhib-comb     (CH3)(DPN)P(AR2)
                                                          (DCI) (STA) LYS (MTF) PHE
1epp                     inhibitor 4         inhib-comb   (MAS)
1HPG                                         inhib-comb   (BOC)AAPE
1PPL                          IvaVVLP(0)FOM      inhib-comb       (IVA)VV(PLE)(OPH)
                              Ac-
                              (Cha)R(MeA)(Haic)-
1D5X                          NHCH(CH2OH)2       inhib-comb       (ACE)(ALC)R(MAA)(HAQ)(SEL)
                              Ac-
                              (Cha)R(MePhg)MAS(
1D6E                          tLeu)-NH2          inhib-comb       (ACE)(ALC)R(MPQ)MAS(BUG)
2djf                                             inhib-comb
       Ac-T-I-Nle-r-Nle-Q-R
       amide (r is the
       reduced peptide        Ace-T-I-Nle-r-Nle-Q-
2AVQ   bond)                  R (p2/NC)            inhib-comb     (ACE)TI(2AO)(NLE)QR(NH2)
       Ac-T-I-Nle-r-Nle-Q-R
       amide (r is the
       reduced peptide        Ace-T-I-Nle-r-Nle-Q-
2AVM   bond)                  R (p2/NC)            inhib-comb     (ACE)TI(2AO)(NLE)QR(NH2)
       Ac-T-I-Nle-r-Nle-Q-R
       amide (r is the
       reduced peptide        Ace-T-I-Nle-r-Nle-Q-
4HVP   bond)                  R (p2/NC)            inhib-comb     (ACE)TI(NLE)(NLE)QR(NH2)
1CGH                                               inhib-comb     (SIN)VP(PPH)
1AU8                                               inhib-comb     (SIN)VP(KPH)

       succinyl-APA-p-        succinyl-Ala-trans-
1V9T   nitroanilide           Pro-Ala-p-nitroanilide inhib-comb   (SIN)APA(NIT)

       succinyl-APA-p-        succinyl-Ala-trans-
1LOP   nitroanilide           Pro-Ala-p-nitroanilide inhib-comb   (SIN)APA(NIT)
1NH0                                                 inhib-comb   (KI2)FEE(NH2)
1U8G                                                 inhib-comb   (KI2)FEE(NH2)
                              methoxysuccinyl-Ala-
                              Ala-Pro-Ala
       methoxysuccinyl-       chloromethyl ketone
3prk   AAPA-CMK               (MSACK                 inhib-comb   (MSU) ALA ALA PRO ALA (CH2)
                              methoxysuccinyl-Ala-
                              Ala-Pro-Ala
       methoxysuccinyl-       chloromethyl ketone
2rdl   AAPA-CMK               (MSACK                 inhib-comb   MSU A A P ALM
                              methoxysuccinyl-Ala-
                              Ala-Pro-Ala
       methoxysuccinyl-       chloromethyl ketone
1hne   AAPA-CMK               (MSACK                 inhib-comb   (MSU) ALA ALA PRO (ALM)
1IVP                          U75875                 inhib-comb   (NOA)H(CAV)I(APY)
1HIV                          U75875                 inhib-comb   (NOA)H(CAV)I(APY)
       H,N-Pro-Leu-Gly-
1JAN   NHOH                                         inhib-comb    PLG(HOA)
       H,N-Pro-Leu-Gly-
1QJJ   NHOH                                         inhib-comb    PLG(HOA)
1NKK                                                inhib-comb    (ACE)V(DMK)(DMH)A
1NJT                          inhibitor 2           inhib-comb    (ACE)V(DMK)(DMH)A
       acetyl-cmF-Glu-Glu-    acetyl-cmF-Glu-Glu-
1BHF   Ile                    Ile (cmFEEI)        inhib-comb      (ACE)(1PA)EEI
1CPI                                                   inhib-comb   (CH2)(CBG)NY(CH2)PIV(NH2)
1GHB                                                   inhib-comb   (ACE)W
       adduct on Cys 95 of
207L   chain A                                         inhib-comb   (ACE)C
                              mAZ-pY(αMe)pYN-
1JYQ                          NH2                      inhib-comb   (MAZ)(PTR)(PTM)N
1AY6                                                   inhib-comb   (HMF)PR(HHO)
                              Ac-Ala-Lys-boroArg
1OT5   inhibitor, borate      inhibitor                inhib-comb   (ACE)AK(BOR)
       EGR-CMK, inhibitor     dansyl-Glu-Gly-Arg-
1bda   (dansyl deriv at E)    chloromethylketone       inhib-comb   (DSY) GLU GLY ARG (CH2)
                              MEO-SUCCINYL-
                              ALA-ALA-PRO-VAL
                              CHLOROMETHYLA
1PPG                          CETONE                   inhib-comb   (HMB)AAP(VAF)
                              LAP inhibitor
1BLL                          amastatin                inhib-comb   L(FOR)VVD


       4(S)-[([[N-(morpholino-
       l-carbonyl)-~-
       phenylalanyl]-~-
       norleucyl]amin0]-5-
       cyclohexyl-2,2-difluoro-
       3-oxopentanoyl]-
2jxr   methyl; CP-81,28         CP-081282              inhib-comb   MOR F NLE CHF NME


       4(S)-[([[N-(morpholino-
       l-carbonyl)-~-
       phenylalanyl]-~-
       norleucyl]amin0]-5-
       cyclohexyl-2,2-difluoro-
       3-oxopentanoyl]-
1epo   methyl; CP-81,28         CP-081282              inhib-comb   MOR PHE NLE CHF NME
1A8G   SDZ283-910               SDZ283-910             inhib-comb   PHQ TBG HV8 VAL HV7
2est                            TFAP                   inhib-comb   TFA PHE ALA ANI
1PAD   Ac-AAFA-CMK              Ala-Ala-p-I-Phe-Arg    inhib-comb   (ACE)AAF(ALM)
                                Ac-Arg-Glu-Lys-
1R64                            boroArg                inhib-comb   (ACE)REK(BOR)
                                Ac-Pro-Ala-Pro-Phe-
3SGA                            OH                     inhib-comb   (ACE)PAP(PHA)
2H5I   Ac-DEVD-CHO              Ac-DEVD-Cho            inhib-comb   (ACE)DEV(ASA)
1F1J   Ac-DEVD-CHO              Ac-DEVD-Cho            inhib-comb   (ACE)DEVD
1PAU   Ac-DEVD-CHO              Ac-DEVD-Cho            inhib-comb   (ACE)DEVD
2H6M   Ac-LAAQmm-FMK            LAAQmm-FMK             inhib-comb   GLAA(EPQ)
2H9H   Ac-LAAQmm-FMK            LAAQmm-FMK             inhib-comb   (ACE)LAA(EPQ)
                                ACE-Ala-Ala-Pro-Ala-
                                7-Amino-4-
1VDN                            Methylcoumarin         inhib-comb   (ACE)AAPA(MCM)
                                Caspase-2 Inhibitor;
2H65   Ac-VDVAD-CHO             Ac-VDVAD-Cho           inhib-comb   (ACE)VDVA(ASA)
       Boc-Glu-Leu-(di-
1dxw   fluoro)Abu                                    inhib-comb   E L FKI -- SER 195
1DY9                                                 inhib-comb   (BOC)EL(FKI)
       Ac-NA-Val-Sta-Glu-    LP-149; Ac-NA-Val-
1FIV   NA-NH2                Sta-Glu-NA-NH2          inhib-comb   (ACE)AV(STA)EA(NH2)
       Ac-NA-Val-Sta-Glu-    LP-149; Ac-NA-Val-
2FIV   NA-NH2                Sta-Glu-NA-NH2          inhib-comb   (ACE)(NAL)V(STA)E(NAM)
                                                                  (FOR) ALA PRO ARG (FOR)
1tmb                         Cyclotheonamide A       inhib-comb   PHE (AHT)

1QR3                         FR901277                inhib-comb   (AIB)(ORN)T(AA3)(AA4)F(AA6)V
2B7F                                                 inhib-comb   (ACE)APQV(STA)VMHP
                             endothiapepsin (EC
3ER5                         3.4.23.6)               inhib-comb   PHPFH(STA)VIHK
2h5j   Ac-DMQD-CHO           AC-DMQD-CHO             inhib-comb   D M Q ASA
2ql5   Ac-DMQD-CHO           AC-DMQD-CHO             inhib-comb   D M Q ASA
       terlakiren (isopropyl N-
       [N-(4-
       morpholinocarbonyl)-L-
       phenylalaninyl-5-
       methyl-L-cysteinyl]-2-
       (R)-hydroxy-3(S)-
       amino-4-
       cyclohexybutanoate,
1GVT   formerly CP-80,794) CP-80,794                 inhib-comb   (MOR)F(CYM)(NOR)
       terlakiren (isopropyl N-
       [N-(4-
       morpholinocarbonyl)-L-
       phenylalaninyl-5-
       methyl-L-cysteinyl]-2-
       (R)-hydroxy-3(S)-
       amino-4-
       cyclohexybutanoate,
1EPN   formerly CP-80,794) CP-80,794                 inhib-comb   (MOR)FC(NOR)
1EAG                            A70450               inhib-comb   ODS PSS LYW CHA VAS LYT
1GSS   glutathione                                   inhib-comb   Q(SHC)G
                                Fortovase;
1HXB   inhibitor                SAQUINAVIR           inhib-comb   QNC ASN HPH DIQ NTB
                                Ac-
                                (Cha)RA(Odapdc)SL-
1d5z   inhibitor                NH2                  inhib-comb   ALC R A ODA S CLE
                                                                  VAL ASN SER THR LEU GLN
1P9U   Z-VNSTLQ-CMK                                  inhib-comb   CH2
       Ac-Leu-Ala-Ala-
2Z3D   cycloGln                                      inhib-comb   (ACE)LAA
       N-methyl-D-
       phenylalanyl-N-[5-
       [(aminoiminomethyl)
       amino]-1-[[(2-
       benzothiazolyl)carbon
       yl[butyl]-L-prolinamide
       trifluoroacetate
1tbz   hydrate                 RWJ-50353           inhib-comb
4pad                                               inhib-comb    LYM TOS
                               Ac-
                               (Cha)RA(Odapdc)SL-
7HVP                           NH2                inhib-comb     (ACE)(ALC)RA(ODA)S(CLE)

10GS   modified gluatathione                        inhib-comb   E(BCS)(PG9)
                               B-IAF;B-IPF; Ac-IPF-
1GTJ   Ac-IAF-CHO              CHO                  inhib-comb   ACE ILE ALA PHE
                                                    ongoing
3gcd                                                processing
                                                    ongoing
3eov                           Cyclosporin          processing
                                                    ongoing
1sp4                           ns-134               processing
                                                    ongoing
3EXB                                                processing
                                                    ongoing
3EQ9                                                processing
                                                    ongoing
3EQ8                                                processing
                                                    ongoing
3EQ7                                                processing
                                                    ongoing
3E7A                                                processing
            chem comp
clean seq   ID        counter



736         736                 1



AUR         AUR                 2



AZX         AZX                 3



BES         BES                 4



BES         BES                 5



BES         BES                 6



BES         BES                 7



BES         BES                 8



BES         BES                 9



BES         BES                 10



BES         BES                 11



BES         BES                 12
CEM   CEM   13



HT    HT    14



HT    HT    15



HT    HT    16



HT    HT    17



KWT   KWT   18



LY2   LY2   19



LY3   LY3   20



039   039   21



085   085   22



090   090   23



093   093   24



094   094   25
358                               358         26



cnq                               cnq         27



FRQ                               FRQ         28
"HMI ALA GLY NH2"                 01s          1
(ACE) D E V D                     0D0          2
BTP ALA GLY NH2                   0D3          3


(ACE) (ALC) R A M (CY1) S (CLE)   0D4         4
"CAB MAA DAL LEU ACB ARG ADD"     0D5         5
(BZP) L (NFP) (BNS)               0D6         6

ACE LEU ALA ALA ECQ               0D7         7



(ACE) A P V                       0D9          8
ACE SER LEU ASN PHM PRO ILE VME   0da          9
ACE SER LEU ASN PHM PRO ILE VME   0da         10




(CLT) (CCM) W                     0DB         11
ace d e v d 0qe                   0DD         12
ace d e v d 0qe                   0DD         13
ace d e v d 0qe                   0DD         14


                                  0DD ( 0qe
(ACE) D E V (ASK)                 is used)    15


(ACE) D V A (ASK)                 0DE         16

(ACE) I P F                       0DH         17

ACE ILE PRO PHL                   0DH         18
(ACE) L D E S D                   0DK         19
(ACE) L F F (MKE) (EKE)           0DL         20

(ACE) (NAL) V L A E (NAM)         0DM         21
(DBA) (PHM) (PPL) (SPY)     0DO   22
(ACE) P P P V (IPG) P R R   0DP   23
(ACE) R E R (LYM)           0DR   24



(HAE) (MOP) L F (NH2)       0DS   25
(DTG) (TBG) (ASM)           0DT   26



(ACE) T I (NLE) (NLE) Q R   0DW   27



(ACE) T I (NLE) (NLE) Q R   0DW   28



(ACE) T I (NLE) (NLE) Q R   0DW   29



(ACE) T I (NLE) (NLE) Q R   0DW   30



(ACE) T I (NLE) (NLE) Q R   0DW   31

(HMI) (DSG) (DBP)           0DY   32


ACE VAL THR LEU MBN ECQ     0e2   33


ACE VAL THR LEU MBN KCQ     0e3   34


ACE VAL THR LEU MBN KCQ     0e3   35
(ACE) Y V A D               0E4   36


(CBZ) R (SEM)               0E6   37


(ALG) F (ALO) (0A9)         0E7   38
(BOC) (HPH) (BOC)           0E8   39
(BOC) (HPH) (HPH) (BOC)     0E8   40
PHQ VAL COR VAL PHQ               0E9   41
BNN CHG PRR LEU PRO NH2           0EB   42

(PHQ) (ABU) L F (EMR)             0ED   43
ACE TRP GLU HIS ASA               0EE   44




(BOC) A P (APE)                   0EF   45



(BOC) A P (B2V)                   0EG   46
(BOC) F H (AHS) K F               0EK   47
(BOC) F H (CAL) K F               0EL   48
(BOC) F H (PTA) (DCI)             0EM   49
(BOC) F H (PTA) (DCI)             0EM   50
(BOC) (FOG) (CHS) L               0EO   51
(BOC) H P F A (LOV) I H           0EP   52


(BOC) H P F H (LOV) I H           0EQ   53


(BOC) H P F H (LOV) I H           0EQ   54
BOC HIS PRO PHE HIS STA LEU PHE   0ES   55
(BOC) (PR0) Y I G                 0EZ   56
(BP4) C (DAR) Y (PEA)             0F6   57
PHQ ILE LEU FKI                   0F7   58

PHQ LEU VAL ARG TYR               0F8   59



(PHO) L (NH2)                     0FA   60

PO3 LEU NH2                       0FA   61



(ILG) (TNB) G                     0FB   62
D A D E (FTY) (CLE)               0FC   63
(DAR) (OIC) P (DAL) (4PH)         0FD   64
ASP GLU VAL ASP 0QE PHQ           0FE   65
ASP GLU VAL ASP 0QE PHQ           0FE   66
ASP GLU VAL ASP 0QE PHQ           0FE   67
DKA ARG VAL LYS MAI 0QE                 0FF   68
(DLE) F (FBA)                           0FG   69

DLY GLY DAL DCY DGL DSN DPR DGL
DTR DGN DTR DLE DCY DAL DAL NH2         0FH   70
(DLY) G (DAL) (DCY) (DAS) (DTY) (DPR)
(DGL) (DTR) (DGN) (DTR) (DLE) (DCY)
(DAL) (DAL)                             0FJ   71
(DLY) G (DAL) (DCY) (DAS) (DTY) (DPR)
(DGL) (DTR) (DGN) (DTR) (DLE) (DCY)
(DAL) (DAL)                             0FJ   72
D N L (ASA)                             0FM   73
(DNL) (TBG) (TBG) (DMH) A               0FP   74
(DNL) (TBG) (TBG) (DMH) A               0FP   75
(DNL) (TBG) (TBG) (DMH) A               0FP   76

RPF                                     0G6   77

(DPN) P (MAI) (S)                       0G6   78

FPR                                     0G6   79

(DPN) P (MAI)                           0G6   80

F P (ARM)                               0G6   81

F P (ARM)                               0G6   82

(DPN) P (ARM)                           0G6   83

F P R (CH2)                             0G6   84

(DPN) P R                               0G6   85

(DPN) P (MAI)                           0G6   86

(DPN) P (ARM)                           0G6   87

(DPN) P (ARM)                           0G6   88

(DPN) P (ARM)                           0G6   89

F P R (CH2)                             0G6   90

(DPN) P (ACL)                           0G6   91

F P R (CH2)                             0G6   92

(DPN) P R                               0G6   93

F P R (CH2)                             0G6   94
F P R (CH2)               0G6   95

F P R (CH2)               0G6   96

F P R (CH2)               0G6   97

F P R (CH2)               0G6   98

(DPN) P R                 0G6   99

(DPN) P (MAI)             0G6   100

F P R (CH2)               0G6   101

(DPN) P (MAI)             0G6   102

F P R (CH2)               0G6   103

(DPN) P R (CH2)           0G6   104

F P R (CH2)               0G6   105

F P R (CH2)               0G6   106
DPN PRO ARM               0G6   107
dpn pro acl               0G6   108
D Q M (ASA)               0G9   109
TRP TYR THR ARG 0QE       0GB   110
(DVA) L (LYM)             0GC   111

GLU GLY ARM ANS CL        0GE   112
E G (ARM)                 0GJ   113
GLU GLY ARG 0QE           0GJ   114
E G (ACL)                 0GJ   115
E G (MAI)                 0GJ   116
E G (MAI)                 0GJ   117
E G (MAI)                 0GJ   118
E L D (LOL) (ALQ) V E F   0GK   119
E S M (ASA)               0GL   120
E (STA) L (TRJ)           0GM   121


A A (PS0) G V (0AB)       0GN   122
E V (ASK)                 0GP   123


E V (ASK)                 0GP   124
F (BAL) (CHS) I (NSP)     0GQ   125

(FLE) W                   0GR   126

H P F H (FRD) F V Y       0HA   127
I A (PHA)             0HB   128
I E P (ASA)           0HC   129
I E P (ASA)           0HC   130
I E T (ASA)           0HE   131
(ILG) (OCS) G         0HF   132


(ILG) (PBB) G         0HG   133
E (GT9) G             0HH   134
I P (PHA)             0HI   135
K P F S (DCL) L Q F   0HR   136

(ACE) K Q L (MAI)     0HS   137
(LEM) V I (0A9)       0HT   138

L F (GLM)             0HU   139




L F (GLM)             0HU   140

EPO ILE PRO EOH       0HW   141

(DPR) R               0HZ   142
(MOR) L (HPQ)         0I5   143

A A P (B2I)           0I8   144

(MSU) A A P (B2A)     0IA   145

(MSU) A A P (B2A)     0IA   146

(MSU) A A P (B2A)     0IA   147

(MSU) A A P (B2A)     0IA   148

MSU ALA ALA PRO B2A   0IA   149

(MSU) A A P (B2F)     0ID   150

(MSU) A A P (B2F)     0ID   151

(MSU) A A P (B2F)     0ID   152

(MSU) A A P (B2F)     0ID   153

MSU ALA ALA PRO B2F   0ID   154
(MSU) A A P (B2V)               0II   155



A A P (B2V)                     0II   156



A A P (B2V)                     0II   157



(MSU) A A P (B2V)               0II   158

(MSU) A A P (BLE)               0IJ   159

(MSU) A A P (BLE)               0IJ   160

(MSU) A A P (BLE)               0IJ   161

(MSU) A A P (BLE)               0IJ   162

(MSU) A A P (BLE)               0IJ   163

(MSU) A A P (BNO)               0IO   164

(MSU) A A P (BNO)               0IO   165

MSU ALA ALA PRO BNO             0IO   166


A A (PS0) F V (0AA)             0IQ   167


N L (LNT) Q I                   0IR   168


N L (LNT) Q I                   0IR   169
(PMS) (NVA) G R                 0IT   170


(DMF) (PHC) (HII) (CHA) (IP3)   0IU   171
PMS NVA GLY 3GA                 0iv   172
PMS NVA GLY 3GA                 0iv   173
(PMS) (NVA) G (3GA)             0iv   174
(NVA) G (1PI)                   0iv   175
(ODS) F (NFP)                 0IW   176
P F E (6CW) L D W E F (DPR)   0IX   177
(ILG) C G                     0P0   178

(PHQ) A A (PLE) (OPH)         0P1   179
(PHQ) A (B2I)                 0P2   180




(PHQ) A V F                   0P3   181




(PHQ) A V F                   0P3   182




(PHQ) A V F                   0P3   183
(PHQ) A V F                 0P3   184
(PHQ) D E V (AA1)           0P7   185
(PHQ) D                     0P7   186
(PHQ) D                     0P7   187

(PHQ) D E V D               0P9   188
(PHQ) D E V (MX4)           0PB   189
(PHQ) D E V (MX3)           0PB   190
(PHQ) F (ALM)               0PC   191
(PHQ) G F (GLM)             0PD   192

(PHQ) I A R S               0PE   193

(PHQ) I                     0PE   194
(PHQ) L E T (MX5)           0PG   195
(PHQ) L V (GLM)             0PH   196
(PHQ) (PGL) (1LU) L         0PI   197
(PHQ) (PGL) L L             0PJ   198
(PHQ) (PPH) L A             0PK   199
V A (ASK)                   0PM   200
(PHQ) V A (ASK)             0PM   201


(PHQ) V A R S               0PN   202
(QND) V (HPB) (PPL) (PY2)   0PO   203

(QNC) T                     0PP   204
(PPH) (DPH) F               0PQ   205
(PLP) Y                     0PR   206
P (PHI) (SMC) (NOR)         0PS   207

(PTC) E E I                 0PT   208

PTEFFRE                     0PU   209
P T E (FRF) R E             0PV   210
P V Y (TBG) Q               0PW   211
(QNC) N (CPV) (NPT)         0PX   212

R V L F E A (NLE) (NH2)     0Q4   213

R V L F E A (NLE) (NH2)     0Q4   214
R V L F E A (NLE) (NH2)         0Q4   215

R V (DCL) F E A (NLN)           0Q4   216

R V (DCL) F E A (NLE) (NH2)     0Q4   217

R V (DCL) F E A (NLE) (NH2)     0Q4   218

R V (DCL) F E A (NLE) (NH2)     0Q4   219

R V (DCL) F E A (NLE) (NH2)     0Q4   220

R V (DCL) F E A (NLE)           0Q4   221

R V (DCL) F E A (NLE)           0Q4   222

R V (DCL) F E A (NLE)           0Q4   223

R V (DCL) F E A (NLN)           0Q4   224

R V (DCL) F E A (NLN)           0Q4   225

(SIN) A A P K                   0Q7   226

(SIN) A A P R                   0Q8   227

(SIN) A K (NIT)                 0Q9   228


(DMF) (PHC) (HII) (CHA) (IP4)   0QB   229



(SIN) Q V V A A (NIT)           0QC   230
(BNN) (CUC) (MLY) L P           0QD   231

(SOT) F G (XAO)                 0QF   232
(TBG) P I                       0QG   233
(TFA) L (MBH) (ISO)             0QH   234
(SLE) Y (CH3)                   0QI   235
(TFA) V A (ANI)                 0QN   236
T I (NLE) (NLE) Q R             0QP   237
T I (NLE) (NLE) Q (AAR)         0QP   238
(TSM) (DPH) H (CHF) (EMR)       0QS   239
(TSM) (DPH) H (CHF) (EMR)       0QT   240
(TSM) (DPH) H (CHF) (EMR)       0QT   241
V S Q N (LOV) I V               0QU   242

(ACE) L E A L F Q               0TV   243
(TFA) F A (ANI)                 0Z0   244
(TFA) K P (ISO)                   0Z1   245



(TFA) L A (ANI)                   0Z2   246




(TFA) K F (ISO)                   0Z3   247




(TFA) K L (ISO)                   0Z4   248

(DPN) F R (CH2)                   0Z6   249

(DPN) F R (CH2)                   0Z6   250

(DPN) F (ACL)                     0Z6   251

(DPN) F R                         0Z6   252

(DPN) F (ARM)                     0Z6   253
L (HMA)                           0Z9   254

(HMI) D (BNN)                     0ZB   255

(FLE) (TCR)                       0ZC   256
(BCC) R (THZ)                     0ZE   257
(MCP) (MQI) R                     0ZF   258
(TOS) (APH) (PIP)                 0ZG   259
(TOS) (PIP) (APM)                 0ZG   260
(ANS) R (EPI)                     0ZI   261

(MCR) (DPN) P (ARM)               0ZJ   262

(MCR) (DPN) P (ARM)               0ZJ   263
(NAS) G (PIP) (APH)               0ZK   264
(NAS) G (PIP) (APH)               0ZK   265

(0AG) L (XAO)                     0ZL   266

(ACE) D F L A E G G G V R (CH2)   0ZM   267
(CLT) L W                         0ZN   268
A A P (PHM)                       0ZO   269
(BNA) H (CAL) (DCI)               0ZP   270
(BOC) (PO0) F E F (NH2)       0ZQ   271


(BOC) (PO0) F E F (NH2)       0ZQ   272


(BOC) (PS0) F Q F (NH2)       0ZR   273


(BOC) (PS0) F Q F (NH2)       0ZR   274


(BOC) (PR0) F E F (NH2)       0ZS   275


(BOC) (PR0) F E F (NH2)       0ZS   276


(BOC) (PR0) F E F (NH2)       0ZS   277


(BOC) (PR0) F E F (NH2)       0ZS   278


(BOC) (PS0) F E F (NH2)       0ZT   279


(BOC) (PS0) F E F (NH2)       0ZT   280


(BOC) (PS0) F E F (NH2)       0ZT   281


(BOC) A A P (PVA) (LAC) A     0ZU   282


(BOC) A A P (PVA) (LAC) A     0ZU   283


(BOC) A A P (PVA)             0ZU   284
(BOC) A V (BLY) (PDO)         0ZW   285
(BOC) A V (BLY) (0AY)         0ZX   286


(BOC) A V (BLY) (CH3)         0ZY   287
(BOP) (ACE) V ) D (PTF)       0ZZ   288
(CH3) (DPN) P (AR2)           1Z0   289

(DCI) (STA) K (MTF) F (MAS)   1Z1   290
(BOC) A A P E                 1Z3   291
(IVA) V V (PLE) (OPH)             1Z7   292


(ACE) (ALC) R (MAA) (HAQ) (SEL)   1Z9   293


(ACE) (ALC) R (MPQ) M A S (BUG)   1ZA   294
                                  1zb   295



(ACE) T I (2AO) (NLE) Q R (NH2)   1ZD   296



(ACE) T I (2AO) (NLE) Q R (NH2)   1ZD   297



(ACE) T I (NLE) (NLE) Q R (NH2)   1ZD   298
(SIN) V P (PPH)                   1ZG   299
(SIN) V P (KPH)                   1ZG   300


(SIN) A P A (NIT)                 1ZH   301


(SIN) A P A (NIT)                 1ZH   302
(KI2) F E E (NH2)                 1ZI   303
(KI2) F E E (NH2)                 1ZI   304



MSU ALA ALA PRO ALM               1ZJ   305



(MSU) A A P (ALM)                 1ZJ   306



(MSU) A A P (ALM)                 1ZJ   307
(NOA) H (CAV) I (APY)             1ZK   308
(NOA) H (CAV) I (APY)             1ZK   309

P L G (HOA)                       1ZL   310

P L G (HOA)                       1ZL   311
(ACE) V (DMK) (DMH) A             1zm   312
ACE VAL DMK DMH ALA CFT           1ZM   313

(ACE) (1PA) E E I                 1ZP   314
(CH2) (CBG) N Y (CH2) P I V (NH2)   1ZR   315
(ACE) W                             1ZS   316

(ACE) C                             1ZT   317

(MAZ) (PTR) (PTM) N                 1ZU   318
(HMF) P R (HHO)                     1ZV   319

(ACE) A K (BOR)                     1ZY   320

DSY GLU GLY ARG 0QE                 2Z0   321



(HMB) A A P (VAF)                   2Z1   322

L (FOR) V V D                       2Z2   323




(MOR) F (NLE) (CHF) (NME)           2Z3   324




(MOR) F (NLE) (CHF) (NME)           2Z3   325
(PHQ) (TBG) (HV8) V (HV7)           2Z4   326
(TFA) F A (ANI)                     2Z5   327
(ACE) A A F (ALM)                   2Z6   328

(ACE) R E K (BOR)                   2Z7   329

(ACE) P A P (PHA)                   2Z8   330
(ACE) D E V (ASA)                   2Z9   331
(ACE) D E V D                       2Z9   332
(ACE) D E V D                       2Z9   333
ACE LEU ALA ALA EPQ                 2ZA   334
ACE LEU ALA ALA EPQ                 2ZA   335


(ACE) A A P A (MCM)                 2ZB   336

(ACE) V D V A (ASA)                 2ZD   337
E L (FKI)                             2ZF   338
(BOC) E L (FKI)                       2ZF   339

(ACE) A V (STA) E A (NH2)             2ZG   340

(ACE) (NAL) V (STA) E (NAM)           2ZG   341

(FOR) A P R (FOR) F (AHT)             2ZJ   342

(AIB) (ORN) T (AA3) (AA4) F (AA6) V   2ZK   343
(ACE) A P Q V (STA) V M H P           2ZN   344

P H P F H (STA) V I H K               2ZP   345
D M Q (ASA)                           2ZR   346
D M Q (ASA)                           2ZR   347




(MOR) F (CYM) (NOR)                   2ZS   348




(MOR) F C (NOR)                       2ZS   349
(ODS) (PSS) (LYW) (CHA) (VAS) (LYT)   A70   350
Q (SHC) G                             LEE   351

(QNC) N (HPH) (DIQ) (NTB)             ROC   352


(ALC) R A (ODA) S (CLE)               SGQ   353

PHQ VAL ASN SER THR LEU GLN 0QE       shq   354

ACE LEU ALA ALA OCQ                   SHS   355
(CH3) (DPN) P R (THZ)             shz            356
(LYM) (TOS)                       TCK            357
                                  use diff
ACE SER LEU ASN PHE CH2 PRO ILE   ligand: 1ZB-
VME                               >0da           358

E (BCS) (PG9)                     VWW            359

(ACE) I A F                       XAS            360

                                  az0             1
BMT ABA SAR MLE VAL MLE ALA DAL
MLE MLE MVA                       EOV             2

MEU GLY LEU LEU PRO EPO           ep2             3

"EXB GLY ALA ALA NH2"             N31             4

"FIM PRO PRU"                     X97             5

"FQO PRO PRU"                     X98             6

"FTF PDF PRU"                     X99             7

ACB ARG MFD GLU MDH               X9A             8
                                       ligand
pdb_id   molecule name (SD)            synonym   molecule type
1H0G     argadin                                 inhib-no-comb
1H0I     argifin                                 inhib-no-comb
1BZH     cyclic peptide inhibitor                inhib-no-comb
2ANK     DECAPEPTIDE HIRUDIN                     inhib-no-comb
1NZQ     DECAPEPTIDE HIRUDIN                     inhib-no-comb
1O0D     DECAPEPTIDE HIRUDIN                     inhib-no-comb
2FES     DECAPEPTIDE HIRUDIN                     inhib-no-comb
2A2X     DECAPEPTIDE HIRUDIN                     inhib-no-comb
2FEQ     DECAPEPTIDE HIRUDIN                     inhib-no-comb
2q3i     D-peptide inhibitor                     inhib-no-comb
2itk     D-peptide substrate                     inhib-no-comb
1EFR     Efrapeptin, natural product             inhib-no-comb
1E5O     ENDOTHIAPEPSIN INHIBITOR                inhib-no-comb
1FPC     EXOSITE INHIBITOR HIRUGEN               inhib-no-comb
1dwd     hirudin                                 inhib-no-comb
1fph     hirudin                                 inhib-no-comb
1dwb     hirudin                                 inhib-no-comb
1c5n     hirudin                                 inhib-no-comb
1dwc     hirudin                                 inhib-no-comb
1hrt     hirudin                                 inhib-no-comb
1c5o     hirudin                                 inhib-no-comb
1c1u     hirudin                                 inhib-no-comb
1D6W     hirudin                                 inhib-no-comb
1bmm     hirudin 1                               inhib-no-comb
1ktt     hirudin IIB                             inhib-no-comb
2GDE     hirudin like                            inhib-no-comb
2PKS     hirudin like                            inhib-no-comb
1TWX     hirudin like                            inhib-no-comb
1tmt     hirudin variant                         inhib-no-comb
1k22     hirudin variant 2                       inhib-no-comb
4htc     hirudin variant 2                       inhib-no-comb
1GHV     hirudin, dbref                          inhib-no-comb
1ZRB     hirudin, dbref                          inhib-no-comb
1T4V     hirudin, dbref                          inhib-no-comb
1MUE     hirudin, dbref                          inhib-no-comb
1QBV     hirudin, dbref                          inhib-no-comb
1G32     hirudin, dbref                          inhib-no-comb
1GHY     hirudin, dbref                          inhib-no-comb
1GHX     hirudin, dbref                          inhib-no-comb
1G30     hirudin, dbref                          inhib-no-comb
1GJ5     hirudin, dbref                          inhib-no-comb
1O5G     hirudin, dbref                          inhib-no-comb
1GHW     hirudin, dbref                          inhib-no-comb
1C1W     hirudin, dbref                          inhib-no-comb
1KTS     hirudin, dbref                          inhib-no-comb
1O2G     hirudin, dbref                          inhib-no-comb
1MU8     hirudin, dbref                          inhib-no-comb
1T4U     hirudin, dbref                          inhib-no-comb
1NO9     hirudin, dbref                          inhib-no-comb
1MU6     hirudin, dbref                          inhib-no-comb
1C1V     hirudin, dbref                          inhib-no-comb
3C1K   hirudin, dbref   inhib-no-comb
1GJ4   hirudin, dbref   inhib-no-comb
1bcu   hirugen          inhib-no-comb
1nt1   hirugen          inhib-no-comb
1nm6   hirugen          inhib-no-comb
1tbz   hirugen          inhib-no-comb
1hag   hirugen          inhib-no-comb
1AHT   hirugen          inhib-no-comb
2hat   hirugen          inhib-no-comb
1ABI   hirugen like     inhib-no-comb
1SL3   hirugen like     inhib-no-comb
3HAT   hirugen like     inhib-no-comb
1A46   hirugen, dbref   inhib-no-comb
1YPJ   hirugen, dbref   inhib-no-comb
1D3Q   hirugen, dbref   inhib-no-comb
1Z71   hirugen, dbref   inhib-no-comb
1AIX   hirugen, dbref   inhib-no-comb
3BIV   hirugen, dbref   inhib-no-comb
1TA6   hirugen, dbref   inhib-no-comb
1YPG   hirugen, dbref   inhib-no-comb
1TA2   hirugen, dbref   inhib-no-comb
1TOM   hirugen, dbref   inhib-no-comb
1AWF   hirugen, dbref   inhib-no-comb
1A61   hirugen, dbref   inhib-no-comb
1AD8   hirugen, dbref   inhib-no-comb
1AE8   hirugen, dbref   inhib-no-comb
1AI8   hirugen, dbref   inhib-no-comb
1C4V   hirugen, dbref   inhib-no-comb
1A5G   hirugen, dbref   inhib-no-comb
1D3T   hirugen, dbref   inhib-no-comb
1D4P   hirugen, dbref   inhib-no-comb
1D3P   hirugen, dbref   inhib-no-comb
1K21   hirugen, dbref   inhib-no-comb
1D3D   hirugen, dbref   inhib-no-comb
1C4Y   hirugen, dbref   inhib-no-comb
1QHR   hirugen, dbref   inhib-no-comb
1C4U   hirugen, dbref   inhib-no-comb
1C5L   hirugen, dbref   inhib-no-comb
1ZGV   hirugen, dbref   inhib-no-comb
1VR1   hirugen, dbref   inhib-no-comb
1YPE   hirugen, dbref   inhib-no-comb
1YPK   hirugen, dbref   inhib-no-comb
3BIU   hirugen, dbref   inhib-no-comb
1ZGI   hirugen, dbref   inhib-no-comb
1YPL   hirugen, dbref   inhib-no-comb
1SB1   hirugen, dbref   inhib-no-comb
1UMA   hirugen, dbref   inhib-no-comb
1YPM   hirugen, dbref   inhib-no-comb
2BDY   hirugen, dbref   inhib-no-comb
1D9I   hirugen, dbref   inhib-no-comb
1XM1   hirugen, dbref   inhib-no-comb
1AFE   hirugen, dbref   inhib-no-comb
1A2C   hirugen, dbref                            inhib-no-comb
1a4w   hirugen, dbref                            inhib-no-comb
4thn   HIRUNORM IV                               inhib-no-comb
5gds   HIRUNORM V                                inhib-no-comb
1OKU   inhibitor                                 inhib-no-comb
1GVK   inhibitor                                 inhib-no-comb
1OKW   inhibitor                                 inhib-no-comb
1A30   inhibitor                                 inhib-no-comb
9gaf   inhibitor                                 inhib-no-comb
1pcg   inhibitor                                 inhib-no-comb
1h9l   inhibitor                                 inhib-no-comb
1eol   inhibitor                                 inhib-no-comb
1OL1   inhibitor                                 inhib-no-comb
1JCR   inhibitor                                 inhib-no-comb
1SMR   inhibitor                                 inhib-no-comb
1jyr   inhibitor                                 inhib-no-comb
1nb5   inhibitor                                 inhib-no-comb
1MF4   inhibitor                                 inhib-no-comb
1eb1   inhibitor                                 inhib-no-comb
9gac   inhibitor                                 inhib-no-comb
1okv   inhibitor                                 inhib-no-comb
1qur   inhibitor                                 inhib-no-comb
1eoj   inhibitor                                 inhib-no-comb
2ZHR   inhibitor                                 inhib-no-comb
2H9E   inhibitor                                 inhib-no-comb
1OL2   inhibitor                                 inhib-no-comb
5cev   inhibitor                                 inhib-no-comb
1gm2   inhibitor mimetic                         inhib-no-comb
1IBC   inhibitor peptide                         inhib-no-comb
2K1C   inhibitor peptide                         inhib-no-comb
3cqz   inhibitor, alpha-amanitin, gene product   inhib-no-comb
2vum   inhibitor, alpha-amanitin, gene product   inhib-no-comb
1k83   inhibitor, alpha-amanitin, gene product   inhib-no-comb
3cqz   inhibitor, alpha-amanitin, gene product   inhib-no-comb
1nx0   inhibitor, calpastatin                    inhib-no-comb
1BCS   inhibitor, chymostatin                    inhib-no-comb
1A1P   inhibitor, compstatin                     inhib-no-comb
1t9e   inhibitor, cyclic, dbref                  inhib-no-comb
2ARR   inhibitor, dbref                          inhib-no-comb
2ARQ   inhibitor, dbref                          inhib-no-comb
1EVD   inhibitor, natural                        inhib-no-comb
1EVC   inhibitor, natural                        inhib-no-comb
1fq8   inhibitor, of renin                       inhib-no-comb
1fq4   inhibitor, of renin                       inhib-no-comb
1fq5   inhibitor, of renin                       inhib-no-comb
1fq6   inhibitor, of renin                       inhib-no-comb
1fq7   inhibitor, of renin                       inhib-no-comb
1GA6   inhibitor, part of tyrostatin             inhib-no-comb
1GA1   inhibitor, part of tyrostatin             inhib-no-comb
1hd9   inhibitor, peptide                        inhib-no-comb
3C8A   inhibitor, peptide                        inhib-no-comb
3C88   inhibitor, peptide                        inhib-no-comb
3SEM   inhibitor, peptide                       inhib-no-comb
3C8B   inhibitor, peptide                       inhib-no-comb
3C89   inhibitor, peptide                       inhib-no-comb
1OKX   KH comment                               inhib-no-comb
1J9N   nucleopeptide                            inhib-no-comb
1KUK   pEKW endogenous inhibitor                inhib-no-comb
1KUG   pENW, endogenous inhibitor               inhib-no-comb
1k09   peptide denovo                           inhib-no-comb
1Y4E   peptide fragment                         inhib-no-comb
1j8n   peptide fragment, lt 10% NP              inhib-no-comb
1jq9   peptide inhibitor                        inhib-no-comb
1I73   peptide inhibitor                        inhib-no-comb
1e8n   peptide inhibitor                        inhib-no-comb
1jq8   peptide inhibitor                        inhib-no-comb
3BOO   peptide inhibitor                        inhib-no-comb
1cwd   peptide ligand                           inhib-no-comb
1cfa   peptide ligand                           inhib-no-comb
1cfn   peptide ligand                           inhib-no-comb
1kzo   peptide product                          inhib-no-comb
1YTJ   peptide product                          inhib-no-comb
1kzp   peptide product                          inhib-no-comb
1mt9   peptide substrate                        inhib-no-comb
1ov3   peptide substrate                        inhib-no-comb
1h28   peptide substrate                        inhib-no-comb
1mt8   peptide substrate                        inhib-no-comb
2hat   peptide substrate                        inhib-no-comb
1de7   peptide substrate                        inhib-no-comb
1cvu   peptide substrate                        inhib-no-comb
1mt7   peptide substrate                        inhib-no-comb
1oxn   peptide substrate                        inhib-no-comb
1bjr   peptide substrate                        inhib-no-comb
1jcs   peptide substrate                        inhib-no-comb
1ycp   peptide substrate                        inhib-no-comb
2v5w   peptide substrate                        inhib-no-comb
1bdk   peptide, bradikinin antagonist           inhib-no-comb
2IFR   peptide, transition state analog         inhib-no-comb
2IFW   peptide, transition state analog         inhib-no-comb
1vqk   peptide, transition state intermediate   inhib-no-comb
1vq8   peptide, transition state intermediate   inhib-no-comb
1vq9   peptide, transition state intermediate   inhib-no-comb
1KUI   pEQW endogenous inhibitor                inhib-no-comb
1tlp   phosphoramidon                           inhib-no-comb
2AST   protein fragment, inhibitor              inhib-no-comb
1PEK   substrate analog                         inhib-no-comb
148L   substrate cell wall                      inhib-no-comb
1GDN   substrate like                           inhib-no-comb
1FN8   substrate like                           inhib-no-comb
1AY3   toxin, nodularin                         inhib-no-comb
1qrp   transition analog                        inhib-no-comb
2aoh                                            inhib-no-comb
1jbu                                            inhib-no-comb
1jd6                                            inhib-no-comb
2AOC   inhib-no-comb
1PFG   inhib-no-comb
1G89   inhib-no-comb
1THS   inhib-no-comb
1ejy   inhib-no-comb
1cmk   inhib-no-comb
2hgt   inhib-no-comb
1XV3   inhib-no-comb
1QXQ   inhib-no-comb
1GJF   inhib-no-comb
1oy7   inhib-no-comb
1pts   inhib-no-comb
1dxp   inhib-no-comb
1IN3   inhib-no-comb
1oxq   inhib-no-comb
2AOF   inhib-no-comb
1brc   inhib-no-comb
1acb   inhib-no-comb
1JRR   inhib-no-comb
1cmi   inhib-no-comb
1fkn   inhib-no-comb
2AOI   inhib-no-comb
1CZQ   inhib-no-comb
1epl   inhib-no-comb
1g9i   inhib-no-comb
1g37   inhib-no-comb
1G8C   inhib-no-comb
1GJG   inhib-no-comb
1jvq   inhib-no-comb
1h27   inhib-no-comb
1gmc   inhib-no-comb
1gct   inhib-no-comb
1IN2   inhib-no-comb
1GJE   inhib-no-comb
1gha   inhib-no-comb
1foz   inhib-no-comb
1haz   inhib-no-comb
1HR1   inhib-no-comb
1OYT   inhib-no-comb
1ppe   inhib-no-comb
1ppf   inhib-no-comb
1o9u   inhib-no-comb
1cho   inhib-no-comb
1ny2   inhib-no-comb
1mct   inhib-no-comb
2AOG   inhib-no-comb
1IMW   inhib-no-comb
2AOD   inhib-no-comb
1R1L   inhib-no-comb
1smf   inhib-no-comb
1sfi   inhib-no-comb
1WCO   inhib-no-comb
1WO0                                                       inhib-no-comb
1VQN                                                       inhib-no-comb
2MIP                                                       inhib-no-comb
1f95                                                       inhib-no-comb
1gag                                                       inhib-no-comb
1VQ6                                                       inhib-no-comb
2gct                                                       inhib-no-comb
8gch                                                       inhib-no-comb
2tld                                                       inhib-no-comb
3gct                                                       inhib-no-comb
1QX9                                                       inhib-no-comb
1tab                                                       inhib-no-comb
1WO1                                                       inhib-no-comb
1jd5                                                       inhib-no-comb
1lk6                                                       inhib-no-comb
2AOJ                                                       inhib-no-comb
1jlu                                                       inhib-no-comb
1epm                                                       inhib-no-comb
1eak                                                       inhib-no-comb
1hbt                                                       inhib-no-comb
       (D)cyclohexylalanine-Pro-Arg-(CH2N+C5H4CH2CO)-(Gly)4-Asp- Tyr-Glu-Pro-Ile-Pro-Glu-Glu-Ala-cyclo-hexylalanin
5HVP   acetyl pepstatin                                    inhib-no-comb
1A7C   Ac-TVASS-NH2                                        inhib-no-comb
                                              inhibitor type 1 (PAI-1)
1DIT   CVS995; bifunctional inhibitor                      inhib-no-comb
2v3h   hirudin                                             inhib-no-comb
2v3o   hirudin                                             inhib-no-comb
2cn0   hirugen                                             inhib-no-comb
2cf9   hirugen                                             inhib-no-comb
2cf8   hirugen                                             inhib-no-comb
1A3E   hirutonin                                           inhib-no-comb
1A3B   hirutonin                                           inhib-no-comb
1IHS   hirutonin, bifunctional inhibitor                   inhib-no-comb
1IHT   HIRUTONIN-6                                         inhib-no-comb
1nx1   inhibitor, calpastatin                              inhib-no-comb
1ke2   inhibitor, chymostatin                              inhib-no-comb
2QKI   inhibitor, compstatin                               inhib-no-comb
2PSY   Leupeptin                                           inhib-no-comb
2AGI   Leupeptin                                           inhib-no-comb
2F9P   Leupeptin                                           inhib-no-comb
1JRS   Leupeptin                                           inhib-no-comb
2F9N   Leupeptin                                           inhib-no-comb
1TL9   Leupeptin                                           inhib-no-comb
1JRT   Leupeptin                                           inhib-no-comb
1POP   Leupeptin                                           inhib-no-comb
2NQA   Leupeptin                                           inhib-no-comb
2P0R   Leupeptin                                           inhib-no-comb
2PSX   Leupeptin                                           inhib-no-comb
2FO5   Leupeptin                                           inhib-no-comb
1lyb   pepstatin                                           inhib-no-comb
1pso   pepstatin                                           inhib-no-comb
4ER2   pepstatin                                           inhib-no-comb
1qs8   pepstatin                                           inhib-no-comb
2rmp   pepstatin                                           inhib-no-comb
6APR      pepstatin                        inhib-no-comb
1WKR      pepstatin                        inhib-no-comb
1apv      pepstatin analog                 inhib-no-comb
1apt      pepstatin analog                 inhib-no-comb
1apw      pepstatin analog                 inhib-no-comb
1apu      PEPSTATIN ANALOGUE               inhib-no-comb
1ppk      PEPSTATIN ANALOGUE               inhib-no-comb
4APR      PEPSTATIN-LIKE RENIN INHIBITOR   inhib-no-comb
5apr      PEPSTATIN-LIKE RENIN INHIBITOR   inhib-no-comb
5APR      PEPSTATIN-LIKE RENIN INHIBITOR   inhib-no-comb
1YTG      peptide product                  inhib-no-comb
1YTH      peptide product                  inhib-no-comb
1BFZ      peptide product                  inhib-no-comb
1eeo      peptide substrate                inhib-no-comb
1ZKF      peptide substrate                inhib-no-comb
1RMH      peptide substrate                inhib-no-comb
4SGA      peptide substrate                inhib-no-comb
1PJ8      peptide substrate                inhib-no-comb
3D3X      peptide substrate                inhib-no-comb
1VBS      peptide substrate                inhib-no-comb
2hod      peptide substrate                inhib-no-comb
1VBT      peptide substrate                inhib-no-comb
2q5a      peptide substrate                inhib-no-comb
1XN2      peptide substrate                inhib-no-comb
1NES      peptide substrate                inhib-no-comb
2hlo      peptide substrate                inhib-no-comb
5SGA      peptide substrate                inhib-no-comb
1ga4      PSEUDOIODOTYROSTATIN             inhib-no-comb
1nlu      PSEUDOIODOTYROSTATIN             inhib-no-comb
1ke1      PSEUDOTYROSTATIN                 inhib-no-comb
2er0      statin, L364 099                 inhib-no-comb
1XN3      statine based inhibitor          inhib-no-comb
3MAT      substrate based inhibitor        inhib-no-comb
1gy3      substrate peptide                inhib-no-comb
1kdz      TYROSTATIN                       inhib-no-comb
1ekb      VDDDDK-chloromethane             inhib-no-comb
3d9l      peptide ligand                   N-ter res
1x6n      Allosamidin                      split
1w9u      Argadin                          split
1waw      Argadin                          split
1wb0      Argifin                          split
1w9v      Argifin                          split
3chf      Argifin                          split
3che      Argifin                          split
3chd      Argifin                          split
3chc      Argifin                          split
1wvm      inhibitor, chymostatin           split
1m21      inhibitor, chymostatin           split
1sgc, 1BCSinhibitor, chymostatin           split
1jgf      pepstatin                        split
3emy      pepstatin                        split
1m43      pepstatin                        split
1ize   pepstatin        split
2qzx   pepstatin        split
1xdh   pepstatin        split
1w6i   pepstatin        split
1sme   pepstatin        split
1ls5   pepstatin        split
1xe5   pepstatin like   split
1xe6   pepstatin like   split
                                                         seqres?link?
pdbx_seq_one_letter_code   clean seq           counter   nolink?
RP(UN2)H(UN1)             R P (UN2) H (UN1)                    1 seqres
RGI ARG ALA ASP ASP MEA   (RGI) R A D D (MEA)                  2 seqres
DADE(FLT)L(AEA)           D A D E (FLT) L (AEA)                3 seqres
                          (SIN)                                 Q
(SIN)YEPI(HYP)EE(SMF)(ALC)Q Y E P I (HYP) E E (SMF) (ALC) 4 seqres
                          (SIN)                                 Q
(SIN)YEPI(HYP)EE(SMF)(ALC)Q Y E P I (HYP) E E (SMF) (ALC) 5 seqres
                          (SIN)                                 Q
(SIN)YEPI(HYP)EE(SMF)(ALC)Q Y E P I (HYP) E E (SMF) (ALC) 6 seqres
                          (SIN)                                 Q
(SIN)YEPI(HYP)EE(SMF)(ALC)Q Y E P I (HYP) E E (SMF) (ALC) 7 seqres
                          (SIN)                                 Q
(SIN)YEPI(HYP)EE(SMF)(ALC)Q Y E P I (HYP) E E (SMF) (ALC) 8 seqres
                          (SIN)                                 Q
(SIN)YEPI(HYP)EE(SMF)(ALC)Q Y E P I (HYP) E E (SMF) (ALC) 9 seqres
                          DGL DGL DTR DPN DTR (DGN) 10 seqres
G DAL DCY G DLE G DGN G (DAL) (DCY) G (DLE) G DLE (DGL) (DGL) (DTR) (DPN) (DTR) (DLE)
F D11 CPI NAL Q           F (D11) (CPI) (NAL) Q               11 seqres
                          (APP) (AIB) (CPI) (AIB) (AIB) L (BAL) Gseqres(AIB) (CPI) (AIB) G L (AIB) (TLX)
                                                              12 (AIB)
(APP)(AIB)(CPI)(AIB)(AIB)L(BAL)G(AIB)(AIB)(CPI)(AIB)GL(AIB)(TLX)
HPH MET ALA ILE           (HPH) M A I                         13 seqres
(ACE)NGDFEEIPEEYL         (ACE) N G D F E E I P E E Y L       14 link
                          D GLU I P E E Y LEU
ASP PHE GLU GLU ILE PRO F E EGLU TYR L Q GLN                  15 seqres
                          G D F GLU GLU Y L LEU GLN 16 seqres
GLY ASP PHE GLU GLU ILE PROE E I P E E TYRQ
                          D GLU I P E E Y LEU
ASP PHE GLU GLU ILE PRO F E EGLU TYR L Q GLN                  17 seqres
                          D GLU I P E E (STY)
ASP PHE GLU GLU ILE PRO F E EGLU STY LEU L                    18 seqres
                          D GLU I P E E Y LEU
ASP PHE GLU GLU ILE PRO F E EGLU TYR L Q GLN                  19 seqres
                          V THR D C SER G Q N L ASN E 20 CYS LEU Q G N K GLY SER ASN K N Q C GLY E G T
                                                              G seqres
VAL VAL TYR THR ASP CYS V Y T GLU T E SGLY GLNC L C LEU S N V C GCYS GLU C I L G S D G E VAL CYS V T GGLN GL
                          D GLU I P E E (STY) GLN
ASP PHE GLU GLU ILE PRO F E EGLU STY LEU L Q                  21 seqres
                          D GLU I P E E (TYS) GLN
ASP PHE GLU GLU ILE PRO F E EGLU TYS LEU L Q                  22 seqres
                          D GLU I P E E (TYS)
ASP PHE GLU GLU ILE PRO F E EGLU TYS LEU L                    23 seqres
                          G D F GLU GLU Y L LEU GLN 24 seqres
GLY ASP PHE GLU GLU ILE PROE E I P E E TYRQ
                          D GLU I P E E (TYS) GLN
ASP PHE GLU GLU ILE PRO F E EGLU TYS LEU L Q                  25 seqres
DFEEIPGE(TYS)L            D F E E I P G E (TYS) L             26 seqres
DFEEIPGE(TYS)L            D F E E I P G E (TYS) L             27 seqres
DFEEIPGE(TYS)L            D F E E I P G E (TYS) L             28 seqres
                          P G G G G D G D GLU I P ILE PRO seqres
                                                              Q
PRO GLY GLY GLY GLY ASP GLY ASP PHE F E EGLUE E Y L 29GLU GLU TYR LEU GLN
                          N G D PRO I P E E (TYS) L
ASN GLY ASP PHE GLU GLU ILE F E E GLU GLU TYS LEU             30 seqres
                          I Y T GLU SER G Q GLN L C LEU CYS LEU K G GLU I L SER G K VAL CYS GLY E G T P
                                                              31 N V C
ILE THR TYR THR ASP CYSTTHR D C T E S GLY N L CASN E G S seqres G CYS N K CGLYG S N ASN G N Q C V T G LYS GL
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           32 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           33 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           34 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           35 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           36 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           37 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           38 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           39 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           40 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           41 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           42 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           43 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           44 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           45 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           46 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           47 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           48 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           49 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           50 seqres
DFEEIPEE(TYS)LQ           D F E E I P E E (TYS) L Q           51 seqres
DFEEIPEE(TYS)LQ       D F E E I P E E (TYS) L Q       52 seqres
DFEEIPEE(TYS)LQ       D F E E I P E E (TYS) L Q       53 seqres
                      G D F GLU GLU (TYS) L Q
GLY ASP PHE GLU GLU ILE PROE E I P E E TYS LEU GLN    54 seqres
                      D GLU I P TYS LEU ALA
ASP PHE GLU GLU ILE PRO F E EALAE A (TYS) L A         55 seqres
                      D GLU I P E E (TYS) ALA
ASP PHE GLU GLU ILE PRO F E EGLU TYS LEU L A          56 seqres
                      N G D PRO I P E E (TYS) L
ASN GLY ASP PHE GLU GLU ILE F E E GLU GLU TYS LEU     57 seqres
                      D GLU I P E E Y LEU
ASP PHE GLU GLU ILE PRO F E EGLU TYR L                58 seqres
(ACE)NEDFEEIPEEYL     (ACE) N E D F E E I P E E Y L   59 seqres
                      G GLU I P E Y L
GLY PHE GLU GLU ILE PRO F E EGLUETYR LEU              60 seqres
                      F P (HMR) G G G G G N G D F E E 61 seqresL
FP(HMR)GGGGGNGDFEEIPEEYL                              IPEEY
DFEEIPEE(TYS)LA       D F E E I P E E (TYS) L A       62 seqres
(MBN)(ABN)(RNG)GVR    (MBN) (ABN) (RNG) G V R         63 seqres
NGDFEEIPEE(TYS)L      N G D F E E I P E E (TYS) L     64 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         65 seqres
GDFEEIPEE(TYS)LQ      G D F E E I P E E (TYS) L Q     66 seqres
DFEEIPEE(TYS)LA       D F E E I P E E (TYS) L A       67 seqres
NEDFEEIPEE(TYS)L      N E D F E E I P E E (TYS) L     68 seqres
NGDFEEIPEE(TYS)L      N G D F E E I P E E (TYS) L     69 seqres
DFEEIPEA(TYS)LA       D F E E I P E A (TYS) L A       70 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         71 seqres
DFEEIPEA(TYS)LA       D F E E I P E A (TYS) L A       72 seqres
NEDFEEIPEE(TYS)L      N E D F E E I P E E (TYS) L     73 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         74 seqres
NGDFEEIPEE(TYS)L      N G D F E E I P E E (TYS) L     75 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         76 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         77 seqres
NEDFEEIPEE(TYS)L      N E D F E E I P E E (TYS) L     78 seqres
ACENEDFEEIPGE(TYS)L A C E N E D F E E I P G E (TYS) L 79 seqres
NGDFEEIPEE(TYS)L      N G D F E E I P E E (TYS) L     80 seqres
GDFEEIPEE(TYS)LQ      G D F E E I P E E (TYS) L Q     81 seqres
GDFEEIPEE(TYS)LQ      G D F E E I P E E (TYS) L Q     82 seqres
GDFEEIPEE(TYS)LQ      G D F E E I P E E (TYS) L Q     83 seqres
NGDFEEIPEE(TYS)L      N G D F E E I P E E (TYS) L     84 seqres
GDFEEIPEE(TYS)LQ      G D F E E I P E E (TYS) L Q     85 seqres
ENEDFEGIPGE(TYS)L     E N E D F E G I P G E (TYS) L   86 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         87 seqres
ACENEDFEGIPGE(TYS) A C E N E D F E G I P G E (TYS) 88 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         89 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         90 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         91 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         92 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         93 seqres
NGDFEEIPEE(TYS)L      N G D F E E I P E E (TYS) L     94 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         95 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         96 seqres
DFEEIPEE(TYS)         D F E E I P E E (TYS)           97 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         98 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L         99 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L        100 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L        101 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L        102 seqres
DFEEIPEE(TYS)L        D F E E I P E E (TYS) L        103 seqres
NGDFEEIPEE(TYS)L          N G D F E E I P E E (TYS) L       104 link
ANS-DAR-2EP-KTH           (ANS) (DAR) (2EP) (KTH)           105 link
                          (CHG) H HMF T G D Y E E (BAL) 106 seqres
                                                            P E S H (HMF) G
CHG R NAL T D DAL G BAL P E SR (NAL) G D (DAL) G I P AIB AIB Y ALC DGL G D Y E E I P (AIB) (AIB) Y (ALC) (DGL)
                          (CHG) H HMF T G D Y E E (BAL) 107 S H (HMF) G
                                                            P E seqres
CHG V NAL T D DAL G BAL P E SV (NAL) G D (DAL) G I P AIB AIB Y ALC DGL G D Y E E I P (AIB) (AIB) Y (ALC) (DGL)
                          A ILE PFF NH2
ALA ALA ABA ARG SER LEUA (ABA) R S L I (PFF) (NH2)          108 link
ACE ASN PRO ILE           (ACE) N P I                       109 link
                          (ACE) R
ACE ARG ARG LEU ASN FCL NH2 R L N (FCL) (NH2)               110 seqres
GLU ASP LEU               EDL                               111 seqres
 inhibitor free GLYCINE     inhibitor free GLYCINE          112 one ligand
K DCY I L C R L L Q       K (DCY) I L C R L L Q             113 seqres
 ACE VAL GLU PRO ILE (ACE) V E P I                          114 seqres
                          R (CPI)                            EA
R CPI NLE DOA D Y E P I P E E A (NLE) (DOA) D Y E P I P E115 seqres
CIR CIR LEU ILE PFF NH2 (CIR) (CIR) L I (PFF) (NH2)         116 seqres
CYS VAL PHE MET           CVFM                              117 seqres
(PIV)HPFH(LPL)YYS         (PIV) H P F H (LPL) Y Y S         118 seqres
A P S PTR V N V Q N       A P S (PTR) V N V Q N             119 seqres
                          E P ALA THR
 GLU PRO GLN ASN CYS SERQ N C S A T                         120 seqres
VAL ALA PHE ARG SER V A F R S                               121 seqres
                          D Y E P P E ALA
 ASP TYR GLU PRO ILE PRO GLUIGLU E A FPHE                   122 seqres
 inhibitor free GLYCINE     inhibitor free GLYCINE          123 one ligand
                          RR
 ARG ARG LEU ILE PHE NH2 L I F (NH2)                        124 link
                          I P E E A ALC DGL                 E A seqres
ABU G G G G N G D Y E P (ABU) G G G G N G D Y E P I P E 125 (ALC) (DGL)
                           EEA                              EA
R CPI TIH DOA D Y E P I P R (CPI) (TIH) (DOA) D Y E P I P E 126 seqres
EVN(LOL)(ALQ)AEF          E V N (LOL) (ALQ) A E F           127 seqres
(DTY)IRL(LPD)             (DTY) I R L (LPD)                 128 seqres
                          RR
ARG ARG LEU ASN PFF NH2 L N (PFF) (NH2)                     129 seqres
 inhibitor free LYS         inhibitor free LYS              130 one ligand
                          S C T K PRO GLN CYS
 SER CYS THR LYS SER ILE PRO S I P P Q C Y TYR              131 seqres
(ACE)WEHD                 (ACE) W E H D                     132 seqres
ITF(L2A)YYGKKK            I T F (L2A) Y Y G K K K           133 seqres
N HYP ILX TRX G I G CSX N (HYP) (ILX) (TRX) G I G (CSX) 134 seqres
N HYP ILX TRX G I G CSX N (HYP) (ILX) (TRX) G I G (CSX) 135 seqres
N HYP ILX TRX G I G CSX N (HYP) (ILX) (TRX) G I G (CSX) 136 seqres
ASN--HYP-- ILX ?          N (HYP) (ILX)                     137 seqres
 ALA LYS ALA ILE ALA      AKAIA                             138 seqres
CSI L PHA                 (CSI) L (PHA)                     139 one ligand
ICVVQDWGHHRCT(NH2) I C V V Q D W G H H R C T (NH2) 140 seqres
                          F R
G R ABA T K S I P P I ABA G P (ABA) T K S I P P I (ABA) F P 141 seqres
(ACE)TEAAAGMGGVMTGR                                          R
                          (ACE) T E A A A G M G G V M T G142 seqres
(ACE)TEAAAGDGGVMTGR                                          R
                          (ACE) T E A A A G D G G V M T G143 seqres
(ACB)V(ADD)(ILG)(MDH) (ACB) V (ADD) (ILG) (MDH)             144 seqres
(ACB)V(ADD)(ILG)(MDH) (ACB) V (ADD) (ILG) (MDH)             145 seqres
???                                                         146 link
???                                                         147 link
???                                                         148 link
???                                                         149 link
???                                                         150 link
unk Y unk                 (UNK) Y (UNK)                     151 seqres
unk (PHI) unk             (UNK) (PHI) (UNK)                 152 seqres
NLE C T A S I P P Q C Y (NLE) C T A S I P P Q C Y           153 seqres
RRGL(NH2)                 R R G L (NH2)                     154 seqres
RRGC(NH2)                 R R G C (NH2)                     155 seqres
PPPV(NMC)PRRR             P P P V (NMC) P R R R          156 seqres
RRGI(NH2)                 R R G I (NH2)                  157 seqres
RRGM(NH2)                 R R G M (NH2)                  158 seqres
(1BO)ATTL(SUJ)(CNT)V (1BO) A T T L (SUJ) (CNT) V         159 seqres
(ACE)KWK(HSE)A            (ACE) K W K (HSE) A            160 seqres
GLU LYS TRP               EKW                            161 seqres
GLU ASN TRP               ENW                            162 seqres
                          GC
D G CLH ABA Q T F V Y G D G (CLH) (ABA) Q T F V Y G G C163 seqres
                          FLQSDVF                        AGYFLP
FLQSDVFFLFLLPPIILDAGYFLPLR(HSL) F L F L L P P I I L D 164 seqres L R (HSL)
                          I
I W G C ASA G K L I C T T AW G C (ASA) G K L I C T T A   165 seqres
PHE LEU SER TYR LYS F L S Y K                            166 seqres
PL(PAT)                   P L (PAT)                      167 seqres
                          GFGPFG
GLY PHE GLY PRO PHE GLY PHE ALA F A                      168 seqres
LEU ALA ILE TYR SER       LAIYS                          169 seqres
(ACE)(CSO)RATKML          (ACE) (CSO) R A T K M L        170 seqres
P E G D PM3 E E V L       P E G D (PM3) E E V L          171 seqres
C L G DAR                 C L G (DAR)                    172 seqres
G A T P Q D L N T NLE     G A T P Q D L N T (NLE)        173 seqres
                          K K K CYS K C V I MET
LYS LYS LYS SER LYS THR LYS S K T VAL ILEM               174 seqres
(PPN)EA(NLE)S             (PPN) E A (NLE) S              175 seqres
                          K K K CYS K C V I MET
LYS LYS LYS SER LYS THR LYS S K T VAL ILEM               176 seqres
                          R P G N SER S R PRO
ARG PRO GLY ASN PHE LEU GLN F L QARG P                   177 seqres
                          K Q P P PRO P P ARG A E A R K ALA GLU
                                                         178
LYS GLN PRO PRO SER ASN PRO S N P PROR P P PRO PRO K seqres ALA ARG LYS LYS
                          A ARG K R R L F G E
ALA GLY SER ALA LYS ARG G S ALEU PHE GLY GLU             179 seqres
                          K A R ALA E A SER
LYS ALA ARG VAL LEU ALA GLUV L A METM S                  180 seqres
                          (MBN) RNG GLY VAL V R
 Fibrinopeptide A Mimic MBN ABN (ABN) (RNG) GARG         181 seqres
                          T V VAL VAL PRO ARG
  THR VAL GLU LEU GLN GLY E L Q G V V P R                182 seqres
                          T ASN T I N A S
  THR LYS THR ALA THR ILEK T A ALA SER                   183 seqres
                          V S ILE Y P V Q N
  VAL SER GLN ASN TYR PRO Q N VAL IGLN ASN               184 seqres
                          A E A V SER GLU
  ALA GLU ALA VAL PRO TRP LYS P W K S E                  185 seqres
                          V A Q G G A A G ALA
  VAL ALA GLN GLY GLY ALA ALA GLY LEU L A                186 Seqres
                          TK
  THR LYS CYS VAL PHE MET C V F M                        187 seqres
                          YG
  TYR GLY VAL ARG GLY PRO V R G P                        188 seqres
ALY-MCM                   (ALY) (MCM)                    189 link
                          RR                             R
R R P HYP G TIH S IGL OIC R P (HYP) G (TIH) S (IGL) (OIC)190 seqres
FKF(TA2)AL(AAR)           F K F (TA2) A L (AAR)          191 seqres
FKF(PSA)L(AAR)            F K F (PSA) L (AAR)            192 seqres
   C C DA F ACA           C C D A F (ACA)                193 seqres
   C C DA F ACA           C C D A F (ACA)                194 seqres
   C C A F ACA            C C A F (ACA)                  195 seqres
GLU GLN TRP               EQW                            196 seqres
(RHA) LEU TRP             (RHA) L W                      197 seqres
AGSVEQ(TPO)PKK            A G S V E Q (TPO) P K K        198 seqres
                          P
PRO ALA PRO PHE ALA ALAA P F A A                         199 seqres
AE(API)A                  A E (API) A                    200 seqres
GLY ALA LYS               GAK                            201 seqres
GLY ALA ARG               GAR                            202 seqres
(ACB)RE(MDH)              (ACB) R E (MDH)                203 seqres
IVA V V PLE HFA A A       (IVA) V V (PLE) (HFA) A A      204 seqres
V S F N FRD P Q I T A     V S F N (FRD) P Q I T A        205 seqres
                          E CYS V L THR TRP GLU E R 206 seqres
GLU GLU TRP GLU VAL LEUE W ETRP C W T W E T CTHR CYS GLU ARG
                          A PRO Y L P E G G
ALA VAL PRO PHE TYR LEUV P F GLU GLY GLY                 207 seqres
                       (ACE)                             208
(ACE)(OLT)I(2AO)(NLE)QR(NH2) (OLT) I (2AO) (NLE) Q R (NH2) seqres
(ACE)PAPFAAAA(NH2)     (ACE) P A P F A A A A (NH2)       209 seqres
                       I
ILPWKWPWWPWRR(NH2) L P W K W P W W P W R R (NH2) seqres  210
(SIN)YEPIPEEAAE        (SIN) Y E P I P E E A A E         211 seqres
                       K LYS A T K K GLY GLNALA K 212 seqres
LYS ARG PRO ALA ALA THRR P ALYS ALAA G Q A K K K LYS LYS LYS LYS
                       T Y ALA I A S G R T G THR A213 seqres ASN ALA ILE HIS ASP ILE LEU
THR THR TYR ALA ASP PHETILEA D FSER GLY ARGR R NGLYH D I L I ARG ARG
ARG PRO PHE            RPF                               214 seqres
                       H S S G Y T R P L R K P S R P I F 215 P
                                                          I R seqres
HSSGYTRPLRKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHL I G C D V C Y G I P S S T A R L C C F R Y G D C C H L
                                                         2
ILKKWPWWPWRRK(NH2)I L K K W P W W P W R R K (NH2) 16 seqres
                       (ACE)                              G (NH2)
(ACE)RAGPLQWLAEKYQG(NH2) R A G P L Q W L A E K Y Q 217 seqres
                       A E V SER K S
ALA GLU VAL VAL ALA VAL LYS V A VGLU E                   218 seqres
FSHPQNT                FSHPQNT                           219 seqres
                          G S V V ARG R I L S L Y SER 220 seqres
LYS GLY SER VAL VAL ILEKVAL GLY I V G ILE IILE LEU R K LY ARG LYS
(ACE)RPLQWLAEKYFQ(NH2)                                   221
                       (ACE) R P L Q W L A E K Y F Q (NH2) seqres
                       AVPIAQKS
ALA VAL PRO ILE ALA GLN LYS SER GLU E                    222 seqres
RPGN(FRD)LQSRP(NH2) R P G N (FRD) L Q S R P (NH2) 223 seqres
                       V GLU C S ALA GLU THR GLY M I seqres F ALA MET K C A P ARG G G TYR PHE N N F
                                                         224 CYS Y
VAL ARG GLU VAL CYS SERR E V GLNE Q A E T G P C R APROS R WARG D V T E G ILE SER F F Y TRP C G G N RASP VA
                       T E F G LYS SER F P PRO GLU VAL seqres E LYS L H VAL ASP V Y ALA E G GLU T L PH
                                                           VDQAR
THR GLU PHE GLY SER GLU LEU S E L K S PHEE V V G K T225 VAL GLY Y F TTHR Y P Q Y DGLN F L PARG S P VTYR D L
(ACE)TEAAAGTGGVMTGR                                       R
                       (ACE) T E A A A G T G G V M T G 226 seqres
                         ALA I K MET M S GLU Q Q D S E C GLN A L SER N I GLU I A A H I THR F D ALA N
                                                         227 seqres
LYS ALA VAL ILE LYS ASNK A VASPN A D SER E E MGLU MET V GLN A T QASP E K YVALE K DCYS ALA K K EGLN K K YLEU
                       E GLU PHE
GLU VAL ASN LOL ALQ ALA V N (LOL) (ALQ) A E F            228 link
RPGN(FRD)LQSRP(NH2) R P G N (FRD) L Q S R P (NH2) 229 seqres
                       (ACE) G (DAL) (DCY) (DGL) (DAL)230 seqres (DAR) (DGL) (DTR) (DAL) (DTR) (DLE) (DCY) (D
                                                           (DAR) (DHI)
(ACE)G(DAL)(DCY)(DGL)(DAL)(DAR)(DHI)(DAR)(DGL)(DTR)(DAL)(DTR)(DLE)(DCY)(DAL)(DAL)
                       PL
PRO LEU GLU PSA ARG LEU E (PSA) R L                      231 seqres
                       E P C C ARG R C T K LYS SER 232 PRO I
                                                         ILE seqres
GLU PRO CYS CYS ASP SER CYS D S CCYS THRS I P P Q C H C A NPRO GLN CYS HIS CYS ALA ASN ILE
                       F E A P A LEU
PHE GLU ALA ILE PRO ALA GLUI TYRE Y L                    233 seqres
                       I
ILPWKWPWWPWRR(NH2) L P W K W P W W P W R R (NH2) seqres  234
(ACE)RPLQWLAEKYFQ(NH2)                                   235
                       (ACE) R P L Q W L A E K Y F Q (NH2) seqres
                       (ACE) S THR
(ACE) SER GLU ALA ALA ALA SER E A A A S T                236 seqres
                       K P S A LEU PHEGLY
LYS PRO SER ALA CYS ARG ASN C R N L F G P PRO            237 seqres
PRO GLY ALA TYR        PGAY                              238 seqres
TYR ALA GLY PRO UNK Y A G P (UNK)                        239 seqres
                       (ACE) R A G                        (LNK) G (NH2)
(ACE)RAGPLQWLAEKYQ(LNK)G(NH2) P L Q W L A E K Y Q 240 seqres
                       C                                 241
CRAGPLQWLCEKYFG(NH2) R A G P L Q W L C E K Y F G (NH2) seqres
TYR VAL GLY PRO        YVGP                              242 seqres
                       (ACE) F PHE
(ACE) PHE GLU LEU ASP LYSASP E L D K D F                 243 seqres
VAL GLU PRO ILE        VEPI                              244 seqres
                       I
ILAWKWAWWAWRR(NH2) L A W K W A W W A W R R (NH2) seqres  245
(SIN)FEEIPEEYLQ        (SIN) F E E I P E E Y L Q         246 seqres
                       R LEU R I M E C K LYS LYS L247SER ASP CYS LEU G
                                                           A CVC
ARG VAL CYS PRO ARG ILE V C PMETLGLU CYS K D S D CASP Eseqres L E H G Y CALA GLU CYS VAL CYS LEU GLU HIS
                       L A A CYS D C GLU P K PRO T248 Y RALA CYS THR K T GLU TYR N F PRO V V CYS G
                                                           L PRO P
LEU ALA ALA VAL SER VAL ASPV S V SER S E YTYR P A CLYS E seqres L C G S D NLEU Y G N K C ARGC N A LEU E S NGL
                       V ALA K F GLU L I H R HIS ARG LEU GLU
                                                         Q
VAL GLU PRO GLN LYS PHEE P QGLU A E ELEU ILEL E A V 249 seqres ALA VAL GLN
                       L A A CYS D C GLU P K PRO T250PRO ALA CYS D N K T GLU K C ARG N A LEU CYS G
                                                           L YRP
LEU ALA ALA VAL SER VAL ASPV S V SER S E YTYR P A CLYS E seqres L C G STHR LEUY G NTYR N F CPRO V V E S N G
ARG PRO PRO GLY PHE R P P G F                            251 seqres
                       R I C P R I GLU CYS R D ARG M A K C C V CYS MET
                                                         252 seqres
ARG ILE CYS PRO ARG ILE TRP METW M E C T THR S D C ASP SERI ASP A G H C G ALA LYS CYS ILE CYS VAL ALA GLY
                       (ACE) T I (2AO) (NLE) Q R (NH2) 253 seqres
(ACE)TI(2AO)(NLE)QR(NH2)
                       C                                 254
CRAGPLQWLCEKYFG(NH2) R A G P L Q W L C E K Y F G (NH2) seqres
                       (ACE)                             255
(ACE)(OLT)I(2AO)(NLE)QR(NH2) (OLT) I (2AO) (NLE) Q R (NH2) seqres
(ACE)SEAAAS            (ACE) S E A A A S                 256 seqres
                       E P C C ARG R C T K LYS SER ILECseqres
                                                           H ANI
GLU PRO CYS CYS ASP SER CYS D S CCYS THRS I P P E C257 PRO PRO GLU CYS HIS CYS ALA ASN ILE
                       G ILE PRO I P P I C F P PHE PRO ASP
GLY ARG CYS THR LYS SERR C T K S PRO ILECYSD             258 seqres
                       I (DBU) (DAL) I (DHA) L C (ABA) P259 seqres G A L M G
                                                          G C K (ABA)
I(DBU)(DAL)I(DHA)LC(ABA)PGCK(ABA)GALMGCNMK(ABA)A(ABA)CNCSIHV(DHA)K C N M K (ABA) A (ABA) C N C S I H V
                        KW                             260 seqres
KWCFRVCYRGICYRRCR(NH2) C F R V C Y R G I C Y R R C R (NH2)
CCAF(ACA)(BTN)          C C A F (ACA) (BTN)            261 seqres
FVFLEI(NH2)             F V F L E I (NH2)              262 seqres
                        M THR K S THR
MET SER CYS ASP LYS SERS C DGLN T Q T                  263 seqres
                        P A T G ASN MET S P PRO        264
PRO ALA THR GLY ASP PHE MET D F M N MSER V G VAL GLY seqres
CCAF(ACA)(BTN)          C C A F (ACA) (BTN)            265 seqres
TYR ALA GLY PRO UNK Y A G P (UNK)                      266 seqres
Gly-Ala-Trp             GAW                            267 seqres
                        S SER A P LEU V L LEU THR V268 T TLYS P E VAL SER ALA THR P S ALA ALA A G GLU
                                                        S GLY A
SER ALA LEU TYR ALA PROA L Y ALA S A LVAL T V G K GVAL A seqresA GLY R A V T L T C A P GTHR G T H P APRO S A C
TYR ALA GLY PRO UNK Y A G P (UNK)                      269 seqres
                        IC
ICLKKWPWWPWRRCK(NH2) L K K W P W W P W R R C K (NH2)   270 seqres
                        S G H THR ASP D E PRO S S GLU C D SER LYS K S CYS K C ASP GLN CYS S C H S TH
                                                       271 seqres
SER GLY HIS HIS ASP GLU THR H D E T T GLUP S E SERK P C SER Q C S C T PROM P PCYS R C S D I R L NSER CYSA C
                        KW                             272 seqres
KWCFRVCYRGICYRRCR(NH2) C F R V C Y R G I C Y R R C R (NH2)
                        PRO ASP GLN ALA
ALA ILE ALA TYR PHE ILE A I A Y F I P D Q A            273 seqres
                        (ACE)
ACE SER GLU ALA ALA ALA SERS E A A A S                 274 seqres
VSFN(FRD)PQITAA(NH2) V S F N (FRD) P Q I T A A (NH2) 275 seqres
                        T Y ALA I A S G R T G THR (SEP)seqres
                                                       276 I H D
THR THR TYR ALA ASP PHETILEA D FSER GLY ARGR R AGLY ARG ARG ALA SEP ILE HIS ASP
                        T ARG (PSA)
THR PHE GLN ALA PSA LEUF Q A GLU L R E                 277 seqres
                        GPAGPP
GLY PRO ALA GLY PRO PRO GLY ALA G A                    278 seqres
                        GLY GLY R (PAA) ASP TYR GLU PRO E E A A GLU GLU ALA ALA GLU
                                                        P I seqres
CHX ALA PRO ARG (PAA) (CHX) A PGLY GLY G G G G D Y E279 P ILE PROE
(ACE)VV(STA)A(STA)      (ACE) V V (STA) A (STA)        280 seqres
(THC)VAS(SET)           (THC) V A S (SET)              281 seqres
                        (2PP) D P R                    282 E E I
(2PP)DPR(FMT)GGGGGNGDFEEIPEYL(FMT) G G G G G N G D FseqresP E Y L
PHE--SIN?               F (SIN)                        283 N-ter res
PHE-SIN?                F (SIN)                        284 N-ter res
PHE--SIN?               F (SIN)                        285 N-ter res
PHE--SIN ?              F (SIN)                        286 N-ter res
PHE--SIN ?              F (SIN)                        287 N-ter res
                        (T16) ASP S H N D PHE GLU I P E Eseqres
                                                       288 Y L
T16 GLY GLY GLN SER HIS ASNG G QGLY ASP G D F E E GLU ILE PRO GLU GLU TYR LEU
                        (T29) ASP S H N D PHE GLU I P E Eseqres
                                                       289 Y L
T29 GLY GLY GLN SER HIS ASNG G QGLY ASP G D F E E GLU ILE PRO GLU GLU TYR LEU
                        (ACE) F P R (CBG) Q S H N D G D290 seqres E Y L Q
(ACE)FPR(CBG)QSHNDGDFEEIPEEYLQ                          FEEIPE
                        (ACE) F P                      291 seqres
(ACE)FPR(PTL)(FBE)(FBE)DFEPIPL R (PTL) (FBE) (FBE) D F E P I P L
                        D SER A L ASP F T
  ASP ALA ILE ASP ALA LEU A I D SERS S D PHE THR       292 seqres
CSI L PHA               (CSI) L (PHA)                  293 seqres
                        (ACE)                           (NH2)
(ACE)ICVWQDWGAHRCT(NH2) I C V W Q D W G A H R C T294 seqres
(ACE)LLR                (ACE) L L R                    295 seqres
(ACE)LLR                (ACE) L L R                    296 seqres
(ACE)LLR                (ACE) L L R                    297 seqres
(ACE)LLR                (ACE) L L R                    298 seqres
(ACE)LLR                (ACE) L L R                    299 seqres
(ACE)LLR                (ACE) L L R                    300 seqres
(ACE)LLR                (ACE) L L R                    301 seqres
(ACE)LLR                (ACE) L L R                    302 seqres
(ACE)LLR                (ACE) L L R                    303 seqres
(ACE)LLR                (ACE) L L R                    304 seqres
(ACE)LLR                (ACE) L L R                    305 seqres
(ACE)LLR                (ACE) L L R                    306 seqres
IVA V V STA A STA       (IVA) V V (STA) A (STA)        307 seqres
IVA V V STA A STA       (IVA) V V (STA) A (STA)        308 seqres
(IVA)VV(STA)A(STA)      (IVA) V V (STA) A (STA)        309 seqres
IVA V V STA A STA       (IVA) V V (STA) A (STA)        310 seqres
IVA V V STA A STA       (IVA) V V (STA) A (STA)        311 seqres
(IVA)VV(STA)A(STA)       (IVA) V V (STA) A (STA)           312   seqres
(IVA)VV(STA)A(STA)       (IVA) V V (STA) A (STA)           313   seqres
IVA V V DFO NME          (IVA) V V (DFO) (NME)             314   seqres
IVA V V LTA              (IVA) V V (LTA)                   315   seqres
IVA V V DFI NME          (IVA) V V (DFI) (NME)             316   seqres
(IVA) VAL VAL (STA) (OET)(IVA) V V (STA) (OET)             317   seqres
(IVA) VAL VAL (STA) (OET)(IVA) V V (STA) (OET)             318   seqres
(IVA)HPFH(STA)LF         (IVA) H P F H (STA) L F           319   seqres
IBU H P F C STA L F DHL (IBU) H P F C (STA) L F (DHL)      320   seqres
HPFC(STA)LF(DHL)         H P F C (STA) L F (DHL)           321   seqres
PIV(NH2)                 P I V (NH2)                       322   seqres
(ACE)SLNF                (ACE) S L N F                     323   seqres
(ACE)SYVKA               (ACE) S Y V K A                   324   seqres
L E F PTR M D Y E        L E F (PTR) M D Y E               325   seqres
(SIN)AGPF(NIT)           (SIN) A G P F (NIT)               326   seqres
(SIN)AAPF(NIT)           (SIN) A A P F (NIT)               327   seqres
(ACE)PAPF                (ACE) P A P F                     328   seqres
PAPFPA(NH2)              P A P F P A (NH2)                 329   seqres
RIME(NH2)                R I M E (NH2)                     330   seqres
A(DAL)PF(NIT)            A (DAL) P F (NIT)                 331   seqres
G HYP R P                G (HYP) R P                       332   seqres
A(ALT)PF(NIT)            A (ALT) P F (NIT)                 333   seqres
F TPO CPI NAL Q          F (TPO) (CPI) (NAL) Q             334   seqres
WWSEVN(DLE)(ALQ)AEF W W S E V N (DLE) (ALQ) A E F          335   seqres
(ACE)APA                 (ACE) A P A                       336   seqres
G HYP R P                G (HYP) R P                       337   seqres
(ACE)PAPY                (ACE) P A P Y                     338   seqres
IVA PHI TYB              (IVA) (PHI) (TYB)                 339   seqres
IVA PHI TYB              (IVA) (PHI) (TYB)                 340   seqres
IVA Y TYB                (IVA) Y (TYB)                     341   seqres
IVA H P F H CHS L F      (IVA) H P F H (CHS) L F           342   seqres
KTEEISEVN(STA)VAEF       K T E E I S E V N (STA) V A E F   343   seqres
(AHH)ALVF                (AHH) A L V F                     344   seqres
                         H LYS
  HIS HIS ALA SER PRO ARGH A S P R K                       345   seqres
IVA Y L TYB              (IVA) Y L (TYB)                   346   seqres
                         VD
  VAL ASP ASP ASP ASP LYS D D D K                          347   seqres
TYR--BTN                 Y (BTN)                           348   N-ter res
AO3                      AO3                                 1   one ligand
RIG                      RIG                                 2   one ligand
RIG                      RIG                                 3   one ligand
RAG                      RAG                                 4   one ligand
RAG                      RAG                                 5   one ligand
URG                      URG                                 6   one ligand
VRG                      VGR                                 7   one ligand
WRG                      WRG                                 8   one ligand
ZRG                      ZRG                                 9   one ligand
CHY                      CHY                                10   one ligand
CHY                      CHY                                11   one ligand
CST                      CST                                12   one ligand
IHN                        inhibitor free GLYCINE           13   one ligand
                         IHN                                14   one ligand
IHN                      IHN                                15   one ligand
IHN   IHN   16   one ligand
IHN   IHN   17   one ligand
IHN   IHN   18   one ligand
IHN   IHN   19   one ligand
IHN   IHN   20   one ligand
IHN   IHN   21   one ligand
5FE   5FE   22   one ligand
5FP   5FP   23   one ligand

				
DOCUMENT INFO
Shared By:
Categories:
Tags:
Stats:
views:10
posted:9/18/2012
language:Latin
pages:56