
C5011-Pengurusan Pembinaan

Document Sample
C5011-Pengurusan Pembinaan Powered By Docstoc
					                                   C 5011 PENGIIRUSANPEMBINAAN


               Awammerupakan industri
                            satu      yangutamayang
menyumbangkepada ekonomi
pembinaan dapat
        yang      memajukan
                                  dua iaitu:
i.  KerjaBangunan
ii. KerjaKejuruteraan

i.        Rumah kediaman
ii.       Hartanahperdagangan
iii.      Hartanahkhasseperti
iv.       Pejabat-pejabat
v.        Hospital,

                              kepada jenis iaitu:
   i.       Kejuruteraan
   ii.      Kejuruteraan
   i.      Jalanraya
   ii.     Lebuhraya
   iii.    Jambatan
                                     C 5011 PENGIIRUSANPEMBINAAN

  iv.       Jeti
  V.        Terowong
  vi.       Pembentungan

                Awam Berat

            Empangan  sungai
            Lapangan terbang
            Rangkaian Lebuhraya Negara
            Landasan keretapi,

              binaanmenjadi penggalak
       industry kerana
              lain       bahagian
       simen,pasir,keluli,   papan Cat
                         bata,    ,   dansebagainya.
       Sebagai industriperkhidmatan
                                  dalam  menyediakankemudahan
                        danbangunan.  Industri
                                            pembinaan adalah
       kompleks mempunyai
                dan                  yangtersendiri
                              ciri-ciri          iaitu:

       1"     Rekabentuktersendiri

             Projek pembinaan memerlukan pendekatan yangberbeza
             untuk melaksanakannya.Initerjadi
                                            mungkin diselbabkan
             rekabentuk berbeza setiap
                        yang       bagi        pemninaan.Jika
             rekabentuk berbeza,penggunaan bahan, buruh rogidan
             sumber  yangterhadyangrainadarah        jenis,"
             saiz,,jenama,tahapkecekapan kerja,kemahirindan
             sebagainya. pengalaman projek
                                   dari       yanglepasjuga
             tidakdapat gunakan
                       di                     -
                            C 5011 PENGURUSAN


     i.     Fungsi kegunaan
                   dan          yangberbeza.
     ii.    Pengaruh alamsekitar       jenistanah,kawasan
            lombong ,cuaca,musim  dsb.
     iii.   Penonjolan identiti prestij
                             dan       padabangunan yang

2.   SaizProjek

              yangbesar         (Canggih)
                      dankompleks      biasanya

     i.     Sejumlahmodal yangbesar.
     ii.    Jenisdanbilangan yangbanyak.
     iii.   Pekerjaatautenaga mahirsamada  sepa
            professional berpengalaman.
     iv.    Kaedah teknik
                   dan                  binaan
                             atauteknologi     yanglebih
            rumit           dan
                 dancanggih memerlukan     kepakaran

3.   Lokasiprojekyang berlainan

     Lokasiakanmempengaruhi   binaanstrukturbawah  tanah
     sesuatu pembinaan.
     Selain itufaktor
           dari             jugamungkin
                       lokasi            memberi  kesan
     sampingan  yanglainkepada  pembinaan sepertikeadaan
     tanah, pantai,
           tepi      penduduk           bangunan
                     pembinaan, tapak
     disekeliling                          binadengan
     ibupejabat akanmempengaruhi  overhead lain-
     lain.Kesesauaianpemilihan      jugaperlu
                              jentera         difikirkan
     dengan lokasiyangterlibat.

4.             kepadakeadaan
      Bergantung           setempat.

      Peraturan-peraturan            codes) seperti
      kod,akta,           kecil
              undang-undang , enakmen  dll.
                                C 5Oi1 PENGURUSANPEMBINAAN

     5.   Jangkahayatyang panjang(lifespan)

          Lackof turn-over tradein.


     Amalan         adalah
           Pengurusan      komplekskeranaianyadiuruskan
                       adalahmakhlukyangkompleks dan
     mempunyaipelbagai               pemikiran
                     cara,rasa,kaedah,       yang

     Menurut     Psikoanalisis
                           Swiss,        Jungpernah

     'Lebih senangpergike Marikh atauke bulan
     daripadamenembusijiwa manusia'.

     Berikut     beberapa                yangsering
                          takrifPengurusan        diguna

A.   Takrif-takrifPengurusan:

1.   RobertKreitner:1983:

     Pengurusanmerupakansuatu proses kerjadengan dan
     melalui orang lain bagi mencapaiobjektif organisasi
     terhad secara cekapdalamsuasanayang senfiasa
                                               C 5011 PENGURUSAN

             2.   Donnelly,
                          Gibsondan lvancevich

                  Pengurusanialah satu proses yang dilalui oleh satu atau
                  Iebih individu untuk menyelaras aktiviti orang lain untuk
                  mencapaikeputusanyang tidak boleh dicapai oleh
                  seseora yang bertindak berseorangan.

             3.   Massiedan Douglas(1992:24):

                  Safuproses...... ia bukan semata-mata satubadan
                  pengetahuan,teori-teori,idea-idea,tetapi ianyajuga aktif
                  dan melibatkanfungsi-fungsi yang jelas dan berbeza-
        ')   4.   Kastdan Rosenweing

                  Pengurusanmelibatkanpenyelarasansumber manusia dan
                  bahan ke arah pencapaianobjektif.

             5.   Jaafar     (1988:1)

                  Pengurusanialah satu proses mengagihkaninput-input
                  organisasi(termasuksumber ekonomidan sumber
                  kakitangan)dengan cara
                  perancanga pengorg ani s asian,penga
                             n,                        rahan dan
                  pengawalan  untuk tujuan mengeluarkan  output (segala
                  barangandan perkhidmatan)yang diperlukan oleh
        i         pelanggan-pelanggan  supaya objektif organisasi tercapai.

             Secara amnya  Pengurusan bolehlah
             yangberkaitan dengan ehwalmengurus
                                  hal               ataumelaksanakan
             sesuatu aktiviti
                           dengan menggunakan  teknik-teknik kemahiran
                    bagimencapai  objektif
             gabungan antara  perancangan(planning),
                                                  penyusunan (organizing),
             pengagihan (delegating) kawalan
                                   dan        (controlling).


                               C 5011 PENGURUSAN

Selain       itu          juga
     daripada Pengurusan merupakan      penyelarasan
kesemuasumber-sumber pengeluaran      satuproses
                                melalui         supaya
                                     Beberapa unsurperlu
         dalam menguruskan projek

B.   Unsur-Unsur

Limaunsur-unsur sering

i.   Bekerja'dengan' 'melalui'
                  dan       oranglain.


ii. Objektiforganisasi.

     la merupakan
                matlamat utamadanperludicapai
     dengancekapdanberkesan. Keberkesanansesebuah
             dapatdinilai     pencapaian
                        melalui         objektifnya.

iii. Keberkesananmelawankecekapan.

                            kepadapencapaian objektif
     manakalakecekapan          jumlah
                      mencerminkan    inputatausumber
     yangdigunakan melaksanakan
                 bagi           sesuatukerja,

iv. Sumber-sumber

                                 modal tanahadarah
                       Pengetahuan berkaitan      gunaan
           turunnaikkadarhargabahan, minyak,kos
     pengangkutan tempat
                 dari      berbeza ataujauhdaripembekal
                                  C 5011 PENGURUSAN

         Ini adalah       bagisetiapPengurusuntukmengagihkan
         sumber-sumber  terhad supaya
                              ini      dapat
         cekap pada tingkatyangpalingoptimum


         a. Bahan
         b. Buruh
         c. Logidanperalatan
         d. Kewangan
)        e. KosPengangkutan
         f. Kakitangan
         g. Maklumatprojek
         h. Pengalaman
         i. KosKeuntungan Pengurusan
                         dan       (profit overhead)

    v.   Suasanayang sentiasaberubah-ubah.

         Suasana yangdimaksudkan
               dan moral.
                                C 5011 PENGTJRUSAN

                       dengan dan           Suasana               ah
                                                   yang b erubah-ub
                       melalui orang

  Keseimbanganantara                   Melaksanakankerja
  keberkesanan                         denganmenggunakan
  kecekapan                            sumber-sumberyang

                      yang berubah-ubah

Unsur-unsur   dalamPengurusan.
                                 C 5011 PENGURUSAN


       'Pengurusan   pembinaan melambangkan
       kumpuIan aktiviti -aktivi ti Peng urusan yang
       melebihiperkhidmatanatau tugas-tugaslazim
       bagi Akitek dan Jurutera yang berkaitandengan
       sesuafuprogram pembinaan di mana aktiviti-
       aktiviti tersebutdijalankan padaperingkat
       pera cangan konsep, p ra-rekabentuk,rekab entuk
       dan juga semasa fasa pembinaanyang
       menyumbangkepadakawalan masa,kos
       (kewangan)   dan kualiti dalampemhinaan satu-
       satukemudahanyang baru'.

A.   TakrifPengurusan       yang popular
     Pengurusan            juga
                 Pembinaan dikatakan    mempunyai
     takrif.Antara               ialah:

1.   Menurut
           Charted Institute Building
                            of       (GIOB)
     Kingdom (1982: - 1992:3)
                  12          dan Greenwood 982/88):

     Pengurusan pembinaan
                        merupakan perancangan
                         dan                 projek
     daripada       permulaanhingga peringkat
     memenuhi         pelanggan memastikan
              keperluan         dan           projek
     tersebut       padamasayangditetapkan
            disiapkan                      dalam
     lingkungan dankualiti
              kos         kerja      yangdiharapkan
                               seperti             oleh

2.        (1984:5)
     Walker      :

     Perancangan,kawalan koordinasi
                          dan         sesuatuprojekdaripada
     konsepsehingga penyiapan  projek pembayaran
                                    dan           komisyen
                   lanyamenekankan   penentuanobjektif
     berkenaandengan utility,fungsi,mutu,masa sertadapat
                                       C 5011 PENGIIRUSANPEMBINAAN

             mewujudkan            sumber-sumber maklumat
                       hubungan               dan

             Beberapaaspekutama               projek
                                dalampengurusan     pembinaan
             adalah    bagimemenuhi        Klien
                                    kepuasan    denganprojek
             yangdihasilkan.Antara-       utama       ialah:

             a. Mengintegrasi.
             b. Menyelia.
             c. Mengawal semua     yangmenyumbang
                               pihak                 kepada projek.
             d. Output-output yangberkaitan
                            pihak             kepada projek.,
             e. Penilaian pemilihan
                        dan                         bagi
                                    alternatif-alternatif memenuhi
                impian kehendak
                     dan          Klien.
'' ')   3.   Sidwell(19771:

             Perancangan, pengarahan,koordinasian maklumbalas
             yangprlubagimelaksanakan      projek
                                     sesuatu    dengan mematuhi
                       dan         yangdikehendaki
             tarafkualiti kefungsian             dalamtempoh
             masadanstruktur yangdipersetujui.

        4.   Maevis(1977)z

                      pembinaan suatu
             Pengurusan       ialah    proses
                               danpembinaan memenuhi
             perancangan,rekabentuk        bagi
             keperluan seseorang
                     asas       pemilih.

 ' )    Secara                     di
                           dapatlah simpulkan
              keseluruhannya                  bahawa   pengurusan
        pembinaanmerupakan penyelarasan
                                      kumpulan         pengurusan
        yangmelebihiperkhidmatan tugas-tugas
                               atau          lazimbagiAkitekdan
        Jurutera                        dengan  dengan
        menggunakan kesemua sumber-sumberpengeluaran        satu
        prosessupaya        yangdipastikan
                     matlamat            boleh tercapai.

                                    C 5011 PENGURUSAN

B,                      Pembinaan.
     Giri-ciri Pengurusan

Daripada      dapat digambarkan       ciri-ciripenting
dalampengurusan projek      berikut:




                   Keluaran akhir

            Ciri-Ciri Pengurusan Pembinaan

                                 C 5011 PENGURUSAN

     1.2.2 Komponen UtamaDalamPengurusanPembinaan

          a. Kerjaberpasukan.

          Menguruskan            pembinaan
                      sesuatu                    melibatkan
          kerjaberpasukan. (3)komponen
                         Tiga            utama dalampasukan
          kerjaprojek                  :

          i. Pemilik
          ii. Perekabentuk
          iii. Kontraktor

          Koordinasi    merekabentuk pembinaan
                                    dan         sesuatu
          projekmemerlukanperancangan organisasi
          sekumpulan       yangberdedikasi
                     pekerja                 satuobjektif

          Kuncikejayaan             ialahpemilihan
                               projek            dan
          koordinasi                    kebolehan
                      masalah menyelesaikannya
          mengenalpasti                          dalam
                                      dalamjangka masayang
          di rancang.


                               C 5011 PENGURUSANPEMBINAAN

                      yang       dalam
         istilah-istilah digunakan
   Berbagai                           Pengurusan.

   1.          (forecasting).

        Andaian yangdibuat       kemungkinan
                          terhadap             yang
        berlakuagarsemua  perancangan
                                    dapat  diatur dengan
        strategi                          aktiviti-aktiviti
        pengeluaranuntukmenentukan piawaian
                                   satu           dan
        kaedah binaanyangsesuai.      itu
                                Selain maklumat
        bahan,kemudahan danlogiperlu
                        alatan             diambilkira.

   2.             (planning)

        Mewujudkan           untuk
                   tindakbalas     memberikanpanduan
        padasuatu projeksehinggaianyadisempurnakan.
        Bermula dengan skopkerjasehinggatamatsesuatu
              lanyamesti disediakan
                                  dalam bentukpelan
        kejelasanmatlamatdengan membentuk        dan
        mengembangkan   Perancangan menyusun
                                   untuk         aktiviti.

   3.          (organizing)

        Mengaturkan semua mengikut system
                                  satu       yangsesuai
        dengan       Suatuprojek
               projek.           mestidiaturkan
        kehendak kerjayangdilakukan.Semua perlu
        diagihkankepada unit-unit yangdapat
                               kecil         dilaksanakan
               kerjadansistem dengan menentukan tugas
        yangperlu dibuat,
        bagaimana suatutugasan akandikelompokkan serta
        siapayangmelaporkan  kepadasiapa?.

                          C 5011 PENGIIRUSANPEMBINAAN

4.          (motivating)

     Apabilasesuatukehendakbelum dipenuhimakaia
     merupakan permulaanprosesdorongan.Dorongan amat
     carayangdikehendakiuntukmemenuhi tujuan
              Padamasayangsamaia memenuhi
     organisasi.                             objektif
     sendiri objektif
           dan       professional.

     Dalam  pembinaan, dorongan merupakan  pengurusan
     semangat  juangpekerja pihak-pihak berkaitan
                           dan            yang
     denganpendekatan'melayan    merekadenganbaik,.
     Dorongan berbentuk
               ini         usaha terhadapkemanusiaan.
     Antara perkarayangperlu diberidorongan ialahsikap
     pekerja,pencapaian,penghargaan,ta ggungjawab,
     wang,pening                 persaingan hubungan
                 katan,penyertaan,         dan

5.   Arahan(directing)

     Panduan  yangdiberiuntukmelakukankerjaseperti
     dikehendaki supayaprojekdapat
     kakitangan yangbertug,as
     dibentuk sebagaisatupasukanberkesandan
     bekerjasama satuarahyangsamaiaitumencapai
     objektif           sesuatuprojek

6.              (coordi
     Penyelarasan     nating/commu

     Penyelarasan penting
                 ini      agarsemuapihak dapat
     mengetahuitanggungjawab had-had
                            dan        kuasanyaserta
     perhubungandengan pihak-pihak terbabit
                                yang        dalam
                            organisasi cartaalir

                            C 5011 PENGLIRUSAN

7.   Kawalan(controlling)

     Pengawalan merupakan set aturcara
                          satu           untuk
     membandingkan       pencapaian
                    antara          sebenarsesuatu
           dengan perancangan Dalam
                             asal.      konteks
     pengurusan pembinaan,tujuanutama pengawalan
     adalah untukmengawasi perlaksanaansebenar tapak
     binasupaya selaras menepati
                       dan         perancangandan
                     yangtelah dibentuk          pra

     Dalampengawalan semua
                    ini      aktiviti-aktiviti,
     perlaksanaan dipantau
               akan        supaya  dapatberjalan
     denganlancar tindakan
                dan        sertalangkah-langkah
     pembetulan diambil perlu.

                                        C 5011 PENGIIRUSANPEMBINAAN


  A.         ProsesPengurusan
             Jikaandaseorang pekerjabagisatuorganisasi,
             tentunyaharusmemahami  strukturorganisasinya
                                 peringkattempat andabekerja.
             Andajugaharus mengetahui tugas yangdijalankan
             parapengurus fungsi
                         dan       pengurusan, perancangan,
             pengelolaan pengawalan
                        dan            dalam usaha mencapai
             matlamat-matlamat organisasi. meliputi
             proses pengurusan.

  Sumber-Sumber             Pengurusan

                                                         dan objektif


  Rajah atasmenggambarkan
        di                prosespengurusan
  pakaiolehPengurus-Pengurus mana-mana
                          dalam          organisasi

  .    Perancangan
  .    Pengarahan
  .    Pengelolaan
  .    Pengawalan

                                                  C 5011 PENGIIRUSANPEMBINAAN

     B.     FungsiPengurusan

     Empatfungsipengurusan merupakan
                              ini       rangka
     bolehditerangkansepetirajah bawah.


                                .     Termasukkejelasan
                                o     Membentuk strategi
                                      dan mengembang
                                .     Perancanganuntuk

      Pengawalan                                                        Pengelolaan
.   Memastikan segalanya                   Pasukan               .   Mencipta strukfur kerja
    beq'alanlancar dengan                                            dan systemdengan
    memantau    aktiviti-                                  \         menentukansystem
    aktiviti, pelaksanaan                                            denganmenenfukan
    dan mengambil                           Pengurus                 tugas yang perlu dibuat,
    langkahpembetulan                                                siapayang buat,
    jika perlu.                                                      bagaimanatugasan
                                                                     hendak dikelompokkan
                                                                     serta siapayang


                            o       Menyemai semangat  melalui
                                    motivasi orang bawahan,
                                    mengarahyang lain-lain
                                    melalui salurankomunikasi
                                    yang berkesandan
                                    mententeramkan konfl ik.

                       Rangka Keria Tindakan Pengurusan

                                C 5011 PENGURUSAN

      ParaPengurus        arahan
                    memberi       kepadaorganisasinya,
      memimpin menentukan
                dan           bagaimana hendak  menggunakan
      sumber-sumber organisasi mencapai
                             bagi         matlamat.Pengurus
      mestilah            masalah
              menyelesaikan                   membentuk
      suasana salingmempercayai membantu
                               dan           mengimbangi
      situasi       Pengurusmestimembuat tindakanyang
      berkesan efisien
               dan      menggunakan  sumber-sumber organisasi
      seperti           kewangan,         mesin-mesin
                                  informasi          dan
      peralatan,bahan sebagainYa.

      Bagimencapai             pihakpengurusan
                         projek,             harus
      mengambil       tentang          penting
                             aspek-aspek     fingsi
      pengurusan segi:

      i.   Merancang

           Merupakan pertama penting
                   fasa    dan     dalam Pengurusan


           a.           yangmestidibuat.
           b.   Bila.
           c.   Siapa.
           d.           pembinaan dijalankan.
                Bagaimana         itu

           Langkahpertama untukmerancang  adalahdengan
           mengenalpasti                    projek.Semasa
           merancang,             pengumpulan dijalankan
                     aktiviti-aktiviti        data
           dankemudiannya maklumat   yangdiperolehi

           Perancangan adalah         sepanjang
                             berterusan        tempoh
           projek.Perancangan                merangkumi
           inputdaripada          yang
                        orang-orang terbabit dalamsatu-satu
           projeksupaya perancanganadalahberkesan.
           Perancangan akanmempunyai
                       tidak              sebarang jika
                           C 5011 PENGURUSAN

ii.    Mengawal

       penyenggaraan kelemahan
                    atau          yangwujudsupaya
       dapat            Semasa
            diperbetulkan.     mengawal projek,
       menetapkantahappencapaian meningkatkan
       penyenggaraan memperbaiki
                    dan            sebarangkelemahan
       supayaprojek             dalam
                   dapatdisiapkan     tempohmasayang
       diperuntukan      penggunaan sumbersecara

       Pengawalan projek
                       harus         dan
                            direkodkan dijalankanagar
       tidakberlaku          sumberorganisasi juga
       sebelum       masalah
               berlaku      yanglebihserius.

iii.   Melaksana

       Aktiviti merangkumi  rangka
       perbelanjaan.Semasa           Pengurus
                            melaksana,       projek
       memperkenalkan mengamalkan               dalam
       perlaksanaandengan  caramembuat keputusan
       pengurusan. Pengurus akanmengeluarkanarahan-
       arahan        serta
              tertentu    memimpin,mengelola member

       Selain                kakitangannya,
                    mengarahkan         seorang
       Pengurus menguruskan penggunaansumberseperti
       peralatan,      dan
                kewangan sebagainya.

iv.    Mengarah

       Arahan beriolehPengurus untukmelakukankerja
             dikehendakisupayaprojek    dilaksanakan
       se€ra berkesansebagaisatuberpasukan.
       antara    pengurusan pekerja
                            dan       bawahan mestilah

                           C 5011 PENGURUSAN

C. TakrifProjek

    Safu siri tugas atau kerja yang utama yang
    dilaksanakansekali(one-shot)   dengan matlamat yang
    jelas dan perlu disiapkan dalamperuntukan masa
    yang terhadyang memerlukankomitmen kemahiran
    dan sumberyang berbagai.

1. Menurut Punmia danKhandelwal 19Bg:
                  P.C        K.K;   Projek
   boleh          sebagai:

    Siri rangkaianaktiviti yang mempunyaitujuan
    tertentu,titik permulaandan titik tamatyang jelas
    bagi mencapai satu set objektif secara berkesan
    denganmenggunakansumber-sumberterhad yang

2. Menurut    Kerzner:
         Haroid     Projek

    Sesuafuyang mempunyaititik mula dan tamat yang
    jelas,mempunyaiobjektif tertentu untuk di capai,
    mempunyai satu siri aktiviti kerja dan melibatkan
    penggunaansumber-sumberinput sepertitenaga,
    modal,bahandan peralatan.

D. TakrifPembinaan

    Membina sesuatupembinaan pihak
                             oleh    Jurubina
              di                    awalpembinaan

                         C 5011 PENGIIRUSAN

E.            Pembinaan

     Pengurusan Pembinaanmerupakan   penyelarasan
     kumpulan                yang
                    pengurusan melebihi
     perkhidmatan tugastugas
                 atau           lazimbagiAkitek,
     JurukurBahan Jurutera
                  ,       sertaPerunding-perunding
     lainyangberkaitanmenguruskan sesuatuprojek
     pembinaan peringkat pembinaan
              dari        awal           hingga siap
     menggunakan sumber-sumber pengeluaran melalui
     satuprosessupaya matlamattercapai.

     Amalanpengurusan adalahkompleks  kerana
     diuruskan manusia.Segala perlaksanaan
             oleh               kerja
     sesuatu     kerjapembinaan
           aktiviti             menggunakan  teknik-
     teknik kemahiran
          dan                 hasilgabungan
                       tertentu             antara
     perancangan,                pengarahandan
     pengawalan pembinaan
               kerja          dalam sesuatuprojek.

     Pengurusan         dikendalikan pihak
                Pembinaan         oleh      yang

F.            Projek.

     Mengurus projekadalahpencapaianutama yangpaling
     ungguldalam industri               projek
                       binaan.Pengurusan telah
     menjadicarayangamatberkesan  untukmenyatukan
                organisasi memotivasi
     fungsi-fungsi        dan          mana-mana
     kumpulan untukmencapai tahapprestasi

     Pengurusan projek memerlukan  penggunaanilmu
     pengetahuan, kemahiran, danperalatan teknik
                              logi         dan
     ke atasaktiviti-aktiviti   agarmencapai
     perlaksanaan projek.

                    C 5011 PENGURUSANPEMBINAAN

Pengurusan projekmerupakan suatusuasanayang
melibatkanpengurusansumber-sumber terhadsecara
cekapbagimencapai        secara
                  objektif             bermula
dariperingkat        sehingga penyerahanprojek
pembinaan kepada Pelanggan.


1. Pengetahuan

  Lebih            pemahaman berkaitan
       tertumpu            asas

  a. Rekabentuk.
  b. Sistemkejuruteraan.
  c. Pembinaan.
  d. Ekonomibinaan.
  e. Prosedurkontrak.
  f. Perundangan.
  g. Perancangan prinsip
                serta    pengurusan.

2. Pengetahuan

   a. Pengetahuan
   b. Perhubungan
   c. Pengurusan
   d. Sikap.

                                   C 5011 PENGURUSAN


Akaun dan


Bidang Ilmu pengetahuanyang perlu dalam Pengurusanprojek

                                            C 5011 PENGURUSAN


Berdasarkan                 dan
           takrifan-takrifan konsep-konsep     pengurusan
                 bahawa          perancangan,
                          aktiviti            pelaksanaan
danpengawalan memenuhi
               bagi            kehendak  klienperlu
mengambil masa, dankualiti
         kira       kos             yangtelahditentukan
menjadisuatu       pengurusan
             kitaran            projek.Berikut      hasil
darirumusan perbincangan Austendan Neale(1984)
            dan               oleh
yangmerumuskan         perancangan,
                 aktiviti             pelaksanaan dan
pengawalan adalah seperti        di
                          kitaran bawah.

                      .     Menentukan objektif.
                      .     Pengtajiansumber-sumber.
                      .     Membentuk strategi.

        Mengawal                                             Melaksanakan
r   Menilai pencapaiandan                              .   Mengagihkansumber-
    matlamat.                                              sumber.
r   Melapor.                                           r   Membimbingpelaksanaan.
.   Menyelesaikanmasalah                               .   Menyelaraskanusaha.

                      Kitaran Pengurusan ek

                           C 5011 PENGURUSAN

G.   Perhubungan               Pembinaan
     dengan PengurusanProjek

     Pengurusan  Projekadalah saling berkaitantara satu
     samalain. Jikatiadapembinaan  maka  tiadakerja
     membina  yangakandi uruskan sudah
                                  dan        tentutiada
     projekdikendalikan. adakerjapembinaan,
                        Jika                     maka
     perlukepada            mengurus
                  kerja-kerja         pembinaan yangakan
     dilaksanakan supaya siapmengikut  perancangan  yang

     Pembinaan           projek
              dalamsesuatu     perlu        oleh
     seorangpengurus pihak
                   bagi     Jurubina pengurusan
     projek    perlusupaya
          adalah          perlaksanaankepada
               dapat capai
                    di     denganbaikdengan
     pengarahan kawalan
              dan       olehseorang pengurusyang

     Pengurusan projekpadaasasnya  ialahmerancang,
     mengarah, mengendali mengawal
                          dan           mengenai sesuatu
          bermula peringkat
     projek        dari                dan
                               taklimat ideadariKlien
     kepada Akitekhinggalahsiap.Jikaprojekyangsederhana
     atauyangkecilatauprojek yangmenggunakan   kotrak
     dari                         pengurus
                        penglibatan         projekhanya
     dariperingkatpembinaan hinggaprojek siap.Bagi
     kontrakjenisselain jenistradisional tender
                      dari               atau
     secaraRunding  Terus,

     Pengurus Projekbolehmemainkanperanannya dari
             awalcadangan  membinaprojek

                      C 5011 PENGIIRUSANPEMBINAAN

PengurusProjekakanterlibat                jenis
tender jugakontrak
     dan             yangdigunakan.
Peringkat                dalam      projek
adalah      berikut:

1. Insepsi

  Padaperingkat          pelanggan /Klienakan
  menyatakanimpiannyakepada AkitekKlienakan
  membertaklimat maklumat
                dan         tentang kehendak-
  kehendaknyakepada       Pihak
                    Akitek.    Akitek pula
  merealisasikan             dan
                     maklumat impian    Klien

  Bagiprojek yangbesar atauTender        Terus
  ataukontrak  secaraRekadanBina,         B.O.T,
  dll.; PengurusProjekakan       dalam
                          terlibat     memberi
  pandangan  , nasihat jugacadangan
                     dan              yangsesuai
  mengenai            yang
            pembinaan akan
  dilaksanakan.Pengurus perlumenyiasat
                        Projek              atau
  mengenalpasti  konsepprojekpembinaan secarakasar
  seperti yangdikehendakiolehpelanggan.

2, KajianKemungkinan

   Merupakan peringkatuntuk memikirkan langkah awal
   yangperludibuatbagimemastikan          projek
   yangdicadangkan dapat dilaksanakan dengan jayanya
   bagimencapaiobjektifpembinaan   yangdicadangkan.
   JikaPengurusProjek        padaperingkat , beliau
                      terlibat             ini
               samada   projek tersebutdapat
   dilaksanakan sebaliknya
              atau            dengan
   mempertimbangkan aspek
                     setiap             kewangan
   dan buget,        ekonomi, turunkadar
                               naik          harga
   di pasaran       dan
            semasa lain-lain.

                      C 5011 PENGIIRUSAN

3. Peringkat

  mengendali melaksanakan
            dan                     lukisan,
  kelulusan    dariPihak       Tempatan
                        Berkuasa        yang
  berkenaan sebagainYa.

4. Peringkat

  Jikasesuatu    menggunakan Tenderjenis
  Rundingan,                   secara
                   Projek            langsung

5. PeringkatKontrak

  Bagiprojek  yangmengggunakan khidmatPengurus
  Projek, makaseorang PengurusProjekpadaperingkat
  ini perlumemastikan              yang
                     wujudperjanjian sempurna
  antara                          prosedur.
         Kliendan Kontr:aktor
  Dokumen                  di
                   mestilah sediakan
             Kontrak                dengan
  lengkap  lengkapuntukditandatangani.

6. Peringkat

   Bagiprojek yangmengggunakan   khidmatPengurus
   Projek,maka seorang Pengurus      padaperingkat
   ini perlumemastikan          pembinaan
                      kerja-kerja          projek
   ditapak binadilaksanakanmengikutseperti yang
   dinyatakan dalamdokumen  kontrak.Pengurus Projek
   perlu merancang, mengelola,mengarah dan
   mengawalmasa,    kualiti kosbagikerja-kerja
   pembinaan  menggunakan  sumber-sumber terhad
   supaya         perlaksanaan
           objektif           projek

                        C 5011 PENGTIRUSAN

   Apa-apaperubahan pertikaian
                     dan         semasa  pembinaan
          mengikut  seperti
                          yangterdapat dalam
   borangkontraksetara sepertiyungdigunakan daram
   Dokumen Kontrak yangtelahoipersetJjuiantaraKlien
   dan Kontraktor.
   Pengurusprojekmesti menggunakan segala
            keupa  yaan,pengetanu"nr"iu
   pengalamansecara  cekapdanberkesan.
   kerjapembinaan pihak
                oleh     Kontraktor.
 7. Penyerahan

   sebelum projek
                diserah    pengurus
                      mirik,        projekperru
   memastikanprojekyangdikendalilian beliau
   memenuhi segarakeperruan terah
                          yang     ditetapkan
   olehPihakberkuasasebelum Layak
                           sijil    Menduduki

8. Penggunaan penyenggaraan

   setelahprojekpembinaanborehdiduduki oreh
   pengguna Klienakanperlusentiasamembuat
                 di          pengurus projek  perlu
  memastikan Klien  mematuhi
  jugahal-haryangberkaitandengan pirratBerkuasa


Kerja'kerjapembinaanperru merarui
di atas.Bagimelaksanakan
memerlukan  kepada
                 seorang pengurus projek
mengikut kesesuaian

      pembangunan  memerlukansebidangtanah.
      pembangunan melibatkan

                            c s011PENGURUSAN

pelbagaibinaanbangunan kerjaKejuruteraSn
                         dan                 Awam
(lnfrastruktur). itu Pengurusan
             Oleh                 Pembinaan dan
Pengurusan  Projekperlu  seiringdansalingberkaitan
Perhubungan  Pengurusan   Pembinaan   dan
Pengurusan  Projekperluseiring.
Pengurusan Projekamatpenting   dalam sektor
pembinaan. lanyaboleh lihat
                      di     dalam (3)sudutiaitu:

i. Masa
ii. Kualiti
iv. Kos




     Perkaitan antara Kos, Kualiti dan Masa

                                   C 5011 PENGURUSAN

1.4.1 Perbezaan              pembinaan
     dan Pengurusan

     Peringkatpembinaanadalah berkaitterus dengan
     pengurusanprojek di manaPengurus   projekakan
     terlibat              awalperancangan projekatau
     pembinaan  hinggalahprojekataupembinaan siap
     sepenuhnya  mengikutjenistawaran danjuga kontrak
     yang digunakan bagisesuatu projekyang

    P e m b i n a a n o le hm e lib a tkasa tuje n isp e m b in a a n
                       b                     n
    ataulebihdi tapakbina.sementara                   projekpuraterdiri
    d a r il e b i hd a r isa tuje n isp e m b in a a n a la msa tuta p a k


    s a t u t a p a kb i n ab a g ica d a n g a n e m b in a 0 lo t r u m a h
                                                m           1
    teressetingkat TamanSelesa.

    Bagimelengkapkan lot rumahteressetingkat
                                    10                               perlu
    a d a 1 0 l o t r u ma hja la nm a su k, la nd i ka wa sa n
                                ,               ja
    p e r u m a h a n , gsa m p a h p e r h e n tia b a s,la n ska p ,
                        t on               ,            n
    l a m p uj a l a n , p e r kh id m a ta n       ,
                                          ta liko mp a ipb o m b a ,
    l o n g k a n gd a n la in - la in . r ka r a i a d a la h
                                      Pe         in
    projek.Pembinaan membina     ialah             satu-satu   jenis
    pembinaan          bagimenyiapkan         projek.

                                        C 5011 PENGURUSAN

                    Perbezaan    Konseppengurusan
       Pengurusan         Pembinaan Pengurusan    Pro
       Kontraktor     akan            Pengurus Projek pihak
       meng ruskankerja-kerja Klien
             u                             akanmerancang,
       p e m b i n a a n u p aya
                       s              mengelola,mengarah  dan
       mengikut     masakualiti  dan mengawal  perjalanan kerja-
       kos yang ditetapkan            kerjapembinaan oleh
                                      supayasemua  kerjabagi
                                      dilakukan pihak
                                      kontraktor tapakbina
       Kontraktor    akan             PengurusProjekakan
      memastikan         keseluruhan        memastikan      Kontraktor
      p e m b i n a a n a l a mse su a tu
                        d                   melakukan     kerjapembinaan
      projekditapakbina                     sesuatu   projekdi tapakbina
      d i l a k u k a n e n g i ku t
                      m                     d ila ku ka n e n g iku t
      peringkat      pembinaan       dan    peringkat   pembinaan      dan
      kaedahseperti dalam   di              kaedahseperti dalamdi
      dokumen        kontrak    yang        dalamdokumenkontrak
      ditandatangani Klien  oleh            ya n gd ita n d a ta n g ao le h
      dan Kontraktor.                       Kliendan Kontraktor.
      Kontraktorperlu                       PengurusProjekyang
      memastikan penggunaan                 menguruskan projekperlu
      sumber-sumber terhad                  memantau penggunaan
      diuruskansecara cekap                 sumber-sumber terhadoleh
      supayatidakmengalami                  Kontraktor
      kerugian.                             melaksanakankerja
                                                       dengan baik
                                            Kontraktor kerugian
                                            danmengelakkan projek
                                            Klie nte r b e n q ka la i.

Jadual perbezaan
                              pembinaandan pengurusanprojek.

                                      C 5011 PENGURUSAN

B i I PengurusanPembinaan PengurusanProjek
4 . Kumpulanaktiviti-aktiviti Pengurusan                   projekoleh
      P e n g u r u s a m e n g u r u ska n seorang   Pengurus    boleh
      kerjapembinaan           sesuatu menjadicarayang amat
      projekperlubekerjasama berkesan                  untukmenyatukan
      antarasatusama lainbagi fungsi-fungsi                 organisasi  dan
      memastikan       kerja-kerja          memotivasi    mana-mana
      p e m b i n a a n i u r u ska n
                      d                     ku m p u la n n tu km e n ca p a i
      dengancekapterutama                   tahapprestasi    yangtinggi
      o l e kk u m p u l a ne kn ikad a n dan produktiviti
                           t          l                        terutamanya
      pekerja    dipihakKontraktor terhadap            pihakKontraktor
      bagimenyiapkan           projek       bagi menyiapkan      projek
      Klien..                               Klie n .

5.    PihakKontraktor         perlu      Pengurus     projekperlu
      berpengetah tentang
                        uan              mengetahui      tentang
      perkara-perkara        teknikal,   perkara-perkara kal, tekni
      k o m u n i k a s ia n
                      d                  ko m u n ika sia n
      perhubungan        awamantara      perhubungan      awamsupaya
      pihakKontraktor pihak  dan         bolehmemantau         kerja
      KliensertaPihakBerkuasa            Kontraktor    supayamematuhi
      Tempatan(PBT).                                                ak
                                         ke h e n d a k- ke h e n dPih a k
                                         Berkuasa     Tempatan     supaya
                                         projekpembinaan         Kliensiap
                                         d e n g a n m p u r n a a n b le h
                                                    se           d
                                         mendapatkan Layak Sijil
                                         Duduk(CF)dari atau PBT
                                         Sijilp e m a tu h a d a n
                                         Penyiapan     (CCC)dariAkitek
                                         ya n gd ila n tik.
6.    PihakKontraktor          Kemaskini Pengurus
      m a k l u m ap e m b in a a n a n perjalanan
                                  d              jadual
      perjalanan     jadualdan kerja sebenar   pihakKontraktor.
      sebenar     secarabulanan
      a t a um i n g g u a n .

                                  penrbinaan pengumsan
                                           dan       projek

                                                               C 5OII PINGTJI<(JSAN

                            1.4 .2 Perbezaan
                                           StrukturOrganisasi                                 '' '')'
                                                                                 ,,-,              /    (       r

                                   A.     Orga nisasi                        (     \,r
                                                                                       6 J-   \(

         c ' r t r,|
        *)             n r l l q - .1                                                                       r       " t.':,- .'
".,g --
                       3"alf              Organisasi
                                                   adalahsuatukumpulan       yang
                                          dihubungkandenganeratdalamsesuatu hubungan

                                   B. StrukturOrganisasi

                                          strukturorganisasiadalahbagi memenuhiputaranera
                                          pengurusan sendiriterutamanya
                                                     itu                   apabilamasalah
                                          baru dihadapiatau akan dihadapi,lanyaberkairapat
                                          denganketepatanmembuatkeputusan     datamsesuatu

                                        . Sesuatuorganisasi dipengaruhi
                                                                      oleh peringkat_
                                          peringkatyang akan digunakansepertijangkauan
                                          kawalan.organisasi juga akanmemberikesankepada
                                          kitaranhayatdan juga kejayaanorganisasi.

                                         1. KepentirlganStruktur Organisasi

                                            a. Mengeluarkan  ataumenghasilkan
                                               keorganisasian juga untukmencapai
                                               matlamat               juga
                                                        organisasi.lanya dapatmencapai

                                            b. Menimimumkan sekurang-kurangnya
                                               mengaturpengaruh'individu pelbagai
                            C 5f)I I I,I]NCiTJI{USNN

         c. Struktur
                   merupakan kuasa
                             satu      yang
            dilaksanakan keputusan
                        dan          dibuat
            mempercepatkan sesuatutindakanuntuk
            mencapai pencapaiansesuatumailamat

C.    KonsepPengurusan Struktur

      Dua konsepasasperludipatuhi

      i. suatu kepercayaan
                         atau penerimaan
      ii. Penurunankuasa

                    yang baik amatpentingdaram
     men$uruskan      projekbinaan.pengurusan

        Meramaldan merancang

     Pengurusan    melibatkan prosesbukansahajateknikal
     tetapijuga sosial.lanyatidak bolehdijelask-anatau            ('
     difahami,  apatahlagiuntukdipraktikkan  kecuali
     erti kata dimensiperlaksanaan juga tuntutan
     perlaksanaan atasnya.pengurusan
                     ke                    juga
     memerlukan'keputusan'     dibuatdan seierusnyu
     keputusan perludijalankan
                 itu               ataudilaksanakan  oleh
     oranglain.lanyamelibatkan    sumberterhad.Melalui
     keputusan,   penghasilanyang maksimum    pada
     penggunaan    sumber  yang minimum  akan
     dicapai-Maka    prosespengurusan mempunyai  ciri-ciri

                                        C 501I t'trNai{JI{tJSAN

              Struktur           juga
                       organisas.i m.emainkan      peranan  penting
              dafam  projek pembinaan manastruktur
                                        di              pengurusan
              dancarapasukan    dibentuk   akanmemberi   imprikasi
              kepada   seluruhputaran  sesuatu projek.strukiur
              organisasi ditakrifkansebagai  satuiorak perhubungan
              yangtelahditentukan antara
                                    di        komponen-komponen
              organisasi yangmenggariskan     komunikasi,
              pengawafan autoriti.
                           dan          Strukturorganisasijuga
              membezakan    antara perbagai  bahagian orgunirusidan
              menggariskan   perhubungan   antaramerek lujuga
              merupakan pengagihan
                          satu              tenagadan mekanisrne
             penyelarasan   mengikut  hiraki.Struktur
             dapatdigambarkan    merarui cartaorglnisasi.
             sesuatu   struktur
                              yangboreh    menyumb"rig  kepada
             kej.ay orga isasimestilah
                   aan      n                   pu
                                            mem nyai bebe   rapa
                    serta sifat-sifat
                                    yangdapatmemberi     kesan

             i.     Kejayaan
             ii.    Komunikasi-komunikasi pelbagai.
                             seperti daram
                                  di     jaduar bawah.
 Ciri              sifat             Kesanatas       Kesanatas
                                     kejayaan        komunikasi
    otruKrur asas      Bolehlentur.
                                        Menyokong . Tiadasaluran
                   o  Bolehsuai.        perubahan.      komunikasi
                                                     . Tiadaingatan
2. Pembahagian Kuasa                 . Memberi     I . Memerlukan
   buruh              terpancar.       ruang           orangtengah
                                       kebebasan.      untuk
3. Autoriti                                            tugasan.
                  . Mendatar        . Pakar-pakar . Menggalakkan
                     berasaskan        mengetuai       komunikasi
                     funqsi.           tuoasan         tidakformal.

                                                      C 5()II PI,NGURLJSN PI'Mi]JNANN

                   D. Takrif Struktur Organisasi
I n 9 't, 'a ' n

     ttyV 'fn '
                       a. Child (1977:10)
    :.. ?.Y '1a           organisasi
                                   kepada komponen
                                          3         utamaiaitu.
                       i. Menandakanperhubunganpelaporanformal
                                 bilangan-bilangan dalam
                                                tingkat    Hiraki ydu I
                                                                ,   dc
                          danjangkau      bagipengurus-pengurus
                                    kawalan                    dan

                      lt.     Mengaitkan kelompok-kelompokindividukepada
                              jabatan-jabatan kelompok-kelompok
                                            dan                  jabatan
                              kepada organisasi
                      ilt.   Pencorakan  sistembagimemastikan  komunikasi,
                             penyelarasan pengintergrasian
                                          dan               usahayang
                             efektifkeselu hanjabatan-jabatan.

                     b. Nich ola s(1990: bab dan juga G us wor t h
                             dan Franks91993:bab maka takrif
                             struktur organisasiadalahseperti

                             corak perhubunganyang telah ditentukandi antara
                             komponen -komponen organrbasi ng
                             menggariskankomunikasi,pengawalandan autoriti.
                             struktur organisasi
                                               membezakandi antarapetbagai
                             bahagian organisasidan menggariskan                          f
                             perhubu n antara mereka.

                      c . M i n t z b e r g (1 9 7 9 ) p u lam e n g e n ap a sti:

                            struktur asas organisasi
                                                   sebagaipengagihan buruh
                            (supayasefr'ap ahli membuatsumbaigin yarg
                            berbeza-bezaterhadap kerja)dan mekanisme
                            penyelarasan  (supaya kesemuausahadapat

                     C 5 O II I ' I J N(; URI J S A N I ' MI ] I NA A N

 d. Bfau(1gTg:12)mentakrifkan
  mempengaruhi perhubunganperananantaramereka

e- Half(1982:53-54) menyatakan takrifBrauitu
   memerlukan  peluasan atasduaperkara, iaitu
   pengagihan (yakniorangyangdiberitugasan   atau
   kerjayang berbeza datamorganisasi),
                     di                 dan
  organisasi sendiri
            itu       yangmempunyai atau
  hierarkinya(iaitukedudulianyangorangitu pegang
  mempunyai   kaedah dan peraturan
  dalampelbagai  tahap;carakewajipan f,enu
  dilaksanakan dafam kedudukan tersebut).

f. Meltsner dan Beilavita (1g83:142):
 sesuatu struktur
                         mengandungi  organisasi
 samaseperti struktur
                    rumah  bagisebuahrumah.
        iarahsesuatu yangr"fltukkun org.nisasi
 dalamsuatu suasana tugai.
 Struktur        yangmengikat organisasi
 bersama-sama datamusaha
                       hereka me"ncapai
 matlamatdengan menetapkan

untukmencapai maflamatnyamelalui
sumber yangsedikit.struktur memperjeraskan
                di       bihagian_U"h"gi"n
sesuatuorganisasi. menghuiaik;h
                la             kaedahiyang
menentukan bahagian-bahagian
           cara                itu berkait
berinteraksi                             dan
          (Meltsner Belluuitu
                   dan         1983:Si).

                                                                   C 5 0 1 | P I NG (J f iU. S A N, I : MI ] I NA A N

!i {       f t rr,rlf     cloo,tt\ /,4t,      g. Draft 1989): Struktur
                                                                              cligambarkan cJi
       r, rt iit        ada     cot\q            dalam cartaorganisasi.
                                                                     cartaorganisasi suatu
                   r,oohi(dft                    carlayangmempamerkan   semua aktiviti
                                                                              set       dan
                                                 prosesdalam sesuatuorganisasi
                                                                             (Draftl g8g).

                                           E. Tujuanmewujudkan

                                                     organisasi  adalahuntukmemenuhiputaran
                                              era pengurusan sendiri,
                                                             itu       terutam
                                              masalah  barudihadapi akandihadapi
                                                                    atau           (Galbraith

                                                              dibentuk memperlengkapkan
                                                                      bagi                                                  {"
                                              diriorganisasi sendiri.

                                              Menurut  Paulson,Fondahldan parker (1992),
                                              ketepatan membuat   keputusan dalamsituasi
                                                                organisasi pincang
                                                                          itu        dan tidak
                                              teratursertatidakmenepati kehendak  projek,maka
                                              keputusan yangtepat berkaitan projekmungkintidak

                                              Jelasdi sini,sesuatustruktur        yang digubal
                                              dapat digunakan untukmencapai tujuantertentu.
                                                               dapatdigambarkan  dengantiga (3)                         (
                                              sifat(Meltsnerdan Bellavita1983:142):

                                              a. Sifat-sifat

                                                 i. Bentuknya
                                                    Bentuknya tetap
                                                            tidak    danmengikut

                           (: 5OII I'IJN(JTJIt(

          ii. Perluadasifatkebolehlenturan.
                                        dan boleh
             menerima apa_apa perubahandan perkara_

          iii. perfuadasifatkebolehsuaian.
             perru adasifatkeborehsuaian bofeh
             menyesu  aikandengankeadaan,
             kehendak,tugasan lain_lain.

F.    Prinsip-prinsipyang perlu dipatuhi. z) \tc

      Berdasarkan (3)sifatdi atas,semasa
                tiga                      merancang
      dan menubuhkan struktur
                            organisasi, (3)prinsii
      yangmenjadikonsepasas pertu dipatu-hi
     a' suatu kepercayaan penerimaan
                        atau       kepimpinan.
       Suatuaspek perancangan unsur
                                  pengurusan dan
                     tentangpenentuan spesifikasi
       segaratanggungjawa tertentu genai'pergeraka
                         b       men
       dantugas samping                          n
               di         segala
                               hubunjun yung

     b, Penurunan

      satu rangka
                kerjauntukmenjatankan  tanggungjawab
      pengurusanuntukmemberikuasa  tanggungjawab
      berkenaan penyerarasan
               bagi            aktiviti oorongan
                                diarahkan  untuk
      mempertingkatkan kerja
                      mutu    daram  semuabidang

 c. Struktur tidak beku atau kekal.

                                                      ,+ l
                                  C 5 0 1 I ' llNG t J I rliS iA N, I , Mt J I NA A N
                                         I                       I

      lanyamestilah dibentuk
                           untukmenerima  segala
      perubahan apabiladiperlukan.Tujuan
      penubuhan  struktur
      organisasiberkembang manaagenatauwakildi
                            bersedia untukmemberi
      tindakbalaskepadaapa-apa keperluanprojek.

                              yangpenuh bermakna
      perlumenunjukkan      jelasgaris-garis
                       dengan             kuasa
                yangbergerak ataske bawah.

G. Pemilihan

   Pemilihan struktur
                    organisasiyang relevan
   penting supayaianyaadalahberbentuk  serbaboleh,
   iaituprojekbolehdibinadi sekitar
                                  tugasan; juga
   apabilatugasanitu berubah.Oleh bentuk
   keorganisasian,padasatuhujungterdapat organisasi

   Pengurus projekdiberiautoriti
   menjalankan projeknyaseolah-olah satusvarikat
   satu produk.

   i. Saizdanjangkamasaprojek.                                                          (
         yangbesarsaizsertaperbelanjaannya dan
    panjang        perlukepada
           hayatnya,           suatustrukiur
            yangberautoriti luas.

  i i . S u m b e rD a l am a n , p a ka r a n a n p e n g a la m a n
                                 Ke             d
       d a l a ms e s e b ua ho r g a n isa sin ya .

                         C 501 PIlN(;t_JIttJSAN
                              I               I,tiMfltNAAN

    Bergantungpada masayang ada untukmenyusun
   projekdanjuga peruntukan iewangan yang
   mencukupi.Jika organisasi tida[ aoi pengaraman
   atau belumcukup pengafaman   dan masaamat
   terhad,maka strukturmatrikstidakdigarakkan.

 iii. Wujud perbezaan.

   perniagaan  ata-u
   firma atausyarikattertentu.
                             Jika masaian kos
   adalahpentingmaka autoritipengurus  projek
   mestilah kukuh.


  Jika tahappengguhaan teknologi

  Jika teknorogiyarg digunakan
                             cepatberubah  dan
  wujud banyakketidakpastian,maka strukturmatriks
  atau struktur
  tni semuabergantung
                    padapengataman    organisasi
  tersebut                 jutoriti yang

v. Tahap ketidakpastian

  Hal ini merupakanrisikokepadakrieniaitusejauh
  mana kliendapat mengawai  projek.

 ,!ka projekmenggunakan kontrak kos tambah
 (cost plus)akan.
                mewujudkan ketidat<pastian
 kewangan  yang banyari
                            perubahan teknorogi

                          C 50II I'IJNCJIJI{IJS;AN

       dan undang-undang peraturan
                      atau        yangpesat

       organisasi yangkurangpengaraman  mengendarikan
       autoriti                lebihbaikmenggunakan
       struktur organisasi
       menggunakan   struktur

     vi. Bebankerja

        strukturyangmempunyai  autoritiyangkuatperlu
       kepada  penumpuan  masaotehpengurus   projek
       jugakakitangan projek.Masatah munqkin ikan
       timbul projek   bagisesuatuotguniiusi berjatan
       serentak, makaperkara autoriti
       disalurkan secaraberterusan penumpuan
                                 dan             oreh
       pengurus  projek
                      ataukakitangan  projekakan
       berkurangan sesetengah
                    bagi          projek.
    vii. Kawafan danjadual kerja

                 projekmementingkan danjadual

    viii. Komitmen

       Kedudukanpengurus projek akanmenentukan
                          sesuatu firma.

       a. Kepada siapapengurus
       b. Sejauhmanapengurus projek
H. Jenis-jenis Struktur Organisasi

                                   C 501i ptiNctJItUSAN I,IIMIIINAAN

      Terdapat beberapafaktor
                            yangperrudiambirki daram
      menentukan  pemirihan

       i.   Saizdanjangkamasa  projek.
       ii.  Sumber dalaman,kepakaran pengalaman
                                     dan --
       iii. dalamsesebuah organisasinya. '
       iv.  Wujudperbezaan segi ai<tiviti
                           dbri          atau
      v.    perkhidmatan fasa.
      ui. Pengaruh  teknologiyangdigunakan.
      uii: Tahapketidakpastiankewangan.
      viii. Bebankerja.
      ix.   Kawalan danjadualkerja.
      x.    Keadaanorganisasipemilikatau
     Terdapat perbagaijenis
     Hampir kesemua organisasi
            mereka mefarui
                         penggunaan cartaorganisasi.
     Terdapat beberapajeniscartaataustrukturorganisasi.
  Antara         strukturorganisasi
 i.    Struktur
ii. Struktur
iii. Struktur
iv. Struktur

V.     Strukturorganisasimatriks.

v t. s t r u k t u r o r g an isa si cu ka n /g a b u n g a n
                                   ka                      se m u a d i

                                                        C 50I I PTJNGUI{IJSAN

                                vii- struktur organisasiBerbentukRangkaiankerja
                                viii. Struktur Berasaskankawasan.

                         t.   StrukturOrganisasi
    ^'(c rhnn
                      4\Can   fa berdasarkan  amalanpihaktentera.lanyamenunjukkan
                              aliransecaramenegakdari atas ke bawah.Jalinankuasa
                              adalahdaripada   atas ke bawah.Arahanadatah jelas (line
                              of authority).
                                           Alirankomunikasi, kuasa,pelaburan,
                              tanggungjawab   serta rantaianarahandalahsecara
                              menegakdari atas ke bawah.
                              Buruhdikelaskan  mengikut
                                                      kepakarandan denganitu
                              arahanam sudahmemadai    namunbegitupenyLlia
                              perlulahdari kalangan
                                                  yang berpengalaman.
                              bagaimanapun   Penyelia
                              berpengafaman ini sukaruntukdicari.

                              Di Malaysiakebanyakan jabatankerajaan danjabatan
                              berkanunmengamalkan  sistemini.Jika ada yangsakit,
                              maka perlulahada orangyangmenggantikannya.



                                   C 5()1 I'IJN(;IJ'{IJSAN
                                         I               I,tlMI]INAAN


Timbakan       Timbakan     Timbakan
Pengurus                                                Timbakan
               Pengurus     Pengurus
  Besar                                                 Pengurus
                 Besar        Besar


            C.ontohcarta organisasi

 Daripadacontohcartadi atasdan juga
 menegak,beberapa perkara yang ieruuanpertudi rihat:
 1.   Perhubungan elaburan.

      Perhubunganpetaburan sebutjuga
                              di             sebagairantaian
      arahan-Menurut  Daft (1989:213), ;;;;n    arahanautoriti
      yangmenghubungkan    semuapihakdi daramorganisasi
             tidak notehputus-ra jrg3 ;u;g;,"barkan siapa
      yang mefaporkansesuatu                 -
2.    Pengetompokan   bahagian_bthtgia;.

      Setiapkerompok diwujudkan
      (tugas                           fungsikerompok
            dan kerjakefompok).

                                  C 501 I'tiNctjftt/SiAN
                                       I                ptlMlilNnn N

        dan Greenwood  (1980),
                             kaedah pengefompokan acJalah
        berkesankerana pekerja
                             dafam setiapkelompok
        mempunyai ketua.
                  satu      setiapkelompok sama-sama
        bertanggungjawab atasprestasi
                        ke            kerjadan mereka
        salingmembantu.Masalah dihadapi
                               yang        ialah
        penyelarasan antara
                   di      satukelompok dengankelompok
i3,.r Rantaianmaklumatmenegak.

        MenurutDaft (1g8g)iuga,struktur organisasi   menegak
        sepatutnya memudahkankomunikasidi antarapekerja
        danjuga bahagian-bahagian perlubagimem"nrhi
        tugasanorganisasisecaraam. Rantaianmlklumat pula

        digunakan untukmenyeraras   aktiviti dari atas ke bawah.
        Pekerjadiperingkatbawahperlumelaksanakan       aktiviti
        yang konsistendan ianyajuga akan menjadirantaian
       arahan. Prosidur dan juga peraturan oiwujudkan   yang
       mernberi garis panduanwajib bagi metaksanakan      dln
       juga menyelesaikan  tugas-tugas.

       segala pelandanjuga penjaduatan
                                     dijadikanatat dalam
       rantaianmenegak.perandan penjaduatan metibatkan:
       1.. Kewangan.
       2. Kemajuankerja.
       3. Penyelesaian

       Rantaian menegak mewujudkan
                       jugu          hierarki
       kedudukan pihak-pihakdalam
                          di     organisasi
                    maklumat secara
                                  menegak merupakan
                              keupayaan makrumat
       menegak  kerana:

                                C 50t I I,tiNC;(JI(tJ,SAl.l

      1.   Menjadikan
                    makfumat lebihdipercayai.
      2.   Menjadikan
                    maklumat lebihefisien.

il,    StrukturOrganisasi
      Kadangk projek
               ala      memerlukan perkara_perkara
      berkaitanautoriti,komunikasi har-har
      secaramendatar-                       i"in'r"ngarir
                       Rantaianmendatar  kadangkara    amat
      pentin bagi men hubungkan
           g         g           oanag i"nlt'" rtunitdi
      dalamorganisasi yangsei"tum ini derfun!"i
      bebasdan interatiioi-antara                ,""".u
                                orang-orang   yangberada  di
      pelbagaifungsiyang berbezaamalfah
      Apabila peningkatan
              ada            kesamaran
      nerkall penting    keperfuanpenyerarasan
      mendatarperru adeikan-Beberapa         secara
                    di               perkara
      1.   Kuasa.
      2.   Penyelarasan.
      3.   Komunikasi.dll

                                     C:5OII I'IJNG{



 Ketua             Ketua            Ketua         Ketua
 I I nit A        I Init B         I I n it C    I Init I-)

Penyelia        Penyelia        Penyelia         Penyelia

Penyelia     | | Penvetia
             -1__________t       Penyelia

             Contoh carta organisasi


         organisasi hanyalah mekanisme
                   ini        satu           rantaiantetapi
         masihmenjadl  sebahagiqr organisasi.
                                  dari         sebenarnya
         semua oiganisasi sedikit
                                sebanyak mempuny;idan
         mengamalkan   rantaian
                              mendatar manaindividu
                                       di             di
         dalamorganisasi boleh
                         itu      bertukar-tukar
         Antarainteraksiyangmelibatkan pefbagai    yang
         berbeza-beza ialah:
         i. Kerja-kerjabertulis.

                         C 501I PINGURUSAN PIMI3IFJN

   Rantaianmendatarmemborehkan  memo,
   perkara-perkara disebarkan          raporan
                rain         loepaJa ianagianrain.
                tahusetiapaktiviti dalam
            Walaubagaimanapun ini:
   a' Tidakdapatmeningkatkan
   b' Tidakdapatmeningkatkan
      membuat apa_apa
 ii. Hubungan

   Ketua-ketua   Jahagian
   jika ada masarah                         terus
                              perk'ara sangat
                    berbangkit.      ini
   dafam  trry?npenyelarurln.                efektif
   masalah apabitadi antara
             lain              mereka terus
   mencapai   katasepakatyangtidaksefaridenganporisi
   organisa$i  secarakeseluruhannya.

iii. Berperanan
  lanyaarnat sesuai ditubuhkan
                             peranan  penghubung
  sebagai arternatif
                                 ilil"g"n terus.
  Keadaan memerfukan
           ini           seseorang yangditugaskan
  di satubahagian manaiu n"rt"ndgr-,.r,]ai,ruab
  berkom nikas dan mencapai koorJi"n         untuk
         u      i                   ari J" gun
  bahagian yangberkaitan.
           lain                           "

iv, Menubuhkan
             satu pasukanpetugas.
 Pasukanpetugasmerupakan jawatankuasa
 sementarayangmengandungi J;"da
        yangierlibal                    setiap
                   dengan  sesuatumasalah.
 Pasukanpetugasnrembual rantaian
 bahagian                       dengan beberapa
        yangberkaitterusdaram ,uruui, organisasi.

                            C 501 P[iNGtItr tJSAN I]tNnAN
                                I               I,tiM

        Ahli pasukanpetugasmembawa   bersama mereka
        rnaklumat jugacadangan
                 dan              yangdiputuskandi
        dalam  mesyuaratkepada bahagianmasing-masing.
        Pasukan petugas sesuaidalammenyelesaikan
        masalah atauisu-isusementara ianyaakan
        dibubarkanapabilatugasmereka telahsefesai.
     v. Mewujudkan

                                  menegak  yangkuat
       akanmewujudkan  jawatanintegratorsepenuhmasa
       bagimaksud  tugaspenyelarasan. dalam
                                     Di     organisasi
             pengurus projekmerupakan seoranginlegrator.
                biasanyaditempatkan luarbahagian_
       bahagian yangdiselaraskannya.

     . Pasukan

        Pasukan lebihbersifat
                 ini         kekal.Biasanya
       bersama   kewujudan        pasukan
                         integrator.     projeti
              pembinaan seringmenggunakanpasukan

iii. Stru ktu rOrga nis as iKef ungs ian,

    Aktivitidikelompokkan bersama-sama,dengan fungsi
    yanglazim bermula  dari bawahhinggalahtlngkatatas
    organisasi Tugas-tugas
               itu-           ataukerjadihubungkaitkan
    berdasarkan  kepadafungsiumum.semua aktiviti
    pengetuaran  dikumpulkan dalamsatu fungsiyang
    melaksanakan    semuatugasyangdiperlukan dalim
    aktiviti            Seterusnyasemuatugaskakitangan
    dikumpulkan  dalamsatu fungsiyang meraksanakan
                       (: 5()II P[N(;I/I{{JSAN

       lugasanyangdiperrukan bawah
                           cli     aktiviti-aktiviti
           Fungsi_fungsi lainjuga mengikut
 kaedah yangsama.


semuaJurutera ditempatkan bahagian
                          di        Kejurute
P:fu.nggungjawab semuaaktiviti   Kejuruteraan.
      organisasi manusia aktiviiioig"orngkan
               ini,        dan
olehsumberdansetiap bahagian kefungsiun""*rn
menyediakansumber  misarnyaKejurute"r"un,
perkhidinatan,                         akaun,
            tenderdan lain_lain.
menekankan                               organisasi
            pengkhususan,kebeikesananJan tuariti.
menggalakkan ekonomi                            ra
             skala      (semua  puf,urju
ditempatkandafamtempatyangsama ' boleh
                                dan - -r
Kelemahan strutkur iarah bertindak
                 ini     ia         perrahan
perubahan                                   kepada
         persekitaran memerrukan
                     yang            penyerarasan
antarabahagian-bahagian.Struktur sesuai
organisasi                               untuk
         bersaizkecir sederhana
                     dan           meribatkan
pengeluaran ataubeberapa
           satu             jenisp"ngulrurun

                                 (l 5 { )ll I )liNG t J I t t j. SN I , l: MI J I NA A N

                    I'IINGARA}I URUSAN


      DOKUMEN             ANALISIS
       TENDER             TENDER






                               (: 5 O I I P I J N(; UI (US N
                                                               ' , I J MI J I NA N

 Dalam  struktur
       digabungkan sumberdansetiap
                   oreh               bahagian
 kefungsian akanmenyediakan sumber.
 organisasikefungsian ayaapabifa
                    berj         organisasi

1. P e n g k h u s u s a n .
2. Keberkesanan
3. Kualiti.

fa jugamenggarakkan ekonomidatam
                   skara              fungsi.
kelemahan struktur
        perrahankepada perubahJnpersekitaran
memerlukan penyerarasanantarabahagian-bahagian

Menurut Duncan(1979),Randolph dan Dess(1gg4),

                        C 50tI PI:NGIJRUSAN


 a- Kepakaran teknikal
              dan       semuakakitangan
             bolehdi manafaatkan.

 b- Kepakaran dan teknikaf

c.   Organisasi
              bofehmemudahkan kepakarandan

d- Memaksimakan minatterhadapfungsidi antara

e.   Penggunaan

f-   Menyediakan
               rangkaian komunikasi
     dalamseksyenatau bahagian

g.   Menyediakqanrangkaiankeputusanyangringkas
                     dararnseksyenuiau nanagian.
h.   Peluangyanglebihbaikterhadap orangseperti
     pangkatdan perkembangan kerjaya.


a- Percambahan

                                                 5 (,
                                                      C 50I I PENGUITUSNN

                       b.   Sukaruntukmenyelaras

                       C.   Kos penyelarasan
                                                       atau bahagian

                      d.    Kepuasan
                      e. sukaruntukmenyesuaikandengankehendak
                         kepelbagaian sesuatu
                                    bagi      produkatau

            iv.    StrukturOrganisasi
                                    produk (projek)
V tpn
                  fa sebenarnya         membawa   maksu kebahagian disusun
ll b'( Y1                                                                   iaitu
                  mengikut        kumpufan   produk,
                                                   perkhidmatan,      wifayah,     pasaran,
                  pelanggan.gtau         program besar.
                                                      organisasi berasaskan
                  projek,    perkhidmatan produk.
                                              atau        betiapprojek
                  menerusi                                                    diuruskan
                                 .satu  bahagianyangterasing. boleh
                  menghasirkan          penyerarasa.n. ceklp bagisejumrah
                  besaroutput         projg_k khususl
                                            yang         pakar-pakar perbagai
                  bidang                                                   dari
                             berbeza     dikumpufkanbersama. bertujuan
                  meraksanakan                                                     untuk
                                        semua tuqasanyangdiperrukan          untuk
                                                               r ' r ur \u' uI
                  m e n g h a si l ka n
                                  ke tu a ran utu, ouiputl  '                  ' ILI,.

                  Biasanyaorganisasi-organisasi mempunyai
                  projek,                               rangkaian
                        perkhidmatan proouf
                                     atau           iuu! *urerlukan
                  struktur                      vJng
                                  seperti struftturlni
                                         ini.         Jiw'uludkan
                  mengikut kumpuran tersendiridaram
                                             di    orgunlu"i
                  berasaskan                                 dengan
                   la amat baik untukmencapai
                  bahagian                             antara
                           kefungsian- amatsesuaidaram
                                      ra              situasi:
                  a' Apabilakeadaanpersekitaran

                              C 501I I,I1NC;IJRUSAN

    b. Apabilateknologiyang digunakanmenjaditicjak
       salingbergantung anlarabahagian.
    c. Apabilamatlam atnyaialahkeberkesanan
       penyesuaian (adaptasi).


    strukturorganisasi produkmempunyai

    a- la bolehdisesuaikan untukperubahan
       persekitaranyang tidakstabil.

    b- Membawakepuasanperanggan   keranatanggungjawab
                                              --                ,
                                                                :. 3
       kepadaprodukdan titikpertemuan

    c- Melibatkan
                           yang tinggiantarafungsi.

    d- Memberiruangkepadaunitataubahagian  menyesuaikan
       diri denganproduk,
                        wilayah,klien liin_lain.

    e- la baik untukorganisasi
    f. Kuasamernbuat

    g. Membolehkan sesebuahorganisasi
       produk,perkhidmatan projek.
h. Merekaberupayamenangani/berdepandengan                       i.i

i- Lebihmudahuntukmewujudataumenambah
   ataujabatanyang baru.

j    Memudahkan
k. organisasi
                          (: 501| I,LINCUItIJSAN


 u.               skala
      Ygnghifangkan ekonomi

 b. Membawa  pe.nyelarasan lemahpada
    keluaran                        bahagian

 b' Menghifangkekompetenan
                        mendaram pengkhususan

c' Menjadikankesukaranintegrasi
                              dan penyeragaman
d' Difemma
e' K.urangk"j"lT,an tentangtanggungjawab
   atau pakarprojek.                   diantaraproduk

f ' Kuranghubungan professionar

h' Mungkinberfaku
   produkatauperkhidmatan.          sesebuah

                                          C 5 ()l I I ' liN(; t J I f A N I )t lMI lt NnA N


PcngumsProjekA              Pcngurus
                                   Projck B                    PengurusProjekC

  U nit A I                    UnitBl                               Un it Cl

  Un it A2                    Un it 8 2                             Un it C2

 Unit ,43                     UnitB3                                Unit C3


 tJnit 44                      Un it8 4                             Unit C4


      v.       Struktur Organisasi
               Merupakan suatubentuk keorganisasian yang efektif,
              apabila sejumlah besarprojekbersaing untuksumber
              yangterhad,menghasilkan                                                         :
                                       permintaan terhadap unit-unit                          i ,r
              kefungsian. Satuorganisasimatriks merupakan satu
              jaringan hubungan mendatar, pepenjuru dan menegak
              menerusinya  semuatugasakandilaksanakan.   organisasi
              ini adalahkombinasi penyatuanstrategi-strategi
              berorientasikan matlamat. menghimpunkan
                                      ra                 kakitangan
              dan peralatan dalamunit kefungsian
                            di                    yang
              membolehkan   pembahagian  kecildibuatdalamperkara-
              perkara rkaitan
                      be       pengkhususan,pemajuan, pengg unaan
              sumberyang efektif,skalaekonomi  dan seumpamanya.

                          C 501I I,fiNCtJI{tisnNI,tiMIilNnAN

  MenurutHunterdan sticknet(1983:9g-101),

  suatu bentukkeorganisasian efektif,
                             yang        apabira
  sejumlahprojek bersainguntuk simber yang terhad,
  menghasiIkan pemintaan terhadap uniFLnitkefu g
                                              n s'in.
  safu organisasi
                matriksmerupakansatu  jaringan
  hubungan mendatar, pepenjuru dan meiegrak
  menerusinya semuatugasakan dilaksanakan.

 Terdapat syaratuntukmenjadikan
         tiga                   struktur
       merupakan pilihan
 organisasi.      tersebut
 i-   wujudnya keperrgan mendesakbahawa sumber_
      sumber perru
                 digerakkan digunakan
                            dan         merangkaui
      bahagian-bahagian produk
 ii. VVujudnyakeperluan_keperluanmendesak
      dipersekitaran mengeruarkan ataurebih
                   bagi            dua
            misalnya kualiti
                    bagi      teknikal produk
 iii. Wujudnya domain persekitaran
      kompleks jugatidakmenetu.
Dalam organisasi
peringkat akanturun bawah                    dari
         atas        ke        melituiiiraki
kemudiannya berpecah,
                    yangmewujudkan   tanggungjawab
bersama mengenepikan
        dan             kon"eprantaian autoriti

                                      C 5 0 1I P I I NG URUS A N , l; Mllt NA n N

                                tJ                   U
                                N                    N
                                T                    T
                                A                                                       t

Yt(a r


         ContohI :Strukttrr

                 )   \ ,vd l,   ,{lnt t   R,


                                     C 5 0 1 I P E NG UI { t J S iA I , t : MI J I NA A N


            PIINGURTJS                     PENGURUS               P E N GU R U S
            PLANT                          PEMBELIAN              PERKIIIDMA'T'i\N

PENGURUS                                        Tanggungjawab

PENGURUS                                        Tanggungjawab

PENGLIRUS                                       fanggungjarvab projek


    Contoh2 : Stnrktursebuahorganisasimatriksorqanisasi
                 pembinaan (Burack I 9ZS)

                                   C 501I I'DNGUI{USA I,IIMIJINAA
                                                    N           N


PENGURUS           AKITEK               EKSEKUTIF         EKSEKUTIF
TAPAK                                   PEMBINAN          PEROLEHAN



                                                         J o in t t a s k s


  StrukturMatriks (kontrakpembinaan
                                  furnkey) ) lr r u' f..i- |                       (,t

                             lrnciqr        tundrn.qon

                         C 5 0 1I I , E NC{ J I < { J S iA,N, MI ilNA A N
                                                         I t


  a . Penggunaan
               sumberadalahlebih berkesancjan

  b' Penyampaian

 c. Menggalakkan perkembangan   pengetahuan
             individudi dalam unit ke"fungsian.

 d' Mengurangka.n percanggahanurusandi antara,rine
               bagi pengurusprojekdan kakitangan

 e' Mengerakkan   perubahanmendadak   padakerjadi
    dalamorganisasi-Apabira projekturut, I!t"4u akan
    pulangke bahagian  kefungsianasafmerekauntuk
    bersedia menjafankan kerj-a
                              yang baru.Maka
    perubahan  tenagakerjayung mendadak    tidak
    timbur-f tidakmenimbuikan-tekanan
          ni                           kepadamereka
    dalammenghadapi   perubahan tersebut.-

f ' Mengurangkanpengf
                          i"puiu iluru oun
   dikongsi organisasi
         oleh        kefungsiun
g. Pengurusprojek
   Keadaan terjadi                    masalah.
          ini     kerana"terah
h' Pengurus  projekberpetuang menggunakan dan
   prosedur berasingan daripadu             porisi
                                org"u"n Hur,ngsian
   asalnya.                             "ri

                       tl 5(Jt I,tlNCtJItUSn I,tiMIltNAn
                             I             N            N

i- Meningkalkan  tahapkuantiti dan aliranmaklumat.
   Apabilatahappemprosesan     maktumai telahmeningkat
   dan keputusan  yang efektifperrudibuatcraripada
   maklumat makastruktur
            itu,              organisasimatriksamat

j. Struktur
          matriksmenggabungklan jenis
   komunikasi authiriti
             dan      iaitusecaramendatardan
   menegak. akan mewujudkan
            Ini               kestabitan
   kecekapan dalamstruktur.

k. lanyalebihfleksibel
l- Hubungan antaraahlidalamorganisasi
   tidakformal-                                             ,,
m- lanyalebihfokuskepadakeperluan
n- organisasimempunyai

o. lanyamembantumenjejaskan
                 dalammemastikan kejayaan

p. lanyamenyumbang
                            yang tinggi.
q. Memaksimakan
   terhad                                                   {

                             C 501I I,INCIJIilJSAN |,ITMIJINAAN


 a- 'Dualreporting     boreh  berraku   dan mengakibatkan
    konflik - Aktiviti-aktivititidak d iserarasLu"n,
    tertelingkahan    wilayahkuasa,cemburu
    profesion perseng
               al,          ketaa antarakakitanqa
                                   n                 n,
    kesamaranperananterutamanya             paoa pe.ringkat
    pewujudanstruktur                                     awal
                           matriks.peiru dibendung    untuk
    mengelakkan     kekecewaan       ahli.
 b- Mungkinkerewatanatau 'over budget'berrakudi

c' Pembahagia.nsumbermenjadi

d. Memungkinkanrebihbanyakpengurus
   akan meningkatkan pengurusan
                   kos         denganjelas.
e' Mengurangkan  kepuasanbekerja keranamenurunnya
   penglibatanbersamadan kualitiarahanbagi

t. Pe.ngurus      projekamat memerlukan    dan mencari
   sokongan       daripada    perbagai
                                     pihak.Namunada pihak
   Yang   menganggap merekayangperfudiutarnakan
   d a n d i m u l i a k an .

g . Konflik
                             dengan            peruntukan
h . Mungkin

                                   C 5 0 1I P I I NG UI (US A l, t rMI lt NA A N

A . J e n i s - j e n i s g a n isa sim a tr iks.

      Berlakupenguas aan apabitaada pengurus yang lebih
      menonjol dalamorganisasi
              di                tersebut.pelu diingatkan
      bahawadalamstrukturorganisasi  bagiprojek-projek
      pembinaan sepertiyang dinyatakanolehWalker
      (1984:153),bahawaterdapattiga komponen  utama

      a. Klien.
      b. Pasukanrekabentuk.
      c. PasukanPembina(kontraktor).

sebenarnyaorganisasi     juga ada dua jenis (Hall
1982:871:                                                                          {
                                                                                   ;. 1
      1. Berbentuktetap atau kekal.

        la salingkebergantungan

        D i M a l a y s iad i g u n a ka n le h p ih a kBe r ku a sa
                              ,          o
        Tenrpatan        (PBT)danjuga agensipembangunan
        w i l a y a h , d ll.
        Sebahagian          syarikat                   juga
                                     antarabangsa bergerak
        ke arahini.Pengurus           wilayahmerekaakan
        berhadapan          denganpengurus-pengurus
        pengeluaran         produkantarabangsa.         pengurus
        produkpulamelaporkan             sesuatuitu kepada
        pengurus       wilayahdan pengurus         produk                          :.
        a n t a r a b a ng sa .

  2 . Struktur matriks beratih(beranjak).

  .     la ditujukan
       pasaran orang-orang dalam
               dan          di    organisasi

                                        C 5 0 1I I , i, NC[ J I (I J S A N, t lMI ilNn n N

 vi' struktur organisasi kacukan/gabungan
     semua di atas.
     strukturorganisasi kacukan  iarahmerupakan
     kombinasi strukturorganisasi produk dqanstruktur
     organisasikefungsian. Gabungan   kedua-dua  bentuk
            organisasi membolehkan
                       ini              sesuatu ,firma
     ataubadan  mendapat   manafaat daripada kebaikan
     kedua-dua strukturorganisasi tersebut.struktur
    organisasi kacukan  akanwujudapabila   sesuatu  firma
    ataubadan   berkembang mempunyai
                             dan             beberapa
    produk ataupasaran.Maka    fungsiyangpenting   pada
    asetiap prqduk ataupasaran   akandipincarkanarau
    diagihkan kepada unit-unitserba rengkap tetapi
    sebahagian  fungsijuga dipusatkan ditempatkan
    di ibupejabat organisasitersebut (Daft1gB9:233).
              c 1h"   l 'h r a J c {"        1.9^(Gn.
Kebaikan.                                                 t/ ? , " A " F

a' Memberi  peruang kepadaorganisasiuntukmencapai
   penyesuaian penyerarasan bahagian
               dan             di           produk
   dan kecekapan bagagian
                 di         kefungsian iung
b- Memberi  kesankeseimbangan rebihbaik di antara
   matlamat pqdaperingkatkorporat v maflamat
   padaperingkat            '
c. Mencapai  penyelarasan
                        bahagian, iaitudi antara
   bahagian keruaran di darambahagian
                    dan                   keruaranitu


a' Kemu-ngkinan meningkatkan pentadbiran
                akan            kos
   yang berlebihan.
b' Membawa   konflik antarabahagian
                   di             pengetuaran
   denganbahagian  korporat.

                      C 501I I'DNCURTJSAN

vii- struktur organisasi Berbentuk Rangkaian
    kerja keorganisasian.

   perhubugantidak formal
                        dan secara
   menerus) antara
          di       pihak-pihak           '
   kebaikan memberangsangkan
          dan                  (Hastings

   Ada pihakseperti Gore daripada
                   Bill             Gore
   Associates (Hastings gg5)menamakan
   perhubungan sebagai
               ini        organisasiKekisi.Secara
   dasarnya perhubungan  berbentuksarangla6ah_
   labahdi antarasemua  pihakdi dalamorganisasi
   bagimelahirkanrangkaian kerjakeorganLasian.

                                            C 501I [,tiNa;tJI([JS;AN

         v i i i . S t r u k t u r B e r a sa ska n ka wa sa n .

              sesetengah  struktur
              kawasanaktivitiatau perniaga Territoryjuga
              dikenafdari segi:

                i. Geografi.
                ii. Kawasan.
                     W i t a y a h.

                      yang berdasarkankawasanbermakna
             sesebuahorganisasi di str.ukturuntuk
i-i *l

             D i b a w a h r g a n isa sije n is i,m u n g kin m u aa ktiviti
                          o                    in            se
             k u m p u l a n d ala hb e r d a sa r ka n :

             i. Lokasi geografi (atau kawasanatau
                s e m p a d a n) .

                            Sesetengahnya termasu :
                                           pula     klah
                a. Jarak.
                b. Faktorgeografi.
                c. Liputanperkhidmatan.
                d. Kepuasan  pengguna.
                e. Sempadan  politik.
                f. Tarafsah perniagaan,dll.

                       C 501I PI"lNGtJl{USn I'tlMtitNAAN

ii.   Mengelak
             ataumeminima  kesukaran

      Dapatdiperhatikan setiappejabatkawasan
      bertindakseolah-olahsepertisebuah  organisasi
      Iang berdikariyangberdikari(self-standing=
      bersendirian,tanpabergantung padayungl"in1
      dalammenguruskan   perniagaan tetapimJsih
      mengekalkan  standardperkhidmatan kualiti
      produk yangsama.Semua dikawal
                               ini        seliaoleh
      ibu pejabat.



                                                            \i /

                                        C 5011PENGIIRUSANPEIVIBINAAN
                                                                  w r b t \ l qa 4
1.5 PIHAK-PIHAK YANG TERLIBAT SEIVIASA                            {,
                                                                                     9*r   !r '1 'i c'
    PERTNGKATPEMBINAAN PROJEK                                 tiajrtselO         I
                                                                                     tPc*fla,r *'
                                                                   t       \-+r1



           Pemilik merupakan  tuanpunyaatauorangyang ingin
           melaksanakan  projek.Boleh terdiri dari individu pihak
           kerajaan,badan-badan  berkanun,firma swasta.
           Bagi projek Kerajaan,pemilik selalunya   merupakan
           Kementerian  atauJabatan.Selalunya  Kementerian    atau
           Jabatankerajaan merupakan  pemajuyang terbesar    yang
           melibatkanprojekpembinaan   seluruh  egarakhasnva
           dalampenyediaan  infiastmktur.

           Bagi projek srvasta
                             selalunya lebih mementingkan
           keunfungan dalarnprojek-projekyangdilaksanakan.
           Pemilik biasanyaterdiridaripadasyarikat-syarikat.
           Pemrlikbiasanya merupakan   pemajukepaclaprojek yang

           Projekyang dilaksanakan   oleh pemajusamaclauntuk
           kegunaan awamseperti   sekolah,balairaya,
           ataupununtuk kegunaan   persendirian.
                                               Dalam usaha
           untuk mencapai hasrat pemilik perlumenyediakan
           peruntukankewangan  yang mencukupisamadadengan
           mengeluarkanwang simpananataupun      membuat
           pinjaman daripadainstitusikewangan.

          Pemilik ataupemaju juga perlu menyalurkanhasrafnya
          kepada  pihak yangpakardalammelaksanakan  projeli
          ters t. L azimny pemaju akan berjumpad"n gon
              ebu          a
          kumpulanPerunding                Akitek, pJngurLrs
          Projekataupun  Perunding-perundinglain.

          Namunbegituterdapatjuga pemajuataupemilik yang
          memajukanprojekoranglain. Merekaini cliberikLrasa
          unfuk memajr-rkan
                         projeksepertiini. pemilik seralunya

                                      C 5011PENGIIRUSAN

           melantik perundingbagi membantunya   dalam
           sesuafuprojek.Pemilik juga perlu memikirkan sumber
           kewanganuntuk pembiayaan    projek dan bayarankepada


    a. PengurusProjek

       .    PeranansertaPerhubungan.

           Orangyang terlibatdalampengurusan    projek adalah
           salahsatuciri penting.(CIOB1982:14)menyatakan
           bahawa pelantikan  seseorangpeng,rus projek adarah
           bagi meringankan  tanggungja'uvab
                                           majikan ataukrien
           dalammenyediakan    suatuorganisasiunhrk
           menguruskan  perkara-perkaraberkaitanrekabenfukclan
           pembinaan projek.Sepatutnya  pengLrrusprojek perlu
           wujud bermula  padatahapar.r,al projek lagi.t<lien
           perlu melantikPengurus projekyang akan*.rriugu

           Beberapa faktor perlu dipertimbangkan
           perlantikanPengurus  projek:

                 Kelayakan pengalaman
                              dan            yang diperlukan.
                 Orangataubeberapa     orangyang
                 bertanggungj  awab kepadanya.
                 Had autoritinya.
                 Si fat peribadinyat ermasukdaya kepempinann,va.

       Walaupunada   juga Pengurus  projek yang dilantik oleh
       Kontraktor atauperekabenfuk  tetapi crite;ia pemilihan
       adalahsama  sepertidi atas.Lantikanpengurus    projek
       biasanyadibuatsecara  berfulis.Aclas.ebat ogiu" klien
               Pengurus   projek hanyamen"iarLri sahaia
       yang mengandun syarat-
                       gi        syatafdan terma_  terma
                                                           C 5011PENGTIRUSAN

                              lantikan,termasuklah jenis projek yang
                              dipertanggungjawabkan,bayarannya,    tempohkuatkuasa,
                              lantikan,bidang tugas,peranan,kuasa,tanggungjawab
                              danperkara-perkara  yang berkaitan.Biasanyaklien akan
                              membuat  perjanjian rasmi denganpihak yang dilantik
                              sebagaiPengurusprojek selepassuratlantikan dibuat.

                              PihakThe Royal Institution of chartered Surveyors
                              (ruCS 1989)misalnya,telahmengeluarkan     format
                              seragam  memorandumperjanjian di antaraklien dengan
                              Pengurus projek (berserta
                              Gunakhidmat  Peng,rus projek profesiotrui;,diantara inti
                              isi kand,ngannyaadalahberkaitanperkara-perkara

                              a. Pengurus
                                        projek bertindaksebagaiagenklien / yhv vr, ,,
                               o Bertanggungjawab   dalamhal penyelarasan
                                             pengumsan  dan komunikasiprojek.

                              b. Pengurusprojek mestilahboleh:
                                . Berkomunikasi  de'gan kons,rtanberkaitanrinslsan
                               . Mengawasi   kemajuan,maq\q(
                               . Mengawasi   kos dankewangan   projek.

                             c. Tugasdan tanggungjawabpengurusprojek terhadap
                             d. Tugasdan tanggungjawabklien terhadappengurus
                             e. Feeataubayaranbagi Pengurusprojek. rnr!\h <\''r14\

                             Pengurus projek memainkanperananpenting yang
                             bertindakbagi men canfumkan k esemua b ahigian"projek
                             termasuk para professional ang berbeza_beza
rt qS \,t       yrtq ra

l r nnr" I   f re (lr   n
nrr f 4r. t'(* r\       i'
                                                                                   '7 /1
                              C 5011

 Padaasasnya   Pengurus projek memainkantiga peranan
 (Lorshet al. 1978)iaitu :


 Pengurus   projek mestilahmengintergrasikan
 aktiviti dan elemenyang berasinganuntuk mencapai

i.     masa.
ii.    kos
iii.   fujuanperlaksanaan.

       projekjuga mesti berkebolehan
Pengurus                           unfuk:

       menurunkantugasantanggungj    ar,vab.
       memahami   personaliti,
                             sikapdan ciri-ciri ahli-ahli
       pasukan projek.
       tahucarannfr-ikmenggunakan   bakatyang ada.
       Pandaimendengar berkomunikasi.
       Prihatinterhadapsikap setiappenyumbang
       tentangpolisi,had masakos dll.

 Oleh sebab Pengurus  projek terlatakditengah-tengah
saluran komunikasi,  maka dia juga perlumembuat
keputusan  yang sukaruntuk dibuat.Ada masanya
Pengurus  projek tidak rnempunyaiautoriti unfuk
membuatkeprifusan    besartetapi pengurusprojek masih
lagi orangyang paling sesuaiuntuk *.*p.rrgaruhi
keputusandan tindakanmereka yang ada autoriti
                                   C 5011PENGURUSANPEMBINAAN

 b. Akitek.

       .    Peranansertaperhubungan.

    Menyempurnakanhajat tuanpunyaprojek sertamemberi
    nasihatdancadangan.   Arkitek juga menyediakan
    rekabentukawal dan terperinciberdasarkan     kehendakdan
    modal yang dimiliki oleh ruanpunya   projek. Arkitek yang
    dipilih mestilah mendapatpengiktirifan persatua
    Arkitek ivlalaysia.Kebiasaannya   Arkitek adalah
    perundingyangpertama     sekalidilantik oleh pemaj'dalam
    rnelaksanakan  sesuafuprojek,Arkitek juga perlu
    mengawasi menyeliaprojek semasa
                dan                          pembinaan.  Selain
    dari itu Arkitekjuga adalahsebagai  ketui dikalangan
   Perundingjika sesuatu   projek tidak menggunakan   khidmat
   Arkitek akanmemb,at lakarankasartentangin-rpian
   pembinaanPemilik dan JurukurBahan akan membr,rat
   anggaran pembinaan.
              kos             Sekiranya anggaran  yang dibuat
   adalahbersesuaian   dnganperuntukanvu"g clisecliakan   oleh
   pemilik, makaArkitek bolerrrah   melukis pelanbangunan
   yang lengkap.
   Arkitek akanmengubah     rekabentuk  asaratasnasihat
   Jurukur Bahansetelahanggaran     yang dibuat berbez,a
   samadalebih ataukurang daripada    perunfukan.

c. Jurukur Bahan (JUB).                           tu5'
                                       " t *i
                                         t t t + r'i
   .       Peranansertaperhubungan.    - !awat     K 't       a ; {a 1 a \
                                        - f^!\     {l o n '

  SebgaiPerunding,   Jurukur Bahanmestilah mendapar
  pengiktirafan Institut surveyor Malaysia. N4erekaini
  boleh dianggap  sebagai Akauntan danlriga peguamatau
  penasihat dalamindustri binaan.Berp..onu.,sebagai
  penasihat padaperingkatawal walaupunlukiian
  terperinibelumdisediakan.   Bolehbertindaksebasai
  perancang bagimenganarisa
             kos                  secarasistemarif
  elemendi dalamsesebuah     bangunanseftamembuat
  perbandingan dengan   kos keseluruhan.

                                         C 5011PENGTIRUSAN

       Antara tugas-fugas
                        fUB :

       i.       Menyediakandokumentawaran.
       ii.      Dalam prosesrekabentuk     Jurukur Bahanakan
                membuatanggaran     berdasarkan   draf yang
                disediakan ditambah
                            dan           dengananggaran    oleh
                Perundingelektrik danJentera.
       iii.     Jika anggaran  tidak sesuai denganperuntukan   yang
                JurukurBahan hendaklah     memberi nasihatkepada
               pihak yang berkaitanuntuk melakLrkan      pindaan.
               JurukurBahanjuga perlu memastikansernua
               dokumenkontraktelahditancla      tangani.
       rzi     Merekajuga perlu memastikan     Kontraktortelah
               menyediakan    kesemua  insuran-insuran   yangperlu
               sebelum  kerja bermula.
    vl1.       Merekaj, gu b ertan ggun ar,vab
                                        gi       rneni ai kemaju an
               kerjadan menyediakan bayaran
                                       sijil         kemajuan
               semasa ek sedang
                       proj           dilaksanakan.
   viii.       JurukurBahanjuga mengarvalkos agar harga
               pembinaan   tidak melebihidaripada   peruntukan  yang
   ix.         Semua  pindaankerjaperlulahclinilai.                 ]
   x.          Di akhir projek merekaperlr_r menyediakan    akaun

d. J urutera.

   .         Perananserta perhubungan.

  Juruteraprojek hanyabolehmengawaloperasitapak
  mengikutsyarat-syarat konffak.
  secarapiawainyaseorang   Juruteraperlu merekodkan
  kemajuankerja dan memberitah' Kontraktor sekiranva
  tidak mengikutjadual dan spesifikasi.Jurutera
  mestilahmemben  nasihatteknikalkepadaKontraktor

                                       C 5OI1PENGTIRUSAN

          Juruteramestilahseorang  yang berkelayakan berdaftar
          dengan rnstitut Jurutera Maraysia.peranannyahampir
          samadenganArkitek tetapi merujuk kepadabiiang
          masing-masing  dan selaluberhubungdenganArkiiek.

          Terdapattiga kumpulanutama iurutera:

                 Jurutera Strukfur

          r Peranan sertaperhubungan.

           Merupakanahli kumpuran .Iurubina yang merupakan
          pihak sebenar  yangakanmelaksanakan    keija_kerya
          pembinaan tapakpembinaan.
                      di                  Kontraktoitercli'
          samada   daripadabadan-badan   korporat,syarikat
          perkongsian,persendirian  ataupun usahasama. Biasanya
          dipilih melaluiproses tawaran.Ia menjarankan  keria
          pembinaan   dengan hargadan tempohyang telah
          ditawarkanolehnya.Segala    kerja pembinaan yang
          dijalankanakan.di  arvasioleh pihai perundinj bagi
          memastikan   kerja-kerjamengikutpenentuan rukisan
          yang ditetapkan.

      .       TanggungiawabKontraktor:

                 Membinadanmenyiapkan projekpembinaan

          n      Menanggung  segalakeq'ayangtelahdilaksanakan
                 dan disiapkan tapakbina.

                                  C 5011

     iii.     Melaksanakan  keq'adenganterafurdan cekapbagi
              menyiapkan  kerja mengikuttarikh yang telah

     iv.      Memafuhisegalaperafuranpihak berkuasa

     v.      Menyediakanperlindunganinsuranke ataskeria

.         TugasKontraktor:

    i.       N{engernukakan periaksanaan
                           bon                  yang

    ii.      Mengemukakan poiisi insuranberkaitanclengan
                       orangramai,kebakaran  danSOCSO.

    iii.     lvlelantik
                      rvakil tapakatauagenunt*k menerima
             arahan daripada  Pegawaipenguasa(p.p).

    iv.      IVlernberitahu mengenaisebarang
                          P.P              perfukaran

v'           ivlembenarkan atauwakilnya memeriksa
                         P.P                    rekod

vi.          Mengesahkanarahan perubahansecara berfulis
             dalammasa7 hari selepas

vii.        Mengik,t wakf'kerja yang ditetapkan.Jika waktu
            lain perlu mendapat
                              kebenaran dari pegar,vai

viii.       Tidak menceroboh

ix.         lllengemukakanprogramkerja dalambentuk
            kaedah LaluanKritikal atauCartaBar.

                               C 5011PENGLR.USAN

 X.      Melaksanakankerja menggunakan  bahandan
         melaksanakankerja mengikut upayakerj seperti
         dalam dokumenkontrak.

o Kategori Kontraktor

 Kontraktorboieh dikategorikan kepacla jenis:

 a. Kontraktor [Jtama./

      Merupakanpihak yangmendapatprojek daripada
      Pemilik.Mereka bertanggungjar,vab
      terhadapperlaksanaan pengenclalian
                          dan              kerja
      pembinaan tapakbina bagi sesuatu
                di                      projekmengikut
      merekaakanmenyerahkan   sebahagian kecil kerja_
      keq'apembinaan tersebut

   Ia diibaratkan sebagaikunci kepadasemua    masalah
   danpenyelesaian.  seraindari itu ia juga memainkan
   peranan   utama.
                  dalamsetiappengawasan     projek dan
   dipertan gungj a'u'ab
            g          untuh melaksanakoo    akii,riti -
   aktiviti pembinaan mengikutspesifikasi  penyiapan
   yangdikehendaki   olehpihak pemaiu.

b. Sub Kontraktor. o/

  Sub Kontraktor ataupun  kontraktor kecil akan
  mel;aksanakan  bahagian_bahagian tertenfu  danpada
  projek yang telah diperolehioGn Konffakror
                                              uian a.
  Kontraktoryang ingin melibatkandiri dalamprolek
  pembinaan mestilahmendaftarkan   cliri atausiarikat
  merekadi PusarKhidmat Konffaktor (pKK)
  CIDB' Terdapat  dua(2) kategorisubkonfrokto.iaif':

                         C 5011PENGIIRUSANPEMBINAAN

i.     SubKontraktor
                          " il)lj, il^o
       Sub Konlraktor yang dilantik sendiri oleh
       Kontraktorutama unfuk melaksanakan     yang
       melibatkankerja-kerjafukangbagi pembinaan
       yang dilaksanakanoleh Kontraktor Utama.

l I.   Sub Kontraktor Di namakan. \-/

       Merupakansub kontraktoryans dilantik oleh
       Pemilik ataupunPerundingunhtk
       melaksanakan a-kerjapakar seperti
       pemasangan hai,va
                   lif,   dingin, elektrik,clll.

                                                                                           C 5O1iPENGTIRUSAN

                                                            I.5.4 PIHAK BERKUASA NIE]VIBERI I(BLULUSAN

                                                                A. KBRAJAAN TBNIPATAi\

                                                               o Perananserta perhubungan.

                                                                 KerajaanTempatanberperan member keh-rlus
                                                                                            an              an
                                                                            projek pembinaan   sertamenyediakan satLr
                                                                 pelan pembangunan   yangteratur. N4erekajuga akan
                                                                 mengawal agartidak terjadipenyele\.vengan

                                                                 contoh yangjelas adalahsepertr stratatanahpertanian
                                                                 perlu ditukarkepadastratatanagperindustrianjika
                                                                 Pemilik ingin membina kilang . Stratatanahbansunan
                                                                 hanyabolehdi bina pembinaan  bangunan  sahaja utu,
                                                                 tanahcadangan  projek.

                                                                TerdapatpelbagaiJabatanyang terlibatclalam
                                                                perlaksanaansesuahr projekpembinaan.setiap Jabatan
                                                                mempunyai  kehendak-kehendak perlu dipatuhi
                                                                oleh Pemilikprojek, Selainciariitu peranan
                                                                JabatanKerajaan adalahuntuk:

                                                                      Memberikelr-rlusanperlaksanaan projek
                                                                      Mewujudkan satupembangunan    yang teratur.
                                                                     Memastikan  tidak berlakupenyelewengan
                                                                      terhadapgunatanah sepertiyang telahditentukan.
                                                                     Tidak rvujud pencemaran terhadapalam sekrtar.
                                                                     Tidak berlakuekploitasiterhadap sumber_sumber
                                                                     asliyangsediaadadi sesebuah  kawasan.
                                                                     Melindungikehendak   sosialmanusia
                                                                     Memastikan  matlamat sertadasar-da.sar
 V. \ l'\ (r   $ d Yl                                                                                           l rtn
                                                                                            3 e\ra{ a
! \ qn          -       { } v\ }r\i 4   \ r"'rdl t
                                                                                            - 1tr' * l " t
          .srql                          l i Jth r8 l 6 l                                        \1   thl tu\F '/h

    q lc \          <qv
                              ,:t'*l                                                               v t '4 "
                                                                                                               no "
   -$ ^        V ltct           u lY

   1/ c :rl rro n                                                                                                       82
                                          C 5011 PENGIIRUSAN PEMBINAAN

Antara Jabatan-jabatan pihak KerajaanTempatan
yang terlibat ialahseperti:

o        P TG   r' p L J { lr h 4 7 a r n ,
o        PBN
.        PPBD

B.        TELEKONI

     Dulu tanyasebuahbadankerajaan   yangclikenali
     sebagaiJabatanTelekomMalarrsia.  Ianvatelal-r
     diperbadankan diswastakan
                  dan             pada1i haribulan
     Oktober 1984dan di tukar kepada syarikatTelekom
     MalaysiaBerhad.yang  dikenaiisebagaiTM dan telah
             dalamBursalVlalaysia  pada9 haribulan
     September 1990.

     .    PeranansertaPerhubungan.

          Telekommemainkan     peranan pentingdalam
          merencaltakansistemyangberkaitan   dengan
          telekomunikasi. sesuatu
                        Jika         projekbaru ingin
          dibangunkan pelu mendapat  kelulusanpelan dari
         TelekomMalaysiaBerhad keranasetiapprojek
         bam perlukepada   liputan danpemasangan  kabel
         Telekom.Ini penting supaya   kemudahan
         komunikasibagi projek yangakandibina aka_rr
         mendapat kemudahandan perkhidmatan      dari
         pihak Telekom.Pihakpemajuperlumendapat
         kelulusandari TelekomMalaysiaBerhacl    semasa
         peringkatkelulusan  pelanpembinaan  projek
         lagisebelumproses  memanggil   memanggil tender

                            C 5OI1PENGIIRUSANPEMBiNAAN


     o PeranansertaPerhubungan.

       menentukan sesuaiandan kelulusan pendar,v an
                 ke                           ai
                tenagabagi satu-satu

      Selaindari TelekomMalaysiaBerhacl,  pihak
      Pemaju juga perlu mendapat kelulr_rsan TNB
      semasa peringkatmemohonkelulusan    pelanbagi
      pembinaan  sesuafuprojek. TNB berperanan
      memberiperkhidmatan kemudahan
                            dan             penyaluran
      bekalan tenagaelektrikkepada kawasan  projek

       Segalaperkaraberkaitankedudukan     kabelbasi
      bekalantenaga  elektrik,TNB juga perlu
      memikirkanempangan      hidro barujika perlu,
      iampujalan,bekalanke unit-unitpengguna.
      pembinaan -Station olehpemaju perlu
      ntemafuhi piawai semasa   peringkatkelulusan
      pelanprojek.Pemaju   mestimematuhiapayang
      telahdiluluskanoleh TNB danpihak -fNB juga
      mestimembekalkan   perkhidmatannya    dengan
      sempurna. Selain dari iru semuaperkara_per,kara
      yangberkaitan denganTNB perlu mendapat
      kelulusanpihak TI{8.

                            C 5011PENGIIRUSANPEMBINAAN


     o Perananserta Perhutrungan.

       Jabatan Bomba merupakansalahsatubadanyang
       teriibatdalamkelulusan sijil Layak ivlendurluki
       (C.F) atauSijit Penyiapandan pematuhan
       (CCC). Pihakbombaakanmemberinasihatdan
       kelulusan dari segikeselamatan keselesaan
       pengguna juga tentang
                 dan             perkhidmatan
       bangunan  yangperlu mematuhikehendak    unclang_
       undangkecil bangunan  supayaapabilaada
      kecemasan   ataukebakatan, pihak yangterlibat
       dapatdiselamatkan  termasuk  premis,pcngguna,
      jiran dan orangawam.

      PihakPemaju juga perlu mendapat kelulusan
      JabatanBombadari peringkatkelulusan  pelaniagi.
      PihakJabatanBombaakanrncmastikan    segala
      kemudahantentang kebakaran, hyclrant,
                                 fire         segala
                kebakaran kecemasan
                           dan            sertalokasi
      pemasanganperalatankecemasan  dipafuhi.

      Projekyang dibinaperlu mematuhi Akta
      Keselamatan dan Kesihatanpekerjaan,Llnclan
      undangkecil bangunan tentangkeselamatan,

                            C 5Oi1 PENGURUSAN


     o Peranan sertaPerhubungan.

        JabatanKerja Raya bertanggungjawab  terhadap
       pembaikanpenyenggaraan   semuakenderaan   dan
       bangunanKerajaandan berkhidmatsebagai
       penasihatteknikalkepadakerajaan  diperingkat
       Persekutuan negeri.mereka
                   dan               juga merupakan
       Pemilik projek Kerajaanyang terbesar. Mereka
       juga merancang  pembangunan,  rekabentuk,
       pembinaan pengenggaraan
                  dan               jalan-jalanawam,
       bekalanair ar,vam bangunan-bangunan
       gunasama  bagi KementerianKerja Raya.

      SecaraantnyaJKR merupakansatubadankerajaan
      yangmemajukan    projek-projek Kerajaan.
      Jugaadalahsebagai   wakil KerajaanMalaysia
      sebagai PemajuatauMajikan atauKlien kepada
      kerajaan Malaysia.Banyakkontrakdan tencler
      dikendalikanoleh JKR daiammemajukan    Negara.
      Projekyang seringdimajukanoleh JKR adalah
      sepertipembinaan  bangunan, Jalanraya,
      bekalanair dan lain-lain.

      JKR juga perlu memdapat          pBT
                             kelr_rlusan jika
      ingin membinasesuatuprojek bagi pihak

                               C 5011PENGTIRUSAN PEIVIBINAAN

F.       PEMBENTTI{\GAI\ (Indah \yater)

     .   Perananserta Perhubungan.

         Pembentungan alunyadikaitkan denganInclah
         Water Konsortium (IWK). Ianya adalahsafubadan
         yang melaksaks akankerja-kerja y angb erkaitan
         dengan kerja-kerja p enyambun
                                     gan, p emasangan,
         pengaliranterhaclap sistempembentungan di


     .   PeranansertaPerhubungan.

     Jabatan Alam Sekitarpula berfungsiuntuk
     rnemastikanaktiviti yang bakalatausedang
     dijalankantidakmencemar   keaclaan
                                      alam sekitar.

     Segaiabentukpencemaran    terhadap Alam sekitar
     mestilahdiarnbilberat dan dipaftrhioleh semllapihak
     yangterlibatdalamsesuatu  projek.

 Merekajuga mestilahmemastikanagartiada
                    sumber-sumber yang sedia
 ada di sesebuahkalvasan.

                                 C 5Oi1 PENGURUSAN


       .   Peranan serta Perhubungan.

           B erperanan membekalkanb ahan-bahan   binaandan
           logi yang diperlukandi tapakbina. Terdapatdua
           (2) kategoripembekaliairu:

       a. PembekalDalaman,

           Merupakanpembekalyang dilantik senclirioleh
           Kontraktor unfuk membekalkan
                                      bahan-bahan   dan
           logi ke tapakbina.

      b. PembekalDinamakan.

           V{erupakan pembekal  yang dilantik oleh pemilik
           projek ataupunkumpulanperunding. Laztmnya
           pembekalDinamakan dilantik untuk
           membekalkanbahan-bahan peralatan
                                      atau          yang
           khusussepertisistempenggera plaster ceiling,
           pintu kacakalis peluru, dll.

                                                                        C 5011PENGT]RUSAN

                             1.5.6 SYARIKAT I(EWAI\GAN

                                              .     Peranan sertaPerhubungan.

                                                    Pemilik projek lazimnyatidak mempunyaisumber
                                                    kewanganyangmencukupiuntuk membiayai
                                                    projek yangsedang  dijalankan.Merekaperlu
                                                    membayarkepadaKontraktor segalakos yang
       qro 5rk -.=-1
                                                    telah dikeluarkandalammasatertenfu.
  j1                                               Sehubungan  denganitu pemilik lazirnnyaakan
                    l<                             memiryam daripada institusi-institusi
  t                    I       .,-
                                   o/,             sepertibank,syarikat-syarikatker.vangan lain-
ba{x                ban, l
                              \ ,-,,,              lain sumber.
                                                 ) h\ , f nr : J
                                  ' ,*u^trtl -,^ _
                                             I Insfirusikervangan juga fumt memberikan
                                            6a,i.kemudahan pinjamankepadaKontraktordan
                                               Pembekal.  Perananinstitr,rsi
                                               pentingdalampembiayaan     sesuatu

                                            o Bentuk-bentukkemuclahan

                                                  Bentuk-benfukkemudahan   pembiayaan  yang
                                                  ditawarkanoleh institusiker,vangan

                                                   i.   Pembiayaan  akhir.
                                                   ii.  Overdraf.
                                                  iii.  Pemfaktoran.
                                                  iv.   Pajakan.
                                                  v.    Pendiskaunan  Terhad.
                                                  vi.   PinjamanBersyarat.
                                                  vii. Kredit Pusingan.
                                                  viii. Pendiskaunanbil.
                                                  ix.   PersetujuanJurubank.
                                                  x.    Surat Jaminan.
                                                  xi.   Dll.

                       C 5011

 Kriteria-kriteria projek untuk pembiayaan.

 Antara kriteria-kriteriaprojek yang boleh
 dipertimban gkan oleh institusi kewanganunfuk
 pembiayaan  terhadapsatu-satu   projek ialah:

 i.    Aspek Lokasi.

      Lokasi cadangan    projekperlulah
      bersesuaian denganpembangunan     kawasan
      sekitar.Jika lokasiprojek perumahan yang
      ingin dibina itu perlulahberhampiran
      dengantempatkerja,kemudahun     u-u* serta
      mudahdihubungi.Selaindari iru projek
      yang akandibinaifu mestilahberpotensi  dari
      segi ekonomi dan dapatmeningkatkan   lagi
      kitaranekonon-ri  sediaadadan berdaya

ii.   Aspek ekonomi.

      Permintaan danpenawaran   semasa  di
      kawasancadangan   projek pembangunan
      merupakancriteriautamayans akan
      dipertimbangkan barvahorf.t ekonomi
      keranafaktor permintaandan penawaran ini
      akanmempengaruhi   secara langsung
      kejayaansesuatu cadangan  projek.

      Projekyang akandilaksanakan
      Kawasanyang dijangkakanterdapatlebihan

                       C 5011PENGURUSAN

lll.   Aspek Harga Jualan

       Cadangan   hargajualan haruslah  munasabah
       berdasarkan kepadajenis pembangunan     clan
       lokasi projek berkenaan.Nilai pasaran
       hartanahmestilahsebanding    dengan  yang
       terdpatdengannilai di sekitarkawasan
       pembangunan    yang pafut dipertimbangkan
       dalammenentukan    cadangan  harga jualan.

                                 C 5011PENG{IRUSANPEMBINAAN


      .   Peranan sertaperhubungan.

          Buruh ialah orangyang menyumbangkan    kerjanya
          bagi pihak Pemajumelalui Konkaktor samada
          secaramahir, separamahir atauburuh am atau
          bumh kasar.mengikut bidangkerja terfenfir.

          Buruh secara kontrak biasanyaterbahagikepada
          tiga (3), mengikutkategorikemahiraniaitu:

          i. Tukang

            .   Buruh IVIahir.


                 BuruhMahir ini ialah orangyang mahir
                 melaksanakan  sesuatubidangpekerjaan
                 dari segiperfukanganseperti fukang
                 kayu,Tukang  Besi, penurapBata, Tukang
                 Lepa,Tukangpaip dansebagainya.

                Tukangakan dibayarupahmengikut kaclar
                harianataujam sepertiyang dijelaskan
                sebelum ini.IJpah yang mahal akan dibayar
                kepadatukang mengikut hargapasaran
                semasa juga jenis kerumitankerja.

            .    Buruh SeparaNlahir.

                Buruh Separa Mahir ialahpekerjayang
                bekerjasebagai pembantu kepacla  Tukang.
                Biasanya pekerjaseparuh mahir cliperlukan
                apabilaterdapatbanyakkerja_keqa  yang
                samaperlu dilaksanakan oleh Tukang.
                Kadarupahnyalebih rendahberbanclins

                    C 5011PENGTIRUSAN

ii. Buruh am.

  Dikenalijuga sebagaiburuh kasar.Buruh ini
  merupakan buruh yang kurang mahir
  melakukansesuatu  kerja mengikut yang
  diarahkanoleh tukangatauburuh separuh

  Buruh am ini diperlukanditapak bina Lrntuk
  melakukankerja-kerja seperti

   .   Mengangkutbahanbinaan.
   .   Membuangbahan-bahan.
   .   Membersihkantapakbina.

  Bayaranuntuk buruh am ini lebih murah
           dengan buruh mahir dan separa

iii. Kepala (Foreman/Supervi

  Ditapakbina juga dikenalisebagaigeng
  kerja.Kepalaialahseseorang yang mengetuai
  sekumpulanpekerja bagi:

  o Tukang
  o Separuhrnahir
  . Buruh kasar.

  Kepalaperlu bertanggungjar,vab
  mengendali dan menyeliakerja-kerjadi tapak
  pembinaan bagi pihak Kontraktor.
  Biasanyaorangyangberpengalaman    dalam
  bidangterlenfutermasuklah mengurusan  bahan
  binaan,alatan logi sertabumh.

  Kepalaakandibayarmengikutgaji bulanariclarr
  diperuntukan dalamkos pengurllsan
              di                   syarikat

       c 5 0 11                                       PERAN ANG DANKAWALANPEAABI
                                                          C   AN              NAAN


PE R A N A N E N 6 U R U s R OJE K
            P            P

           Pengurus   projek bertonggungjowob      mengowol   keseluruhonprojek.Bogiprojek
 yang cukup besor untuk membenorkonposukon penguruson                   sepenuh moso ,dio
 mungkindibontu oleh juruukur bohon berhubung dengonkowolonkeewongon                     don
 penyelrakeria,berhubung dengankemojuontopok don kowolonmutu.pokor mungkin
jugo diperlukonuntuk mengowol            pemosongon  elektrik otou kelengkaponmekonik  yang
           Sering koli pengurusprojek perlu mengowoldengon pujukon,bukon             dengon
menggunokon        kuosonyo  secoro lonsung.ini    odolh solohsotu olosonuntuk membentuk
posukonpenguruson          yong ohlinyo sentioso beruboh podo setiap peringkot projek
,sebogai    contoh ,semoso     dolomparingkotroko bentuk ,paroorkitek yong ditugoskon
untuk projek tarsebut munkin dori KementerranKerlo Royo,monokolo                   pengurus
p r o l o k p ul o d o ri K e me n te ri o n Kesihaton.sekir onyopenghosilonlukison tidak
menepotijoduol, pengurus         projek tidok berhok mengorohKementerion        Kerjo Royo
memPeruntukkonsumber tombohon untuk mempercepot penghosilon lukison
 tersebut.Apoyong boleh don perlu dilokukonodoloh dengonmemoporkon                    keson
doripodo kelewotqn ini terhodop keseluruhon projek.sekironyoorkitek teloh
melibotkondiri dalom peroncongon              projek ,sebagaisebohogion  doripodo posukon
toklimot don rekq bentuk,peluong          untuk gerakbolosyongboikodoloh   lebih tinggi.

Tokrif pengowolon:

      pencopoion      sebenor,oktiviti-oktiviti don pencopoion     terancang otou piawoi
      Ya n g d i te to p ko n o d o l o h somo. Tindokon pem betulonper lu dilokukonji k o
      terdopot sisihonontoro keduonya.
   i' Soiu set oturcoro untuk membondingkon            ontoro pencopoion  sesuotuqktiviti
      denganperoncongon          osol.

Sisfem kowolonyongboik hendoklqh          mempunyoi objektif utomo:
        o. memostikon       perloksonoon    peroncongon
        b. Mengeson       seborong     perubohon.
        c " Me n i l o ike so np e ru b ohon m emper bqiki em ohon.
                                           don           ker

                                                                                     I I 1l
       c 50 11                                     PERANCANGAN KAWAUN PEMBINAAN

I. Kowolonsebelum tindokon(pro-kowolon).
                                      - memostikon bohowo sebelum sesuotu
                                    termosuksumbermonusio    perlu diombil
2. Kowolonberpondu- mengeson   lencongondori setengah-setengahpiowoiotou
   motlomot membolehkon    pembetulondibuotsebelumtindokon disempurnqkon.
3. Kowolqn selepostindokan- mengukurhosil-hosil  dori tindokon yang teloh




Mestiloh merongkumi       perkoro-perkoro
  o. lukison   don penentuon.
  b . At u r co rod o nj o d u o l .
  c. Koedoh     kerjo.
  d. Orgonisosi     penguruson.
  e. Perhubungon.

Lukisandon penentuon

Afurcorq don joduol

        c 50 11                                       PERAN AN GAN DAN KAW Ai-/'N PEInIBI AAN
                                                           C                            N


Orgonisosi     penguruson
Mesti terdiri dori kokitongon yong berkeloyakkon don keupoyoonmeloksonqkon
f ungsi-f ungsiberi kut :
    o " p e n j o d u o l od o n o n o l i si so duol.
    b" Belonjowon.
    c . An ol i si s re sto sike rj o .
    d. Pentodbiron         kontrok.
    e. Penguruson         pembinoon.

P e r h u b u ng o n

Kesinrpulonnyo,       kowolon  diperlukon     kerono:
1. Memberiperhotionkep.odo               penyimpongan yangkeforo.
2. Memberiperbondingqn              yong sebenar  don bermokno.
3" Memberimoklumot            jenis tindokonyongperlu don siopoyangber'tonggungjowob.
4 . R i n g k o s o n mu d o hd i fo h o mi .

  1. Corto bor.
  2. Corogont.

Penivedioon    Corto Gont
  1. Menyediokon             senoroioktiviti projek.
  Z. Menganggqrkon             jongkomoso      don sumber.
  3 . A k t i v i ti d i l o mb o n gme l o l uibqr m endotor yong dilukis mengikutskolo don
      d i p l otko n .

      c 5011                                         PERANCANGAN KAWALANPEIABI
                                                               DAN           NAAN

Kebonyokon   projek, wolou bogoimono     kompleks sekolipun,bermulq dengan
digomborkon  meloluisebuohcorto bor. Woloupun     teknik yong lebih sofistikoted
perluuntukperoncongan    Ferperinci,
                                   keputuson-keputuson ditunjukkon
                                                        sering            dolom
bentukcorto bor.
 Prinsip-prinsippenggunoon  CorFaodqloh sepertiberikut;
   o. Menyediokon senoroi
                   sotu        oktivitiprojek.
   b. Mengonggorkon donsumber
                      mosq             yangdiperlukonuntuksetiopoktiviti.
   c. Setiop oktivitidilombongkon        bor
                                 melolui mendotor     yongdilukis menurut  skola
   d. Aktiviti-oktivitidiplotkon
                               podocorto dengon  skolomoso  mendotor dengon  itu
      dopot dilihot bilo oktiviti-qktivitiitu dironconskon  untuk bermulodqn

Kelebihon Corto Bor
  o. Teknik ini sangotmudohsomoodo untuk menyediokonnyo untuk membocq otou
     don memohominyo.            Perkoro ini songot penting kerono semuq pihok dopot
     menggunokonnyo          dengon mudoh. Perlu disedori bqhowo romoi kokitongon
     topok yong tidok mempunyoi            keloyokon otou lotihon khususdolompenguruson
  b. Gomboron       tentong keseluruhon       projek dopot ditunjukkonsecoro menyuluruh
     di peringkotowolprojek.
  c. Kemojuon       kerjo sesuotu elemen      boleh ditondokondengonmudohdibowohbor
     o s o l. Ol e h i tu p e n g o w o son
                                          boleh dilokukondon difohomi oleh sem uo p i hok
  d. Teknik ini boleh dijodikonososdqlom mengiraniloi kerjo terhodop mqsodon
     seterusnyodigunokon           dolompenyedioon   unjurontunoi..

           Corto Bor

  o ) H u b u n g ko i td o n p e rg o n tungon
                                              ontor o oktiviti- oktiviti binoon tidok oopoT
      ditunjukkon.fni bermqknqcorto bor tidok dopot menunjukkon               uruton ontoro
      oktiviti ioitu mqnq yang terdqhulu,monoyong boleh dilokukonserentok don
      monoyang kemudion.           Perkoroini pentingbogi projek yong besor don kompleks
      yongmelibotkon         bonyokoktiviti.
   c 5 0 11                                       PERANC
                                                       ANGANDANKAWALANPE/ABI AAN

b) Kesonkelewqtonsesuotu oktiviti terhodop keseluruhonprojek tidok dopot
   ditunjukkon dengan nyoto. fni kerqno tiodo sotu rongkoion yang dopot
   menghubungkon semuooktiviti.

c) Seteloh semokondibuot, perubohonyong dimosukkonke dolom Cortq Bon
   tidok dopot dilihot kesonnyoterhodop keseluruhonprojek seperti keson
   kelewotqn otos.
Bogi mengqtosikelemohon  diotos corto bor berkoit teloh diperkenolkon.nomun
         teknik corto bqr berkoit tidok begitu digemoridon jorong digunokon.
Seboliknyokoedoh loluongenling merupokonteknik yong semokindigemori di
somping corto bor.
                    Teloh ditunjukkon bohowo corto bor merupokonsotu doripodo
koedoh penjoduolondon kowolon pembinoonprojek yang poling tuo. Tetopi
semosostruktur modendironcong,                 hod yong besor dikenokondiatos koedoh ini.
Hod ini timbul kerono peroncang             mengalomi kesukoron dolommenentukon  susunon
nktiviti. Operosiyong dipilih biosonya           mempunyoi skop yong besor don keputuson
rnemilih     oktiviti yong monohorus di-loduolkan       dohuluodolohsukor keronobonyok
berloku pertindihonmosoperloksonoon.               Seterusnyohubungon yong ujud diontorq
o p e r o s i -o p e ro si d o k d o p o t ditunjukkon dengon jitu woloupunio m un gk i n
diketohuisepenuhnyo            oleh peroncong.
             Woloupun corto bor mempunyoikekurongon,io teloh diterimq
secoro meluos kerono senong difqhomi oleh hompir semuo orong. Corto ini
menunjukkon  roncongon progrom di dqlom sotu formot yong podot don senong
digunokon dolom roncongon    don kemqjuonprojek. Keboikon-keboikon tidok
seharusnyo diketepikon. Seboliknyo ospek parhubungon corto ini harus
dipertingkotkonlogi meloluipenggunoon
                                    peroncongqn rongkoion.

      LqluonKritikol (CPM)
Satu teknik yong digunokonbogi membolehkon        sesuotu projek dironcongdon
dikqwolmeloluikefohomon     yong lebih boik terhodop keseluruhon projek. Koedoh
l-qluonKritikol berdosorkonrongkoion    lojik yang merupokon gombor rojoh yong
ditukis dengan  menggunokqn  simboltertentu. Rongkoion lojik pulo ioloh rongkoion
oktiviti-oktiviti bogi peloksonoonprojek yong disusunmengikuturutonyong lojik.
K q e d o h i me l i b o tko n tu te k nik yong lebih r umit don sukor untuk disediok on.
Kqedqh    tersebut biosonyo     digunokon    sebogoioturcoro indukyong digunokon   bogi
me.gowosi     kemojuon    keseluruhon   projek.

                                                                                  5 I rl
    c 5 011                                        PERANC
                                                        ANGANDANKAWALANPEIABI AAN

Keseluruhon  rongkoionboleh dipecahkonkepodo beberapo bohogionkerjo don
dinyotokon dolom bentuk corto bqr bogi memudohkonkokitongon topok.
Keistimewoonnyq     terletok podo kebolehonnyo
                                             untuk menunjukkqnkeseluruhon
oktivifi dolom sotu rongkoionsohojo. fni bermokno hubungkoit ontoro semuo
oktiviti dopot dilihot dengannyoto.
cr. Simbolyong Digunokqn

               i . A n o kP o n o h

   Menunjukkon oktiviti yong memerlukon mosodon sumber-sumber Anok
ponoh dilukis
            tidqk mengikut skolo.Kepoloonokponohmenunjukkon
                                                          okhir sesuotu
oktiviti monokolo
                nomqoktiviti diletokkon
              i i . B u l o to n e ci l


          moso                                     m ulookhir

Si m b o l b u l o to n ke ci l me n u n jukkon istiwo ioitu titik m oso otou per silongon
sesuotuoktiviti itu bermulo            qtou berokhir. Peristiwodi kepoloonok ponohmesti
lebih besqr doripodo nombor peristiwo ekor onok ponoh ioitu mosoterowol don


Simbol onokponohterputus-putusmenunjukkon
                                        oktiviti domi(dummy). Aktiviti
domi digunokon
             honyountuk memqstikonsupoyotidok odo duo olternotif yong
memPunyoi nomborperistiwoyongsomodi keduo-duokepolo don ekor. Aktiviti

                                                                                  6 l ll
        c 5 0 11                                      PERANCANGAN KAWALANPEIABI AAN
                                                                DAN           N

                      moso don oktiviti kerono io odoloh simbol perhubungon
   domi tidok mempunyoi


   '    Aktiviti - Sotu-sotukerjo yong melibotkonsumber don moso. Contohnyo ioloh
        mengkonkrit, pemosongqn    tetulong don penggolion. diwokili oleh onok
   .    Peristiwo- Nodonyang menunjukkon   permuloonotou okhir sesuotuqktiviti.
   '    Anak Panoh- Mewokiliokfiviti don orohnyosentiosomenuju ke nodonyong
        terlebih besor.Ponjong         onokponoh    fidok merujuk kapoda  moso.
   .                    (D)
        Jongkomoso - Mosoyongdiperluuntuk menyiopkon                    sesuotuoktiviti.
   '    Tempoh- Moso keseluruhqn             untuk menyiopkon   sesuoiuprojek.
   .    M o somu l oo w o l (E S T ) - Moso poling     owoloktiviti boleh dim ulokon.
                                                                                    Diket ohui
        dengon   melokukon       "kiroonke hodopon".    Moso muloowol Aktiviti B = MosoMulo
        A w o l(A kti vi ti A ) + Jo n g ko m oso
                                                ( Aktiviti A) .
   .    Mososiopowol(EFT) - Mosopolingowaloktiviti boleh ditqmqtkon.
   '    &\ o s o l oo kh i r (L S T )- Mosopoling
               mu                                     lewotoktiviti bolehdimulokon.
   .    M o sosi o po kh i r (L F T )- Mo sopoling   lewqtoktiviti bolehditom oikon.
   .    Apungon    (Floot) - Aktiviti kritikol yongmempunyoi        lebihonmcso.
   .    Loluon  kritikol - rongkoion      oktiviti yongmesti dimulokon   seboiksohojooktiviti
   "    Aktiviti Domi (Dummy)- Aktiviti khoyolonyong dilukis untuk i'nengekolkon
        logik.Domitidqk mempunyoi            mosodon dilukisdengon    gorisonputus-putus.

   Annlisodon Pengiraon
      Ap o b i l ote mp o h te l o h d i m osukkon"loluonkr itikol" okon dopot dikir o i oi tu
          oktiviti yong menentukon
   ur'u.ton                                  tempoh kerjo keseluruhqn. Seborongkelewoton
   dqlommeloksonokon        oktiviti dolom loluonkritikol okon mengokibotkon    kelewoton
   yong somo bogi seluruh karjo. Anolisis ini jugo mengenalposti selomo mono
   sesuotu oktiviti itu boleh ditongguhkonsebelum ia menyebobkon                kelewoton
   keseluruhon     dolommenyiopkon         kerjo.
   Ierdopot tigo bohogion
       o) Kiroon ke depon yang menentukon      moso poling owol untuk memulokon
          m e n yi o p kose ti o po kti vi ti.
       b) Kiroon ke belokongyang menentukon      moso terokhir untuk memulokondon
          manyiopkon     setiop oktiviti.

     c 50 11                                           PERANCANGAN KAWALAN
                                                                 DAN           N
                                                                          PEIABI AAN

    c) Pengiroon"opung" ioitu moso kelewoton yang dibenarkon untuk setiap
       oktiviti sebelumoktiviti lointerjejos.
             Apungonbebos ioloh moso sesuotu oktiviti boleh diponjongkon
          \ mengesoni oktiviti-oktiviti seleposnyo.
       k \ npungon   bebos =-         Moso siop owol - Moso mulo owol
           )*-"*-                     Jonqkomoso
                                                          l --' .-l   - Jcr:.ri r,-,
                                            i   Ft r                                 ' r.   )
              Apungon bersqndor
                    tok         iolqhmososesuotu oktiviti diponjongkon
              mengesani       oktiviti somq
                      mono-mono            odosebelumqtouseleposnyo.

              Apungon bersondor Moso siop owol -
                    tok                                                  Moso mulo lewot
  Prosedur        Koedoh
         Mengonoliso        Kritikol
  o . Senoroikqn    semuooktiviti don jongkomoso         setiopoktiviti,
  b. T e n tu ko n fu ru to n o kti vi ti ioitu oktiviti didahului,qktiviti ber ikutnyo don
     o k t i vi ti se ra n to k.
  c. Lukisrongkoion oktiviti denganmeletokkonoktiviti don peristiwomengikut
          Gunokon Domi jiko perluuntukmengekolkonlogik.
  d. Letokkonnombor nodondengonperistiwodengonmemostikon          nombordi
     hujung onokponoh lebihbesordoripadodipongkolnyo.
  e. Lqkukon kiroqnke hodopon kiroonke belokong
                               don                  untukmendopotkon moso
     muloawol, mosotomot okhirdontempoh  projek.
  t. Tqndokon LqluonKritikol.
  g. Sediokon       (LihotJoduol
              Joduol.             3)
  h. Lokukon penjoduolonsumber.
  i. Dopotkon maso optimum.
  j Bino CortoBor.

Syorot-syorot    kritikol
  o. Sebelumsotu oktiviti dimulokon,
                                         oktiviti yang tendohulumesti
  b. Anokponoh
             honyo        rongkoion
                 menunjukkon      logik.
  c. Nombor       tidokbolehberulong dolom
                                   di     soturongkoion.
  d. Penyombungon peristiwo
              duo         tidokbolehdigunokon     sotuoktiviti.

                                                                                                t t i ll
            c 50 11                                            PERANCANGAN KAWAUN PEMBINAAN

          e. Rongkoion honyo boleh bermulo dengonsotu peristiwa don berokhir dengan

     1.    Hubungkoitontoro semuooktiviti dopot dilihot dengon1elos.Aktiviti-oktiviti
           yang pentingotou kritikol ditunjukkonoleh loluonkritikol. Dengon tumpuon
           yong lebih dopot diberikon kepodooktiviti-oktiviti kritikol bagi mengelokkon
           kelewoton penyiopon projek.
     2.    Sekiranyo berloku kelewqton yong tidok dopot dielokkon, rongkoiony-ong
           terlibot dopof disemok don diuboh suoi dengan mudoh. Jikolou terdopot
           o k t i v i ti kri ti ko lp o d o ro n g ko i on sebut, jongkomoso
                                                          ter                 oktiviti kr itikol ter sebut
           p e r l u d i p e n d e kko nP e ru b o hon m ungkinm elibotkonkos yong lebih tin ggi
                                             .             itu
           keronojumloh pekerla don loji yongdiperlukqn                jugo befomboh.

     3.    Kemojuon                         dopot diketohui don diowosidengonlebih
                    prolek secoro keseluruhan
           mudoh.Kesonperubohonsesuotuaktiviti terhodop keseluruhon   projek dopot
           dikesonkeronosemuooktiviti mempunyoihubungkait dolomsotu rongkoion.

{-   Kelemohon
     l.  Teknik rongkoionogok sukor untuk memohominyo.  Lotihon tertentu diperlukon
         don ini tidok dopot diberikon dolsm syorikot kontrokto? yang kecil don
     ?" Romoikokiiongontopok yong tidok dopot menggunokon     koedoh ini. Oleh itu,
         teknik rongkoion tersebut perlu ditukor bentuk kepodo corta bor bogi
         mengotosi mosolqhtersebuf.
     3. Teknik ini honyo sesuoi untuk projek-projek yong besor don kompleks.Bogi
                                         Corto Bor lebih sesuai.
         projek-projekkecil don sederhono,

     Kowolon  Kos
)t   Tokrif :
     - Horpol Singh, 1981 - Sotu proses kowolon                    bogi sesuotu
                                               terhodop perbelonjoon
       projek binoon podo semuq peringkot pembinoon  bermulo doripodo peringkot
       permuloon, rekobentuk pembongunonhinggoloh projek diloksonokon don
          pemboyorqn       okhir dibuot.
     -    Horold Byrne,L9B4- Aktiviti untuk mengekolkon              jumloh keseluruhon pro.lek
          s u p o y o d o k me l e b i hjiu ml o hyongteloh diper untukkon.

           c 50 11                                          PERANCANGAN KAWALANPEMBINAAN

     Objektif Kowolon
      l. mengenolposti mqno-mono   bohogiondolqm kerjo yong didopoti tidok beroperosi
         otou dilqkukondengon  ekonomi.
      2. Memberi moklumbolos kepodo juruukur bohon untuk membolehkonnyo
         menganggor  horgo unit kos bogi projek seterusnyodengonlebih tepot logi.
      3. Merekodkonoktiviti-oktiviti kerjo denganlebih kemqs supoyo mudoh untuk
         melokukon opo-opo tuntuton ferutomo dolomkerjo-kerjo perubohon.
      4. Menyediokon  sotu 'commonplotform' di mono kokitangonpejobot don topok
         dopot bekerjosomq  keo roh mencopoi  soiu objektif.

 7" Kawalankos sehorusnyo bertujuon untuk memostikon kos okhir prolek tidok
    melebihi belonjowon.Kemungkinon                     yong poling besor dolom mempengoruhi      kos
    projek okhir berodo podo peringkot tqklimot don peringkot reka bentuk.
    Pemeriksoon             kos secqra terotur perlu diloksqnokon        semosoproses reko bentuk.
    Bontuon       yong boik dolom kerjo ini ioloh pelonkos, berdqsorkon           onggaron kos kosor,
   yong memoporkon                  mutu, kuontiti don horgounit bogi unsunkos utamoseperti kerjo
   t o n o h , l o n to i d o n b u mb u n g .A pobilo r eko bentuk dikem bongkon      dengon lebi h
   t e r p e r i n c i , re ko b e n tu k se ti q p unsur boleh disemokogor ber odo dolom r ongk o
    lingkungon         kerjo yongditentukondolompelonkos.
               Bontuon yang penting untuk kowolon kos ioloh romolon kos okhir, yong
   sentiusodisemokbogi monggomborkon                      keodoon  semosoprogek.Sekironyoterdapot
   penyimpongon                ontoro romalon ini denganbelonjowonprojek, tindokcn membetul
   p e r l ud i o m b i l .
               Bontuqnyong boik untuk mengemaskinikon               romolonkos ioloh "diori kos" bogi
   setiop okoun, yang mengombil                   kiro segoloperistiwo yong okon mempengoruhi     kos
   o k h i r . D i o r i i n i p e rl u me mo su kkomoklumot
                                                     n        seper ti -
         D Semokon yongdisediokon
                                kos                    ketiko peringkatreko bentuk;
         tr Kontrok dengan               perunding, kontrqktor,pembekol   don orgonisosi
         tr Arohonpindoon                don pindoon yong diromol;
         n Jongkoon perubohonkos yong disebqbkonoleh gongguon                        dolom kemojuon
               kerjo yongteloh dironcong;
         a Perbezaanontqro kuontiti sebenor dengon kuontiti yong dinyotokon serto
              turun noik horgo.

                                                                                             r0/ 11
                      c 5011                                                                                                                       PERAN
                                                                                                                                                       CANGAN               NAAN

Kostetop/ TidokLongsung

Kowolonmutu dolom projek pembinoon  sehorusnyobertujuon untuk memenuhi
        don kehendok
keperluon            klien yong dinyotokon.
                                          Kowolonmutu perlu diloksonokon
podosemuo         projek,sepertiyongditunjukkon
          peringkot                           dibowoh.

                Peringkat                                                                                                                         Peringkat              Peringkat
                takiimat                                                                                                                          Pembinazrn             'fugasan

                 Membuatkeputusan                                                   Prakelayak-an                                                 Kawalan            Kawalan
                                                                                    untuk                                                         dalam              bangunan
                                                                                                                                                  memenuhi           sedangdi
                 secara                                                                                                                           syarat             gunakan
                                                                                    tidak lavak

                       StesenKawalan                                                                                                        Pemeriksaan             Ujian Khas

                                                                                                         ,!,      . a.l c           \       r i \..1r

                                                                                                                . -.   , ri , : !       l

                                                         i .-c   l;r    r. I
                                                                                          .     t,-                                         \'"
                                                    lv                                                  \t!r..:r'g.r

                                                                                                                                                                                     ol '

    l, . r              ! . i r - - - . !"- "

                                                                               '        l: r
                                                                            r      l\          \t

    \ . iiJ {    i'

                                                                                                                                                                                      l     ! . .,       -   ,i   l

                                                                                                                                                                                      , , i t , \'.."
                                                                                                                                                                                           1l / ll,
                                                                                                                                                    f'   ,   * ""

2.1       SistemJawatankuasa

       Dalam pengurusan satuprojek pembinaan, melibatkanbeberapa
                                             ia                    individu bersatu
tenagake arahmencapai  matlamatprojek. Mereka ini akanbekerjasamadalam satupasukan
yang dikenali sebagai            Tujuanjawatankuasa  ditubuhkanialah:

          1      Bagi mengagih-agihkan   kerja diantarapelbagaiahli pasukan,pengawasan   dan
                 pengawalan  kemajuanperlaksanaan    projek.
          2      Bagi menyelesaikan  masalahyang berbangkitdan membuatkeputusan
          3      Menyampaikankeputusanyang telah diambil dalam kumpulan lain atau
                 maklumatyang relevankepadaprojek, kepadapihak-pihakyang ingin
          4      Pengutipan maklumatdan idea.
          5      Menguji dan mengesahkan    keputusan.
          6      Penyelarasan perhubungan
                               dan              diantarapelbagaibidangprojek.
          7      Meningkatkan   komitmen dan   penglibatanahli-ahlinyadalamprosesperancangan
                 dan membuatkeputusan.
          8      Membolehkan    perundingan  dan penyelesaiankonflik yang wujud di antara
                 pelbagaipihak dan atauperingkatdidalamprojek.
          9      Bagi tujuan inkues atau penyelidikan perkara-perkarayang telah berlaku.

2.1.1 Jawatankuasa

      *   Gabunganpihak-pihak tertentu dan bukannyasatupasukan.
      *   Setiapahli ingin mencapai  kepuasan   objektif yangberbeza-beza   antarasatusamalain.
      *   Ini dapatdiatasi dengankeupayaanuntuk menterjemahdan         memahamiorganisasisatu-
          satu j awatankuasa ek.
      'i' Ahli-ahli dalam jawatankuasaprojek selalunyadipinjamkan dari bahagian-bahagian        atau
          organisasi-organisasi berlainan.
      * Kebarangkalianuntuk kesemuaahli bertemubagi sesuatu           projek yang baru selain dari
          projek asaladalahamattipis.
      * Pemilihan ahli jawatankuasadari segi kaedahdan syaratadalahberbeza-beza          mengikut
          keperluan satu-satu projek.
      'i' Perlu mencapaimatlamatpenubuhannyayangakankelak menjadi aktiviti jawatankuasa
      .:. Pada asasnya  terdapatdua cirri aktiviti jawatankuasa  projek:
          i.      Tugas- berkait denganobjektif keseluruhan     bagi projek.
          ii.     Proses- carapasukanitu berfungsi sepertimembuatkeputusan,        pemberian
                  tanggungiawab,  perlaksanaan   aktiviti dan caraahli berhubungsesamasendiri.
    2.1.2 Jawatankuasa

       {. Semuaorangyang bekerjabagi sesuatu   projek yang dipertanggungjawabkan
          secaralangsungatautidak langsungkepadapengurus    projek.
       {. Tidak termasukpenguruskananbagi pengurus    projek, samada daripadaorganisasi
          dalamanklien ataupunseorang perundingbebas.
       i. Menyiapkan sesuatufugasankhusus (projek pembinaan)dan kemudian mereka akan
       {. Dilantik untuk menganggotaiprojek tersebutkeranakemahirandan pengetahuankhusus
          yang dia miliki.

    2.1.3 Jarvatankuasa

          *   Ahli jawatankuasapenyelaraskontraktor boleh dikelompokkan seperti berikut:
              i.      Pakar teknologi - mempunyai kelayakandan pengalaman kepakaranyang
                      diperlukanditapakbina (1%)
              ii.     Pekerjamahir - tukang-tukangdanjuruteknik (29%)
              iii.    Pekerja separuhmahir dan tidak mahir (70%)

    2.2                      Keria
              Struktur Pasukan

           Pasukan kerja yang efektif ialah pasukanyang mencapai  kecemerlangan
    yang diberikandan dapatmelepasimasalah     yang timbul. Kejayaansesuatu
    diukur melalui:
       i. Mencapaiobjektif yang telah dipersetujui.
       ii. Perlaksanaanny^diselesaikanpadatempohyang ditetapkan.
       iii. Perlaksanaannya
                          mengikutbelanjawan  yang telah dipersetujui.

t   Perananahli pasukanamat penting dalam menyumbangkeberkesanan            pasukanprojek. Antara
    perananahli pasukanialah:
       i. Sebagaikoordinator iaitu berkebolehan      bertindak sebagaiketua dan bersikap tenang,
            matang dan pandai menarik sokonganahli.
       ii. Sebagai   pelaksana iaitu menjadi tenaga  kerja kepadapasukannya bersikappraktikal,
            logik, setiasertarajin.
       iii. Sebagai  penyemaiiaitu banyakidea,imaginasi,     kreatif dantidak ortodoks.
       iv. Sebagaipenyiasatsumber iaitu menjiwai dan penghubungsertaberkomunikasi.
       v. Sebagaipengasahiaitu dinamik, positif dan bersemangat       untuk mendapatkan     hasil dan
       vi. Sebagaipenilai pengawasan     iaitu bersikapsederhana,  analitikal dan praktikal.
       vii. Sebagai  ahii pasukaniaitu kaunselor, sosialdan harmoni.
   viii.   Sebagai                        denganteliti, tertib danjarang melakukan
                  penyiapiaitu melaksanakan

      yang seimbang
Pasukan            perlu ada sifat-sifatyangberikut:

   i.   Menyiasat: tentukankerja yang dibuat, tetapkansasaran,   menetapkanparameter,
        mengutip maklumat relevan dan menganalisanya    dan bukan mengecamukkannya.
   ii. Meninjau: skopmaklumat,mencaripendekatan        alternatif,menanyaianggapan-anggapan.
   iii. Menentu: mencapaihalatuju dan kemuktamadantujuan dan mewujudkan ketegasandan
   iv. Mengemuka:mengelaskan       isu-isu,meletakkan keutamaan kepentingan,
                                                                  dan              membuat
        penilaianbagi keperluansegera   dan menerimasituasisukar.
   v. Menentukan:mewujudkan rasapengaturan,memulakantindakan mengikut keutamaan
        dan kepentingandan kebolehlenturandalam tugasan.
   vi. Menjangka:melihatke hadapan,      memandang  jauh, melihatsebabakibat,menilai
        kepraktikalnya, memprogram    secaraberkaedah.
   vii. Menyampai: mewujudkan hubungan dan kesefahaman         diantarc y angberkenaan,
        memanfaat   dan berkongsiaktiviti-aktiviti.
  viii. Mengenali:mengaturkerja dan orangdengansegera       apabiladiperlukan,mengawalmasa
        tindakan,memotivasimanusiaterutama      yang berkaitan'menentukan'dan 'menjangkai'.
  ix. Dinamis: mengambilinisiati{ usahadan dorongan.
  x. Kebolehsuaian:     keupayaan  untuk menuruti,menerimadanbukan melawannya.
  xi. Merigenalpasti:   bersediauntuk bersama-sama   terlibat secara menyeluruhdidalam
        memikirkan sesuatu  kerja dan keupayaanmendorongorang lain sama-sama

Mekanismeuntuk membinapencapaian   pasukan ialah:
  i. Menetapkansatutujuan penting dan yang memerlukantindakan segera.
  ii. Memilih ahli berdasarkankemahirandan potensi kemahirandan bukannyaberdasarkan
  iii. Memberikan perhatiansepenuhnya kepadamesyuaratpertamadan tindakan yang harus
  iv. Menetapkandenganjelas beberapa  peraturankepadaahli.
  v. Menetapkandan menghentikanbeberapa    tugas dan matlamatyang berorientasikan
    vi. Sentiasamemberikancabarankepadakumpulan ataupasukandenganfakta-fakta dan
         maklumat terkini.
    vii. Menghabiskan  banyakmasabersama-sama.
    viii.      Mengeksploitasitenagadaripada          yangpositif, salingmengenalidan

2.3       Kepentingan maklumat-maklumatberikut dalam pengurusanpembinaan:

2.3.1 Dokumen Kontrak

      *   Dokumen kontrak biasanya    disediakanoleh pejabatyang mengeluarkan   tenderdan
          mempelawa    tender.
      * Secara   amnyaia mengandungi                          dan
                                         borang-borang,lukisan dokumen-dokumen         yang sama
          dengandokumenmeja tender.
      * Dokumen kontrak hendaklahdisediakanawal untuk memastikanianya siap untuk
          ditandatanganisecepat  mungkin setelahSurat Setujuterimatender dikeluarkan.
      .i. Pegawaiyang diberi kuasaunfuk menandatangani    dokumenkontrak dan kontraktor akan
          menandatangani    semuadokumen seperti  perkara-perkaraperjanjian, spesifikasi,senarai
          kuantiti dan lukisan-lukisankontrak.
      * Dokumen kontrak hendaklahmengandungidokumen tender dan dokumen-dokumenlain
          yang disusunmengikut aturanberikut:

             a) Kontrak berasaskan senaraikuantiti:
                i.    Perkara-perkara perjanjian dan syarat-syarat
                                                                 kontrak dan lampiran yang
                ii.   Borangtender
                iii.   Suratsetujuterimatender.
                iv.    Suratpindaankepadadan dari kontraklor ataupengesahan    tender asal atau
                       sesuafuyang memberi kesanke ataskontrak.
                v.     Spesifikasi
                vi.    Senaraikuantiti.
                vii.   Lukisan.

             b) Kontrak berasaskanlukisandan spesifikasi:
                i.    Perkara-perkara perjanjian dan syarat-syarat
                                                                 kontrak dan lampiran yang
                ii.   Borangtender
                iii.  Suratsetujuterima tender.
                iv.   Suratpindaankepadadan dari kontraklor ataupengesahan     tender asal atau
                      sesuatuyang memberi kesanke ataskontrak.
                v.    Spesifikasi
                vi.   Ringkasantender
                vii.  Jadualkadarharga
                viii. Lukisan.
     .i. Pembatalanmana-manabahagiandalam dokumen kontrak hendaklahdinyatakan dengan
     *    Dokumen kontrak mestilah mengandungidokumen-dokumen     yang samadengan
          dokumentenderdan dokumenmeja tender.
     *    Segalapindaanyang telah dibuat dalam dokumen tender yang diserahkankepada
          petender danJatatdokumen meja tender,mestilah dimasukkandalam dokumen kontrak.

2.3.2 Laporan lawatantapak.

      *   Laporan ini membentukkefahamantentangkeadaandan halanganyang mungkin
          mempengaruhikerja. Laporan ini juga membantudalam penyediaansenaraisoalanuntuk
          dibentangkankepadaperekabentuk, perunding dan pihak berkuasaawam untuk
          penjelasan        kehendak
                     mengenai         mereka.

No             Maklumat yang diperlukan                         Tujuan/kesan

 I        Keadaantapak- jenis tanah,parasair              kerja penggalian, dan sokongan
                                               Mempengaruhi               loji
          bumi, kekuatantanah.                 tanah.

 2        Tempat membuangbahanbuangan          Mempengaruhikadar bahanyang telah digali.

 3                banzunan
          Perobohan       vans ada.                       kos

 4        Jalan masuk                          Menilai kerja permulaan, dan kenderaan
                                               melaluinya sertapenghantaranbahan binaan.

 5        Halanganlokasi tapak.                Kemudahanmenyimpan,adangyang perlu

 6        Buruh                                Untuk tujuan kadar harga dan bekalan tenaga.

 7        Perkhidmatansediaada                 Untuk memastikanbekalan mencukupi dan
                                               kemudahanuntuk tapak bina dan pekery'a.

 8        Pembekal, subkontraklordan loii.     Untuk membuatkadar harsa.

 9        Keselamatantapak                     Persediaan
                                                               tapakbina, bahan-bahan,
                                               barang-barang pekerjasupayasentiasa
                                                           dan                     selamat.

 l0       Faktor lain                          Kemungkinanperkaraluar jangkaan yang mungkin
                                               mempengaruhiperjalananproj ek.

      2.3.3 Kadar Harga

         *   Kadar harga dikira dalam borang kadar unit berdasarkan kos bersih untuk buruh, bahan
             dan loji, tidak meliputi sebarang         perbelanjaanasas.
         *   Ini membolehkankontraktor mengira nilai bersihjumlah anggarandiperingkat tawaran.
         *   Kemudian nilai bersih kos akan dijadikan asasuntuk sistemkawalan yang akan
             digunakan oleh kontraktor dalam tempoh projek.
         .i. Faktor pembazirandan pemadatanhendaklahdiadakanuntuk elemen bahan.
         * Antara maklumat yang diperlukan untuk mendapatkankadar harga ialah:
                i.  Hasil dan angkatapburuh.
               ii.  Kadar hargadan hasil loji.
              iii.  Hargabahan.
              iv.   Sebutharga untuk kerja subkontrak.

      2.3.4 Kos pengurusan

      Kos pengurusan   biasanya  merangkumi:
          i. Elaun pengarah    dan perbelanjaannya   (berkaitanprojek)
         ii. Gaji pengurusdan pekerjanyatermasukbayarankerja lebih masadan tuntutan lain lain
             berkaitan projek.
       iii.  Faedah  keataspinjaman.
        iv.  Sewapejabat.
 ':      v.  Cukai pendapatan/    keuntungan.
        vi.  Bil-bil air, telefon,elektrik dan lain-lain.
       vii.  Kenderaan.
      viii.  Insuran.
        ix.  Surat-menyurat.
         x.  Peralatan  pejabatdan alat tulis.
        xi.  Yuran pendaftarankonktraktor.
,1,    xii.  Lain-lain perbelanjaan  mengurusyang tidak terdapatdalamsenarai atas.

      2.3.5 Kadar keuntunsan

      Kadar keuntunganbiasanyadiambil beberapa  peratusdari hargaprojek dan selalunyatidak
      melebihi 25o/o.Tinggiatau rendahnyaperafusanyang diambil bergantungkepada:
         i.  Keadaanekonomi negara
        ii.  Bilanganprojek dalamtangan
       iii.  Senang/sukar/ risiko untuk melaksanakansesuatuprojek.

    2.3.6 Programpembinaan

    Programinduk selalunyadisediakandalam bentuk cartabar dan bagi projek yang lebih kompleks
    ianya disediakandalambentukanalisa  rangkaian.Programmestilahmerangkumi:
        i. Fasautama bagi kerja mengikut urutan operasitapak.
       ii. Tarikh permulaandan penyiapankontrak.
     iii.  Cuti tahunandan cuti umum.
      iv.  Tarikh penting peringkat utama kerja.

    Program induk juga menunjukkanburuh yang dirancangkandan keperluanloji.

    2.3.1 Sebutharsa.

    Dalam penyediaansebutharga, kuantiti dan bahanyang diperlukan mesti disediakandahulu dan
,   dapatkanmaklumbalasdaripadapembekal.Jadualbahanuntuk pertanyaan       kepadapembekal
    mestilah merangkumi:
        i. Spesifikasibahan
       ii. Kuantiti bahan
      iii. Programpenghantaran
      iv.  Alamat tapakbina
       v.  Laluan masuk'
      vi.  Tempohmasasebelumsebutharga     diterima
     vii.  Tarikh akhir pembayaran
    viii.  Kaedahbavaran.

    2.3.8 Laporankepadapengurusan

    2.4                     yang perlu diambil kira dalam .perlaksanaan
              Perkara-perkara                                         kontrak

    2.4.1 Skop dan kuantiti kerja

    Terdapat9 prosesutama yang terlibat semasaperlaksanaan
                                                         kontrak dibuat :

              i.      Penyediaan Ringkasan Projek.
              ii.     Penyediaan Rekabentuk Permulaan                   TapakBina.
                                                       Dan PelanSusunatur
              iii.    RekabentukPerincianArkitek Dan Kejuruteraan.
              iv.     Penyediaan AnggaranAwal Dan KawalanKos.
              v.      PenyediaanDokumen Tender.
              vi.     Pelawaan  Dan Penerimaan Tender.
              vii.    PenilaianDan Setujuterima Tender.
              viii.   PenyediaanDan Menandatangani   Dokumen Kontrak.
              ix.     Perlantikan Subkontraktordan Pembekal.

|   2.4.2 Buruh

    Setiaptahunstatistikkeperluanburuh meningkat.

                              JUMLAH KEPERLUAN BURUH (.000)

    TAHLIN             1990    r99I    r992   1993     1994    r99s      2000

    JUMLAH              421     449     481     538     s66        604    772

    JADUAL : Jumlah keperluanburuh dalam sektorpembinaandi Malaysia.


    Pengambilanburuh untuk bekerja perlu dijalankan mengikut peraturan-peraturan  yang telah di
        o Hanya warganegaraMALAYSIA diambil bekerja. Namun begitu pekerja luar boleh
           diambilsekiranya terbukti tiada peke4'ayangboleh didapati dinegaraini serta mendapat

          .   Nisbah pekerja di tapak ikut nisbahkaum di Malaysia.

          o Buruh yang diambil bekerjamesti dari dalam daerahkerja (projek) dijalankan.

          .   Mengambil pelatih bekerjajika diarah oleh kerajaan

2.a.2@)                langsung kontrak
                 Pekerja      atau

  i)      PekerjaAtau BuruhLangsung

          * Buruhlangsung merupakankakitangan                         syarikat.
                                             ataustaftetapbagi sesebuah
                                            yang telah ditetapkan
          i. Perlulahmenurutiprosedur-prosedur                   dalam pengambilan
          {. Mengisi borangtentangmaklumatdiri, tahappendidikandanpengalaman     bekerja.
          * Majikan perlu mencarumkan pekerjanya dengan Kumpulan Wang Simpanan
             PekerjaatauEPF untuk simpanan    hari tua pekerjamereka,SOCSO sertainsurans
             yang berkenaanseperti insuranskemalangandi tempat kerja dan sebagainya.
          * Pekerjalangsungini akan dibayar gaji secarabulanan atauharian.
          * Waktu bekerja mereka adalahselamalapanjam sehari.
          * Pekerja langsung ini adalah tertakluk kepada peraturan-peraturanyang telah
             ditetapkanoleh majikan atau syarikat dimana ia bekerja.


            i.     lsi borang
           ii.     Memiliki

                                       Pekerja@ Buruh

           - Tertakluk                                                        gaji
             kepada                                                        bu
                                                                      secara lanan
            peraturan                                                   atau harian

                                          Kerja jam sehari

  ii)    PekerjaAtau Buruh SecaraKontrak

   {. Kakitangan atau staf yang tidak tetap.
   .i. Boleh didapati daripadasyarikat yang membekalkanburuh secarakontrak.
   i. Sekiranyaperkhidmatanmereka diperlukan,kontrak akan ditandatangani.
   * Perlu menuruti prosedur-prosedur   yang ditetapkan.
   * Menandatangani                                                           tertentu.
                        perjanjian dalam kontrak denganberdasarkansyarat-syarat
   * Jika tempoh kontrak tamat, maka tamatlah perkhidmatannya tetapi     jika projek belum
       siap, buruh secarakontrak ini boleh menyambungkontrak mereka mengikut keperluan
       perkhidmatannyadi tapak bina tetapi mereka perlu menandatanganisemula perjanjian
       kontrak yang baru dengansyarat-syarat  yang baru.
    n Sekiranya majikan pecah kontrak, buruh tersebut boleh membuat laporan di Jabatan
       Buruh dan boleh menuntut gantirugi daripadamajikan.
    i. Tetapi sekiranyaburuh pecahkontrak, majikan boleh tidak membayar gaji atau memecat
       buruh tersebutwalaupun kontraknyamasih belum tamat.
    * Buruh ini biasanyatiada carumanKWSP / SOCSOtetapi ada perlindunganinsurans.

Buruh secarakontrak ini biasanyaterbahagikepadatiga, mengikut kategori kemahiran iaitu :

   1) Tukang ( Craftman )
   2) Buruh biasa ( GeneralLabour )
   3) Kepala/ Penyelia( Foreman/ Supervisor

Hari dan waktu beke{a untuk buruh adalah seperti yang dinyatakan di dalam Borang Kontrak
Setara2}3{bahawa tiada apajua kerja boleh dijalankan:
          * Padahari rehat mingguan
          * Padamana-manahari kelepasanam yang diiktiraf dalam daerahdi mana kontrak
             ini dilaksanakan
          * Di antarapukul enampetangsehinggaenampagi esoknya.

2.4.2(b)       JadualKeperluanBuruh

Keperluan bagi buruh mestilah mencukupi dan memadai bagi projek yang bakal dijalankan.
Dalam erti kata lain, jumlah buruh mestilah mengikut saiz projek yang bakal dijalankan.

Contoh JadualKeperluanBuruh:

      Kumpulan Pekerja                Bilangan




      Tukang Paip



      Tukang Letrik

      Tukang Cat


      Tukang Kayu

2.4.3 BahanBinaan

2.a3 @)        Bahanbinaan yang perlu dibekalkan

Bahan binaanyang dibekalkandi tapak adalahbergantungkepadajenis projek yang ingin
            Antaranya adalah:

  i. Bahanbinaan yang digunakandalam pembinaanjalan raya.
 ii. Bahanbinaan yang digunakandalam pembinaanbangunan

2.4.3 (b)    Jadualbekalanbahanbinaan

1. Panduanbagi kontraktor berkaitan tentangbahanbinaan yang diperlukan"
2. Berpandukankepadasenaraikuantiti.
3. Untuk pemesanan bahanbinaanke tapakbina oleh kontraktorbagi tujuan menjalankankerja.

Pemesanan Tempoh                        Contoh Bahan

Biasa       t hingga 2 minggu           Simen,keluli, bata dan sebagainya.

Khas        Minima 1 bulan              KemasanLarfiai

Jumlah pemesananbagi bahan binaan adalah bergantung kepada kelancaran sesuatu kerja
dilakukan. (Klause 47 -Borang JKR 203 A)

Pemesanan BahanBinaan
1. Pemesanan bahan binaan dilakukan menggunakanPurchaseOrder oleh syarikat kontraktor
   kepada pembekalbahan.
2. Di dalam PurchaseOrder terdapatbutiran sepertikuantiti bahan,jenis bahan,harga bahan,
   namapembekaldan kontraktor dan sebagainya.


1. Mengeluarkanarahanpesanan      bahanbinaan.
2. PMC akan mengenalpasti    pembekal.Katalog pembekal,Profil syarikat diteliti bagi menilai
   pembekalyang berkuatili.
3. Pembekalakan dinilai berdasarkan   :
    i.   SenaraiPembekalLulus - Merupakan senaraipembekal sedia ada atau pembekal yang
   ii.   Rekod urus niaga yang lepasdan kemudahankredit yang diberi.
4. Pembekal-pembekal    yang dipilih dan dibuat penilaian sebutharga.
5. Untuk pembelian segeraatau pembeliandibawah bidang kuasa mutlak PurchaseOrder akan
    dilakukan terus tanpamembuatpemilihan pembekal.
6. Setelah  pembekaldipilih dan sebutharga   telah dinilai , prosespengeluaran
    akan dilakukan dalam borang Purchase   Order.
7. Pengeluaran   PurchaseOrder perlu kelulusan.
8. Setelahkelulusan diperolehi, Purchase  Order dihantarkepadapembekal.
9. Pembekalakan menghantarbahanbinaanyang dipesanke tapak bi4a setelahPurchaseOrder
10. Kontraklor perlu menyemakbahan binaan yang dihantar ketapak bina supayabahan binaan
    yang dihantarmencukupi dan dalamkeadaanterkawal.

11.Pengesahan ataspenerimaan
              ke              bahanbinaanperlu dilakukanoleh personelyang bertauliah.
12.Penilaianprestasi       perlu dilakukansekalisetahun.
13.Pembekalyang kurang berprestasi akan disenaraihitamkan denganmengemaskiniSenarai
   Pembekal  Lulus.

2.4.4 Peralatan

2.4.4 (a)    Pemilihandanpenghantaran tapak

       Walaupunpenggunaan    jenteramelibatkanmodalyang tinggi, tetapimempercepatkan
prosesbinaan dan mengurangkan buruh akan dapatmenghasilkankeuntunganyang banyak-
Keadaan  tapakbina akanmenentukan   jenis jenterayang sesuai         Kedudukandan saiz
bangunan  juga menentukan tempatyang paling sesuai  diletakkanbahandan kelengkapansupaya
tidak perlu dipindah-pindahkansehinggabangunansiap dibina.
       Pemilihan jenis jentera yang digunakan adalah bergantung pada keq'a yang perlu
dilakukan serta fungsi dan keupayaanjentera masing-masing.Jentera-jentera boleh didapati
sama ada denganmembelinya ataupunmenyewa      jentera-jenteraini dari syarikat khas sama ada
secarakontrak, sewaharian ataupunmengikutjangkamasaia disewa.


        PENYEDIAAN TAPAK                          PEMBENAMAN
        ASASDAN PENGO                             CERUCUK

                        JENTERA                                 JENTERA
                        PENGEPAMAIR                             PENGANGKUTAN


Shared By: