C5011-Pengurusan Pembinaan

Document Sample
C5011-Pengurusan Pembinaan Powered By Docstoc
					                                   C 5011 PENGIIRUSANPEMBINAAN


TOPIK 1:                PENGENA.IJhN PENQURUSAII
                         PtrMBINAAIII

1.0 PROJEK
         KEJURUTERAAN
                   AWAM
Projek
     Kejuruteraan
               Awammerupakan industri
                            satu      yangutamayang
menyumbangkepada ekonomi
                       negara.lanya
                                 melibaikan"teknik-teknik
pembinaan dapat
        yang      memajukan
                          pembangunannegara.
Industri
       binaan
            dapatdikategorikan
                             kepada
                                  dua iaitu:
i.  KerjaBangunan
ii. KerjaKejuruteraan
                   Awam
KerjaBangunan

lanyamelibatkan
              pembinaan
                      bangunan
                             seperti
                                  :
i.        Rumah kediaman
ii.       Hartanahperdagangan
iii.      Hartanahkhasseperti
                            hotel,stesyen
                                       minyak.
iv.       Pejabat-pejabat
v.        Hospital,
                 dll

KerjaKejuruteraan
                Awam
Kerja-kerja
         Kejuruteraan
                   Awamterbahagi
                              kepada jenis iaitu:
                                   2
   i.       Kejuruteraan
                      Awam
   ii.      Kejuruteraan
                      awamBerat
KerjaKejuruteraan
                Awam
lanyamelibatkan
              kerja-kerja
                       pembinaan
                               seperti:
   i.      Jalanraya
   ii.     Lebuhraya
   iii.    Jambatan
                                     C 5011 PENGIIRUSANPEMBINAAN

  iv.       Jeti
  V.        Terowong
  vi.       Pembentungan
                      najis

KerjaKejuruteraan
                Awam Berat

            Pelantar
                   minyak
            Empangan  sungai
            Lapangan terbang
            Rangkaian Lebuhraya Negara
            Landasan keretapi,
                            dll


1.1 GIRI.CIRI
            PROJEKKEJURUTERAAN
                             AWAM
       Industri
              binaanmenjadi penggalak
                                    kepadaperkembangan
       industry kerana
              lain       bahagian
                                pengeluaran'bahan
                                               ,"pJrti
       simen,pasir,keluli,   papan Cat
                         bata,    ,   dansebagainya.
       Sebagai industriperkhidmatan
                                  dalam  menyediakankemudahan
       infrastruktur
                  fizikal
                        danbangunan.  Industri
                                            pembinaan adalah
       kompleks mempunyai
                dan                  yangtersendiri
                              ciri-ciri          iaitu:

       1"     Rekabentuktersendiri

             Projek pembinaan memerlukan pendekatan yangberbeza
             untuk melaksanakannya.Initerjadi
                                            mungkin diselbabkan
             rekabentuk berbeza setiap
                        yang       bagi        pemninaan.Jika
             rekabentuk berbeza,penggunaan bahan, buruh rogidan
                                                       ,
             sumber  yangterhadyangrainadarah        jenis,"
                                               berbeza
             saiz,,jenama,tahapkecekapan kerja,kemahirindan
             sebagainya. pengalaman projek
                                   dari       yanglepasjuga
             tidakdapat gunakan
                       di                     -
                                 sepenuhnya.
                                            PEMBINAAN
                            C 5011 PENGURUSAN


                        faktoriaitu:
                 beberapa
     Inidisebabkan

     i.     Fungsi kegunaan
                   dan          yangberbeza.
     ii.    Pengaruh alamsekitar       jenistanah,kawasan
                                 seperti
            lombong ,cuaca,musim  dsb.
     iii.   Penonjolan identiti prestij
                             dan       padabangunan yang
            didirikan.

2.   SaizProjek

     Saizprojek
              yangbesar         (Canggih)
                      dankompleks      biasanya
     melibatkan:

     i.     Sejumlahmodal yangbesar.
     ii.    Jenisdanbilangan yangbanyak.
                             logi
     iii.   Pekerjaatautenaga mahirsamada  sepa
                       yang
            professional berpengalaman.
     iv.    Kaedah teknik
                   dan                  binaan
                             atauteknologi     yanglebih
            rumit           dan
                 dancanggih memerlukan     kepakaran
            khusus.

3.   Lokasiprojekyang berlainan

     Lokasiakanmempengaruhi   binaanstrukturbawah  tanah
     sesuatu pembinaan.
     Selain itufaktor
           dari             jugamungkin
                       lokasi            memberi  kesan
     sampingan  yanglainkepada  pembinaan sepertikeadaan
     tanah, pantai,
           tepi      penduduk           bangunan
                               sekeliling,
                                jarak
                     pembinaan, tapak
                projek
     disekeliling                          binadengan
     ibupejabat akanmempengaruhi  overhead lain-
                                           dan
     lain.Kesesauaianpemilihan      jugaperlu
                              jentera         difikirkan
     dengan lokasiyangterlibat.

4.             kepadakeadaan
      Bergantung           setempat.

                             (building
                      tempatan
      Peraturan-peraturan            codes) seperti
      kod,akta,           kecil
              undang-undang , enakmen  dll.
                                C 5Oi1 PENGURUSANPEMBINAAN


     5.   Jangkahayatyang panjang(lifespan)

                         by
          Lackof turn-over tradein.


1.2 PENGURUSAN

     Amalan         adalah
           Pengurusan      komplekskeranaianyadiuruskan
     olehmanusia.Manusia
                       adalahmakhlukyangkompleks dan
     mempunyaipelbagai               pemikiran
                     cara,rasa,kaedah,       yang
     pelbagai
            untukmenguruskansesuatu.

           seorang
     Menurut     Psikoanalisis
                           Swiss,        Jungpernah
                                CarlGustav
              :
     menyatakan

     'Lebih senangpergike Marikh atauke bulan
     daripadamenembusijiwa manusia'.


           adalah
     Berikut     beberapa                yangsering
                          takrifPengurusan        diguna
     pakaidalamkerja-kerja
                         Pengurusan.



A.   Takrif-takrifPengurusan:


1.   RobertKreitner:1983:

     Pengurusanmerupakansuatu proses kerjadengan dan
     melalui orang lain bagi mencapaiobjektif organisasi
     secaraberkesandenganmenggunakansumber-sumber
     terhad secara cekapdalamsuasanayang senfiasa
     berubah-ubah.
                                               C 5011 PENGURUSAN
                                                               PEMBINAAN


             2.   Donnelly,
                          Gibsondan lvancevich
                                             (1987:5):

                  Pengurusanialah satu proses yang dilalui oleh satu atau
                  Iebih individu untuk menyelaras aktiviti orang lain untuk
                  mencapaikeputusanyang tidak boleh dicapai oleh
                  seseora yang bertindak berseorangan.
                          ng

             3.   Massiedan Douglas(1992:24):

                  Safuproses...... ia bukan semata-mata satubadan
                  pengetahuan,teori-teori,idea-idea,tetapi ianyajuga aktif
                  dan melibatkanfungsi-fungsi yang jelas dan berbeza-
                  beza,,..
        ')   4.   Kastdan Rosenweing
                                   (1985:5):

                  Pengurusanmelibatkanpenyelarasansumber manusia dan
                  bahan ke arah pencapaianobjektif.

             5.   Jaafar     (1988:1)
                       Muhamad

                  Pengurusanialah satu proses mengagihkaninput-input
                  organisasi(termasuksumber ekonomidan sumber
                  kakitangan)dengan cara
                  perancanga pengorg ani s asian,penga
                             n,                        rahan dan
                  pengawalan  untuk tujuan mengeluarkan  output (segala
                  barangandan perkhidmatan)yang diperlukan oleh
        i         pelanggan-pelanggan  supaya objektif organisasi tercapai.


             Secara amnya  Pengurusan bolehlah
                                             ditakrifkan
                                                       sebagaiperkara
             yangberkaitan dengan ehwalmengurus
                                  hal               ataumelaksanakan
             sesuatu aktiviti
                           dengan menggunakan  teknik-teknik kemahiran
                                                          dan
             tertentu
                    bagimencapai  objektif
                                         sesuatukerja.lanya
                                                          adalahhasil
             gabungan antara  perancangan(planning),
                                                  penyusunan (organizing),
             pengagihan (delegating) kawalan
                                   dan        (controlling).

t
I


    a
                               C 5011 PENGURUSAN
                                               PEMBINAAN


Selain       itu          juga
     daripada Pengurusan merupakan      penyelarasan
kesemuasumber-sumber pengeluaran      satuproses
                                melalui         supaya
matlamatyangtelahdipastikan
                          akantercapai.
                                     Beberapa unsurperlu
diambilkira
         dalam menguruskan projek
                                pembinaan.


B.   Unsur-Unsur
               DalamPengurusan

             yang
Limaunsur-unsur sering
                     terdapat
                            dalamPengurusan
                                          iaitu:

i.   Bekerja'dengan' 'melalui'
                  dan       oranglain.

     SeseorangPengurusbiasnya
                            memerlukanbantuandan
     kerjasamakakitangan
                       bawahnya
                              untukberurusan
                                           dengan
     pihakyangdiuruskan.

ii. Objektiforganisasi.

     la merupakan
                matlamat utamadanperludicapai
     dengancekapdanberkesan. Keberkesanansesebuah
     organisasi
             dapatdinilai     pencapaian
                        melalui         objektifnya.

iii. Keberkesananmelawankecekapan.

     Secarakeberkesanan
                      merujuk
                            kepadapencapaian objektif
     manakalakecekapan          jumlah
                      mencerminkan    inputatausumber
     yangdigunakan melaksanakan
                 bagi           sesuatukerja,

iv. Sumber-sumber
                terhad.

     Faktorpengeluaranseperti
                            buruh,
                                 modal tanahadarah
                                        dan
     bersifat
            berkurangan.
                       Pengetahuan berkaitan      gunaan
                                            ekonomi
     sepefti
           turunnaikkadarhargabahan, minyak,kos
     pengangkutan tempat
                 dari      berbeza ataujauhdaripembekal
     dansebagainya.
                                  C 5011 PENGURUSAN
                                                  PEMBINAAN




                  penting
         Ini adalah       bagisetiapPengurusuntukmengagihkan
         sumber-sumber  terhad supaya
                              ini      dapat
                                           digunakandengan
         cekap pada tingkatyangpalingoptimum


                    terhad:
         Sumber-sumber

         a. Bahan
         b. Buruh
         c. Logidanperalatan
         d. Kewangan
)        e. KosPengangkutan
                     teknikal
         f. Kakitangan
         g. Maklumatprojek
         h. Pengalaman
         i. KosKeuntungan Pengurusan
                         dan       (profit overhead)
                                         &


    v.   Suasanayang sentiasaberubah-ubah.

         Suasana yangdimaksudkan
                               adalahfizikal,
                                            sosial,
                                                  maklumat,
         politik
               dan moral.
                                                 PEMBINAAN
                                C 5011 PENGTJRUSAN




                       Bekerja
                       dengan dan           Suasana               ah
                                                   yang b erubah-ub
                       melalui orang
                       lain




  Keseimbanganantara                   Melaksanakankerja
             dan
  keberkesanan                         denganmenggunakan
  kecekapan                            sumber-sumberyang
                                       terhad




                      yang berubah-ubah
                Suasana

                               t
                                I
                                I
          asas
Unsur-unsur   dalamPengurusan.
                                 C 5011 PENGURUSAN
                                                 PEMBINAAN



1.2.1 TAKRIFPENGURUSAN
                     PEMBINAAN


       'Pengurusan   pembinaan melambangkan
       kumpuIan aktiviti -aktivi ti Peng urusan yang
       melebihiperkhidmatanatau tugas-tugaslazim
       bagi Akitek dan Jurutera yang berkaitandengan
       sesuafuprogram pembinaan di mana aktiviti-
       aktiviti tersebutdijalankan padaperingkat
       pera cangan konsep, p ra-rekabentuk,rekab entuk
            n
       dan juga semasa fasa pembinaanyang
       menyumbangkepadakawalan masa,kos
       (kewangan)   dan kualiti dalampemhinaan satu-
       satukemudahanyang baru'.

A.   TakrifPengurusan       yang popular
                    Pembinaan
     Pengurusan            juga
                 Pembinaan dikatakan    mempunyai
                                               berbagai
                 takrifyangpopular
     takrif.Antara               ialah:


1.   Menurut
           Charted Institute Building
                            of       (GIOB)
                                          United
     Kingdom (1982: - 1992:3)
                  12          dan Greenwood 982/88):
                                          (1

     Pengurusan pembinaan
                        merupakan perancangan
     keseluruhan,pengawalankoordinasi
                         dan                 projek
                                       sesuatu
            peringkat
     daripada       permulaanhingga peringkat
                                            penyiapanbagi
     memenuhi         pelanggan memastikan
              keperluan         dan           projek
     tersebut       padamasayangditetapkan
            disiapkan                      dalam
     lingkungan dankualiti
              kos         kerja      yangdiharapkan
                               seperti             oleh
     pelanggan.

2.        (1984:5)
     Walker      :

     Perancangan,kawalan koordinasi
                          dan         sesuatuprojekdaripada
     konsepsehingga penyiapan  projek pembayaran
                                    dan           komisyen
     bagipihakKlien.
                   lanyamenekankan   penentuanobjektif
                                                    klien
     berkenaandengan utility,fungsi,mutu,masa sertadapat
                                          dankos
                                                         9
                                       C 5011 PENGIIRUSANPEMBINAAN


             mewujudkan            sumber-sumber maklumat
                              antara
                       hubungan               dan
             ataudataProjek.

             Beberapaaspekutama               projek
                                dalampengurusan     pembinaan
                  perlu
             adalah    bagimemenuhi        Klien
                                    kepuasan    denganprojek
                                aspek-aspek
             yangdihasilkan.Antara-       utama       ialah:
                                               tersebut

             a. Mengintegrasi.
             b. Menyelia.
             c. Mengawal semua     yangmenyumbang
                               pihak                 kepada projek.
             d. Output-output yangberkaitan
                            pihak             kepada projek.,
             e. Penilaian pemilihan
                        dan                         bagi
                                    alternatif-alternatif memenuhi
                impian kehendak
                     dan          Klien.
f:
'' ')   3.   Sidwell(19771:

             Perancangan, pengarahan,koordinasian maklumbalas
                                             dandan
             yangprlubagimelaksanakan      projek
                                     sesuatu    dengan mematuhi
                       dan         yangdikehendaki
             tarafkualiti kefungsian             dalamtempoh
             masadanstruktur yangdipersetujui.
                             kos

        4.   Maevis(1977)z

                      pembinaan suatu
             Pengurusan       ialah    proses
                                            mengintegrasikan
                               danpembinaan memenuhi
             perancangan,rekabentuk        bagi
             keperluan seseorang
                     asas       pemilih.


 ' )    Secara                     di
                           dapatlah simpulkan
              keseluruhannya                  bahawa   pengurusan
        pembinaanmerupakan penyelarasan
                                      kumpulan         pengurusan
                                                aktiviti
        yangmelebihiperkhidmatan tugas-tugas
                               atau          lazimbagiAkitekdan
                            yangberkaitan
               sertaperunding
        Jurutera                        dengan  dengan
        menggunakan kesemua sumber-sumberpengeluaran        satu
                                                      melalui
        prosessupaya        yangdipastikan
                     matlamat            boleh tercapai.




                                                                  10
                                    C 5011 PENGURUSAN
                                                    PEMBINAAN


B,                      Pembinaan.
     Giri-ciri Pengurusan

       takrifan
Daripada      dapat digambarkan       ciri-ciripenting
                               beberapa
dalampengurusan projek      berikut:
                      seperti




                      Matlamat



                PengurusanPembinaan

                     Merancang
                    Mengorganisasi
                      Mengarah
                      Mengawal


                   Keluaran akhir


            Ciri-Ciri Pengurusan Pembinaan




                                                           1i
                                                 PEMBINAAN
                                 C 5011 PENGURUSAN


     1.2.2 Komponen UtamaDalamPengurusanPembinaan

          a. Kerjaberpasukan.

          Menguruskan            pembinaan
                            projek
                      sesuatu                    melibatkan
                                            sering
          kerjaberpasukan. (3)komponen
                         Tiga            utama dalampasukan
                    pembinaan
          kerjaprojek                  :
                              memerlukan

          i. Pemilik
          ii. Perekabentuk
          iii. Kontraktor

                  dalam
          Koordinasi    merekabentuk pembinaan
                                    dan         sesuatu
          projekmemerlukanperancangan organisasi
                                    dan
          sekumpulan       yangberdedikasi
                     pekerja                 satuobjektif
                                        menuju
          yangsamaiaitumenyiapkanprojek
                                      untukPemilik.

                      satu-satu
          Kuncikejayaan             ialahpemilihan
                               projek            dan
                         yangmempunyai
                   pekerja
          koordinasi                    kebolehan
                              dan
                      masalah menyelesaikannya
          mengenalpasti                          dalam
          usaharnenyiapkanprojek
                               tersebut
                                      dalamjangka masayang
          di rancang.




{
')




                                                         14
                               C 5011 PENGURUSANPEMBINAAN


                 DALAMPENGURUSAN
1.3 ISTILAH-ISTILAH
                      yang       dalam
         istilah-istilah digunakan
   Berbagai                           Pengurusan.

   1.          (forecasting).
        Jangkaan

        Andaian yangdibuat       kemungkinan
                          terhadap             yang
        berlakuagarsemua  perancangan
                                    dapat  diatur dengan
               yangtepat.lanyamerangkumi
        strategi                          aktiviti-aktiviti
        pengeluaranuntukmenentukan piawaian
                                   satu           dan
        kaedah binaanyangsesuai.      itu
                                Selain maklumat
        persekitaran
                   terhadaptenagakerja,keperluan
        bahan,kemudahan danlogiperlu
                        alatan             diambilkira.

   2.             (planning)
        Perancangan

        Mewujudkan           untuk
                   tindakbalas     memberikanpanduan
        padasuatu projeksehinggaianyadisempurnakan.
        Bermula dengan skopkerjasehinggatamatsesuatu
        projek.
              lanyamesti disediakan
                                  dalam bentukpelan
        operasiuntukkeseluruganprojek.
                                     Termasuklahtentang
        kejelasanmatlamatdengan membentuk        dan
                                          strategi
        mengembangkan   Perancangan menyusun
                                   untuk         aktiviti.

   3.          (organizing)
        Kelolaan

        Mengaturkan semua mengikut system
                                  satu       yangsesuai
        dengan       Suatuprojek
               projek.           mestidiaturkan
                                              mengikut
        kehendak kerjayangdilakukan.Semua perlu
                                          tugas
        diagihkankepada unit-unit yangdapat
                               kecil         dilaksanakan
        sertadapatdiukur.Pengelolaan
                                   iniadalahmencipta
        struktur
               kerjadansistem dengan menentukan tugas
        yangperlu dibuat,
                        siapayangmelaksanakannya,
        bagaimana suatutugasan akandikelompokkan serta
        siapayangmelaporkan  kepadasiapa?.




                                                          15
                          C 5011 PENGIIRUSANPEMBINAAN


4.          (motivating)
     Dorongan

     Apabilasesuatukehendakbelum dipenuhimakaia
     merupakan permulaanprosesdorongan.Dorongan amat
     diperlukan
              untukmenggalakkanpekerjabertindak
                                              dalam
     carayangdikehendakiuntukmemenuhi tujuan
              Padamasayangsamaia memenuhi
     organisasi.                             objektif
     sendiri objektif
           dan       professional.

     Dalam  pembinaan, dorongan merupakan  pengurusan
     semangat  juangpekerja pihak-pihak berkaitan
                           dan            yang
     denganpendekatan'melayan    merekadenganbaik,.
     Dorongan berbentuk
               ini         usaha terhadapkemanusiaan.
     Antara perkarayangperlu diberidorongan ialahsikap
     pekerja,pencapaian,penghargaan,ta ggungjawab,
                                      n
     wang,pening                 persaingan hubungan
                 katan,penyertaan,         dan
     sosial.

5.   Arahan(directing)

     Panduan  yangdiberiuntukmelakukankerjaseperti
     dikehendaki supayaprojekdapat
                                 dilaksanakan.
                                             Semua
     kakitangan yangbertug,as
                            dalamsesuatuprojekmesti
     dibentuk sebagaisatupasukanberkesandan
     bekerjasama satuarahyangsamaiaitumencapai
                  ke
            pedaksanaan
     objektif           sesuatuprojek
                                    atausesuatu
     pembinaan.

6.              (coordi
     Penyelarasan     nating/commu
                                 nicating)

     Penyelarasan penting
                 ini      agarsemuapihak dapat
     mengetahuitanggungjawab had-had
                            dan        kuasanyaserta
     perhubungandengan pihak-pihak terbabit
                                yang        dalam
     bidangpernbinaan.
                     Struktur
                            organisasi cartaalir
                                    dan
     adalahpentingbagimelancarkan
                                perjalananprojek.




                                                   16
                            C 5011 PENGLIRUSAN
                                             PEMBTNAAN


7.   Kawalan(controlling)

     Pengawalan merupakan set aturcara
                          satu           untuk
     membandingkan       pencapaian
                    antara          sebenarsesuatu
     aktiviti
           dengan perancangan Dalam
                             asal.      konteks
     pengurusan pembinaan,tujuanutama pengawalan
     adalah untukmengawasi perlaksanaansebenar tapak
                                              di
     binasupaya selaras menepati
                       dan         perancangandan
     penjadualanprojek
                     yangtelah dibentuk          pra
                                       diperingkat
     pembinaan.

     Dalampengawalan semua
                    ini      aktiviti-aktiviti,
     perlaksanaan dipantau
               akan        supaya  dapatberjalan
     denganlancar tindakan
                dan        sertalangkah-langkah
                        jika
     pembetulan diambil perlu.
              akan




                                                   T7
                                        C 5011 PENGIIRUSANPEMBINAAN


1.4 PERHUBUNGAN
             PENGURUSAN
                      PEMBINAAN
    DENGAN
         PENGURUSAN
                  PROJEK

  A.         ProsesPengurusan
             Jikaandaseorang pekerjabagisatuorganisasi,
                                                      anda
             tentunyaharusmemahami  strukturorganisasinya
                                                       dan
             fungsi
                  setiapperingkat-
                                 peringkattempat andabekerja.
             Andajugaharus mengetahui tugas yangdijalankan
                                                         oleh
             parapengurus fungsi
                         dan       pengurusan, perancangan,
             pengelolaan pengawalan
                        dan            dalam usaha mencapai
                              (goals)
             matlamat-matlamat organisasi. meliputi
                                               Ini
             proses pengurusan.



  Sumber-Sumber             Pengurusan



  .
  r
  .
  o
  o
      Pekerja
      Kewangan
      Produk
      Lokasi
      Informasi
                   F
                   I
                            o
                            .
                            .
                            .
                                Perancangan
                                Pengelolaan
                                Pengarahan
                                Pengawalan
                                                      Pencapaian
                                                               matlamat
                                                         dan objektif




                     ProsesPengurusan

  Rajah atasmenggambarkan
        di                prosespengurusan
                                         yangdiguna
  pakaiolehPengurus-Pengurus mana-mana
                          dalam          organisasi
  tidakkirasamada
                berorientasikan
                             keuntungan
                                      ataupun
                                            tidak.
  Terdapat
         konsep
              dasarataufungsi
                            yangharusdiingati
                                            dalam
  proses
       pengurusan
                iaitiu:

  .    Perancangan
  .    Pengarahan
  .    Pengelolaan
  .    Pengawalan

                                                                  18
                                                  C 5011 PENGIIRUSANPEMBINAAN


     B.     FungsiPengurusan

     Empatfungsipengurusan merupakan
                              ini       rangka
     kerjauntuktindakandalampengurusan
                                     yangterbaik
     bolehditerangkansepetirajah bawah.
                                di


                                       Perancangan

                                .     Termasukkejelasan
                                      matlamat
                                o     Membentuk strategi
                                      dan mengembang
                                .     Perancanganuntuk
                                      menvusunaktiviti




      Pengawalan                                                        Pengelolaan
                                            Ketua
.   Memastikan segalanya                   Pasukan               .   Mencipta strukfur kerja
    beq'alanlancar dengan                                            dan systemdengan
    memantau    aktiviti-                                  \         menentukansystem
    aktiviti, pelaksanaan                                            denganmenenfukan
    dan mengambil                           Pengurus                 tugas yang perlu dibuat,
    langkahpembetulan                                                siapayang buat,
    jika perlu.                                                      bagaimanatugasan
                                                                     hendak dikelompokkan
                                                                     serta siapayang




                                         Pengarahan

                            o       Menyemai semangat  melalui
                                    motivasi orang bawahan,
                                    mengarahyang lain-lain
                                    melalui salurankomunikasi
                                    yang berkesandan
                                    mententeramkan konfl ik.



                       Rangka Keria Tindakan Pengurusan
                                                                                         19
a\\



                                                PEMBINAAN
                                C 5011 PENGURUSAN


      ParaPengurus        arahan
                    memberi       kepadaorganisasinya,
      memimpin menentukan
                dan           bagaimana hendak  menggunakan
      sumber-sumber organisasi mencapai
                             bagi         matlamat.Pengurus
      mestilah            masalah
              menyelesaikan                   membentuk
                                   ataukonflik,
      suasana salingmempercayai membantu
                               dan           mengimbangi
            bekerja.
      situasi       Pengurusmestimembuat tindakanyang
      berkesan efisien
               dan      menggunakan  sumber-sumber organisasi
            parapekerja,
      seperti           kewangan,         mesin-mesin
                                  informasi          dan
      peralatan,bahan sebagainYa.
                     dan


                 matlamat
      Bagimencapai             pihakpengurusan
                         projek,             harus
              perhatian
      mengambil       tentang          penting
                             aspek-aspek     fingsi
               dari
      pengurusan segi:

      i.   Merancang

           Merupakan pertama penting
                   fasa    dan     dalam Pengurusan
           Pembinaan.

                            :
                    melibatkan
           Perancangan

           a.           yangmestidibuat.
                Penentuan
           b.   Bila.
           c.   Siapa.
           d.           pembinaan dijalankan.
                Bagaimana         itu

           Langkahpertama untukmerancang  adalahdengan
                       objektifataunnatlamat
           mengenalpasti                    projek.Semasa
           merancang,             pengumpulan dijalankan
                     aktiviti-aktiviti        data
           dankemudiannya maklumat   yangdiperolehi
                                                 akan
           dianalisa.

           Perancangan adalah         sepanjang
                             berterusan        tempoh
           projek.Perancangan                merangkumi
                                    dijalankan
                             mestilah
           inputdaripada          yang
                        orang-orang terbabit dalamsatu-satu
           projeksupaya perancanganadalahberkesan.
           Perancangan akanmempunyai
                       tidak              sebarang jika
                                                  nilai
           tidakdilaksanakan.
                                           PEMBINAAN
                           C 5011 PENGURUSAN


ii.    Mengawal

       Tujuannyaadalahuntukmelaporkansegalakerja-kerja
       penyenggaraan kelemahan
                    atau          yangwujudsupaya
       dapat            Semasa
            diperbetulkan.     mengawal projek,
                                              Pengurus
       menetapkantahappencapaian meningkatkan
                                dan
       penyenggaraan memperbaiki
                    dan            sebarangkelemahan
       supayaprojek             dalam
                   dapatdisiapkan     tempohmasayang
                  dengan
       diperuntukan      penggunaan sumbersecara
       optimum.

       Pengawalan projek
                       harus         dan
                            direkodkan dijalankanagar
                  pembaziaran
       tidakberlaku          sumberorganisasi juga
                                             dan
       sebelum       masalah
               berlaku      yanglebihserius.

iii.   Melaksana

             ini
       Aktiviti merangkumi  rangka
                                 kerjabagimasadan
       perbelanjaan.Semasa           Pengurus
                            melaksana,       projek
                       dan
       memperkenalkan mengamalkan               dalam
                                       kepimpinan
       perlaksanaandengan  caramembuat keputusan
       pengurusan. Pengurus akanmengeluarkanarahan-
       arahan        serta
              tertentu    memimpin,mengelola member
                                            dan
       motivasi.

            daripada
       Selain                kakitangannya,
                    mengarahkan         seorang
               juga
       Pengurus menguruskan penggunaansumberseperti
       peralatan,      dan
                kewangan sebagainya.


iv.    Mengarah

             di
       Arahan beriolehPengurus untukmelakukankerja
       seperti
             dikehendakisupayaprojek    dilaksanakan
                                    dapat
       se€ra berkesansebagaisatuberpasukan.
                                          Komunikasi
            pihak
       antara    pengurusan pekerja
                            dan       bawahan mestilah
       berkesan.Motivasi
                       untukpekerja
                                  mestilahbaik.


                                                    2l
                           C 5011 PENGURUSAN
                                           PEMBINAAN


C. TakrifProjek

    Safu siri tugas atau kerja yang utama yang
    dilaksanakansekali(one-shot)   dengan matlamat yang
    jelas dan perlu disiapkan dalamperuntukan masa
    yang terhadyang memerlukankomitmen kemahiran
    dan sumberyang berbagai.


1. Menurut Punmia danKhandelwal 19Bg:
                  P.C        K.K;   Projek
   boleh          sebagai:
        ditakrifkan

    Siri rangkaianaktiviti yang mempunyaitujuan
    tertentu,titik permulaandan titik tamatyang jelas
    bagi mencapai satu set objektif secara berkesan
    denganmenggunakansumber-sumberterhad yang
    diperuntukansecaracekap.


2. Menurut    Kerzner:
         Haroid     Projek
                         bolehditakrifkan
                                        sebagai:

    Sesuafuyang mempunyaititik mula dan tamat yang
    jelas,mempunyaiobjektif tertentu untuk di capai,
    mempunyai satu siri aktiviti kerja dan melibatkan
    penggunaansumber-sumberinput sepertitenaga,
    modal,bahandan peralatan.



D. TakrifPembinaan

    Membina sesuatupembinaan pihak
                             oleh    Jurubina
    (Kontraktor)tapakbinadariperingkat
              di                    awalpembinaan
    hinggasiap.




                                                        22
                         C 5011 PENGIIRUSAN
                                          PEMBINAAN


E.            Pembinaan
     Pengurusan

     Pengurusan Pembinaanmerupakan   penyelarasan
     kumpulan                yang
                    pengurusan melebihi
             aktiviti
     perkhidmatan tugastugas
                 atau           lazimbagiAkitek,
     JurukurBahan Jurutera
                  ,       sertaPerunding-perunding
     lainyangberkaitanmenguruskan sesuatuprojek
     pembinaan peringkat pembinaan
              dari        awal           hingga siap
     menggunakan sumber-sumber pengeluaran melalui
     satuprosessupaya matlamattercapai.

     Amalanpengurusan adalahkompleks  kerana
     diuruskan manusia.Segala perlaksanaan
             oleh               kerja
     sesuatu     kerjapembinaan
           aktiviti             menggunakan  teknik-
     teknik kemahiran
          dan                 hasilgabungan
                       tertentu             antara
                pengorganisasian,
     perancangan,                pengarahandan
     pengawalan pembinaan
               kerja          dalam sesuatuprojek.

     Pengurusan         dikendalikan pihak
                Pembinaan         oleh      yang
     membinasesuatupembinaanditapak
                                  binaiaitupihak
     Kontraktor.


F.            Projek.
     Pengurusan

     Mengurus projekadalahpencapaianutama yangpaling
     ungguldalam industri               projek
                       binaan.Pengurusan telah
     menjadicarayangamatberkesan  untukmenyatukan
                organisasi memotivasi
     fungsi-fungsi        dan          mana-mana
     kumpulan untukmencapai tahapprestasi
                                        yangtinggi
     danproduktiviti.

     Pengurusan projek memerlukan  penggunaanilmu
     pengetahuan, kemahiran, danperalatan teknik
                              logi         dan
                          projek
     ke atasaktiviti-aktiviti   agarmencapai
                                           objektif
     perlaksanaan projek.



                                                  ZJ
                    C 5011 PENGURUSANPEMBINAAN


Pengurusan projekmerupakan suatusuasanayang
melibatkanpengurusansumber-sumber terhadsecara
cekapbagimencapai        secara
                  objektif             bermula
                                berkesan
            permulaan
dariperingkat        sehingga penyerahanprojek
pembinaan kepada Pelanggan.


                   Projek:
        asasPengurus
Kelayakan

            teknikal
1. Pengetahuan

  Lebih            pemahaman berkaitan
              kepada
       tertumpu            asas
  aspek

  a. Rekabentuk.
  b. Sistemkejuruteraan.
  c. Pembinaan.
  d. Ekonomibinaan.
  e. Prosedurkontrak.
  f. Perundangan.
  g. Perancangan prinsip
                serta    pengurusan.

                       teknikal.
                   aspek
            sealiran
2. Pengetahuan

               komunikasi.
   a. Pengetahuan
               awam.
   b. Perhubungan
              manusia.
   c. Pengurusan
   d. Sikap.




                                             24
                                                   PEMBINAAN
                                   C 5011 PENGURUSAN




Kejuruteraan




                                        TeknologiBangunan
Akaun dan
Simpanan


                    Kewangan




Bidang Ilmu pengetahuanyang perlu dalam Pengurusanprojek




                                                            75
                                                            PEMBINAAN
                                            C 5011 PENGURUSAN


Rumusan.

Berdasarkan                 dan
           takrifan-takrifan konsep-konsep     pengurusan
projekdapatdilihat
                 bahawa          perancangan,
                          aktiviti            pelaksanaan
danpengawalan memenuhi
               bagi            kehendak  klienperlu
mengambil masa, dankualiti
         kira       kos             yangtelahditentukan
menjadisuatu       pengurusan
             kitaran            projek.Berikut      hasil
                                               adalah
darirumusan perbincangan Austendan Neale(1984)
            dan               oleh
yangmerumuskan         perancangan,
                 aktiviti             pelaksanaan dan
pengawalan adalah seperti        di
                          kitaran bawah.




                                  Merancang
                      .     Menentukan objektif.
                      .     Pengtajiansumber-sumber.
                      .     Membentuk strategi.




        Mengawal                                             Melaksanakan
r   Menilai pencapaiandan                              .   Mengagihkansumber-
    matlamat.                                              sumber.
r   Melapor.                                           r   Membimbingpelaksanaan.
.   Menyelesaikanmasalah                               .   Menyelaraskanusaha.




                                       proj
                      Kitaran Pengurusan ek




                                                                                    26
                                           PEMBINAAN
                           C 5011 PENGURUSAN


G.   Perhubungan               Pembinaan
                antaraPengurusan
     dengan PengurusanProjek

     Pengurusan  Projekadalah saling berkaitantara satu
     samalain. Jikatiadapembinaan  maka  tiadakerja
     membina  yangakandi uruskan sudah
                                  dan        tentutiada
     projekdikendalikan. adakerjapembinaan,
                        Jika                     maka
     perlukepada            mengurus
                  kerja-kerja         pembinaan yangakan
     dilaksanakan supaya siapmengikut  perancangan  yang
     dibuat.

     Pembinaan           projek
              dalamsesuatu     perlu        oleh
                                    diuruskan
     seorangpengurus pihak
                   bagi     Jurubina pengurusan
                                   dan
     projek    perlusupaya
          adalah          perlaksanaankepada
     perancangan
               dapat capai
                    di     denganbaikdengan
     pengarahan kawalan
              dan       olehseorang pengurusyang
     cekap.


     Pengurusan projekpadaasasnya  ialahmerancang,
     mengarah, mengendali mengawal
                          dan           mengenai sesuatu
          bermula peringkat
     projek        dari                dan
                               taklimat ideadariKlien
     kepada Akitekhinggalahsiap.Jikaprojekyangsederhana
     atauyangkecilatauprojek yangmenggunakan   kotrak
        jenistradisional,
     dari                         pengurus
                        penglibatan         projekhanya
     dariperingkatpembinaan hinggaprojek siap.Bagi
     kontrakjenisselain jenistradisional tender
                      dari               atau
     secaraRunding  Terus,

     Pengurus Projekbolehmemainkanperanannya dari
     peringkat
             awalcadangan  membinaprojek
                                       iaitubermula
     dariperingkat
                 insepsihinggalah
                                kepadapenyiapan
     projek.




                                                      27
                      C 5011 PENGIIRUSANPEMBINAAN


PengurusProjekakanterlibat                jenis
                                 kesesuaian
                          mengikut
tender jugakontrak
     dan             yangdigunakan.
        kerjapembinaan
Peringkat                dalam      projek
                              sesuatu
adalah      berikut:
      seperti

1. Insepsi

              awalprojek,
  Padaperingkat          pelanggan /Klienakan
  menyatakanimpiannyakepada AkitekKlienakan
  membertaklimat maklumat
                dan         tentang kehendak-
  kehendaknyakepada       Pihak
                    Akitek.    Akitek pula
              semua
  merealisasikan             dan
                     maklumat impian    Klien
  dalambentuklakaran.

  Bagiprojek yangbesar atauTender        Terus
                                   Runding
  ataukontrak  secaraRekadanBina,         B.O.T,
                                   Turnkey,
  dll.; PengurusProjekakan       dalam
                          terlibat     memberi
  pandangan  , nasihat jugacadangan
                     dan              yangsesuai
  mengenai            yang
            pembinaan akan
  dilaksanakan.Pengurus perlumenyiasat
                        Projek              atau
  mengenalpasti  konsepprojekpembinaan secarakasar
  seperti yangdikehendakiolehpelanggan.

2, KajianKemungkinan

   Merupakan peringkatuntuk memikirkan langkah awal
   yangperludibuatbagimemastikan          projek
                                    sesuatu
   yangdicadangkan dapat dilaksanakan dengan jayanya
   bagimencapaiobjektifpembinaan   yangdicadangkan.
   JikaPengurusProjek        padaperingkat , beliau
                      terlibat             ini
   perlumengkaji
               samada   projek tersebutdapat
   dilaksanakan sebaliknya
              atau            dengan
   mempertimbangkan aspek
                     setiap             kewangan
                                  seperti
            keadaan
   dan buget,        ekonomi, turunkadar
                               naik          harga
   di pasaran       dan
            semasa lain-lain.




                                                 28
                                       PEMBINAAN
                      C 5011 PENGIIRUSAN


           rekabentuk
3. Peringkat

  PengurusProjekmemainkanperananpenting
                                      dalam
  mengendali melaksanakan
            dan                     lukisan,
                           rekabentuk,
          pelan
  kelulusan    dariPihak       Tempatan
                        Berkuasa        yang
  berkenaan sebagainYa.
           dan

           Tender
4. Peringkat

            projek
  Jikasesuatu    menggunakan Tenderjenis
           Pengurus
  Rundingan,                   secara
                        terlibat
                   Projek            langsung
                    yanglayak.
            Kontraktor
  bagimemilih

5. PeringkatKontrak

  Bagiprojek  yangmengggunakan khidmatPengurus
  Projek, makaseorang PengurusProjekpadaperingkat
  ini perlumemastikan              yang
                     wujudperjanjian sempurna
  antara                          prosedur.
                           mengikut
         Kliendan Kontr:aktor
  Dokumen                  di
                   mestilah sediakan
             Kontrak                dengan
  lengkap  lengkapuntukditandatangani.


           Pembinaan
6. Peringkat

   Bagiprojek yangmengggunakan   khidmatPengurus
   Projek,maka seorang Pengurus      padaperingkat
                                Projek
   ini perlumemastikan          pembinaan
                      kerja-kerja          projek
   ditapak binadilaksanakanmengikutseperti yang
                                          apa
   dinyatakan dalamdokumen  kontrak.Pengurus Projek
   perlu merancang, mengelola,mengarah dan
   mengawalmasa,    kualiti kosbagikerja-kerja
                          dan
   pembinaan  menggunakan  sumber-sumber terhad
   supaya         perlaksanaan
           objektif           projek
                                   tersebuttercapai.




                                                 29
                        C 5011 PENGTIRUSAN
                                         PEMBINAAN

   Apa-apaperubahan pertikaian
                     dan         semasa  pembinaan
   mestilah
          mengikut  seperti
                          yangterdapat dalam
                                      di
   borangkontraksetara sepertiyungdigunakan daram
   Dokumen Kontrak yangtelahoipersetJjuiantaraKlien
   dan Kontraktor.
   Pengurusprojekmesti menggunakan segala
   kepakaran,
            keupa  yaan,pengetanu"nr"iu
   pengalamansecara  cekapdanberkesan.
   Pengurusprojek
                pihakMajikan
                           akanmemantau
                                      kerja-
   kerjapembinaan pihak
                oleh     Kontraktor.
 7. Penyerahan

   sebelum projek
                diserah    pengurus
                      mirik,        projekperru
   memastikanprojekyangdikendalilian beliau
                                  oleh
   memenuhi segarakeperruan terah
                          yang     ditetapkan
   olehPihakberkuasasebelum Layak
                           sijil    Menduduki
   dikef
       uarkan.

8. Penggunaan penyenggaraan
            dan

   setelahprojekpembinaanborehdiduduki oreh
   pengguna Klienakanperlusentiasamembuat
  penyenggaragnmanaperlu.
                 di          pengurus projek  perlu
  memastikan Klien  mematuhi
                           perkara-perkaradan
                                          ini
  jugahal-haryangberkaitandengan pirratBerkuasa
  Tempatan.

Kesimpulannya:

Kerja'kerjapembinaanperru merarui
                               peringkat-peringkat
di atas.Bagimelaksanakan
                       projekpembinlan
memerlukan  kepada
                 seorang pengurus projek
                                       tetapi
mengikut kesesuaian
                  projek.

Sesuatu
      pembangunan  memerlukansebidangtanah.
Sesuatu
      pembangunan melibatkan
                           perlak""n)"n
pelbagai
       projek.
             setiapprojek
                        meribatkan
                                 pembinaan

                                                30
                            c s011PENGURUSAN
                                           PEMBTry{AN

pelbagaibinaanbangunan kerjaKejuruteraSn
                         dan                 Awam
(lnfrastruktur). itu Pengurusan
             Oleh                 Pembinaan dan
Pengurusan  Projekperlu  seiringdansalingberkaitan
antarasatusamalain.
Perhubungan  Pengurusan   Pembinaan   dan
Pengurusan  Projekperluseiring.
Pengurusan Projekamatpenting   dalam sektor
pembinaan. lanyaboleh lihat
                      di     dalam (3)sudutiaitu:
                                   tiga

i. Masa
ii. Kualiti
iv. Kos

                                              Kualiti




       Ekonomi




                  Munasabah




     Perkaitan antara Kos, Kualiti dan Masa




                                                        a1
                                                        JI
                                   C 5011 PENGURUSAN
                                                   PEMBINAAN


1.4.1 Perbezaan              pembinaan
              KonsepPengurusan
     dan Pengurusan
                  Projek.

     Peringkatpembinaanadalah berkaitterus dengan
     pengurusanprojek di manaPengurus   projekakan
            dalamperingkat
     terlibat              awalperancangan projekatau
     pembinaan  hinggalahprojekataupembinaan siap
     sepenuhnya  mengikutjenistawaran danjuga kontrak
     yang digunakan bagisesuatu projekyang
     dicadangkan.

    P e m b i n a a n o le hm e lib a tkasa tuje n isp e m b in a a n
                       b                     n
    ataulebihdi tapakbina.sementara                   projekpuraterdiri
    d a r il e b i hd a r isa tuje n isp e m b in a a n a la msa tuta p a k
                                                      d
    bina.

    Contoh:

    s a t u t a p a kb i n ab a g ica d a n g a n e m b in a 0 lo t r u m a h
                                                m           1
    teressetingkat TamanSelesa.
                           di

    Bagimelengkapkan lot rumahteressetingkat
                                    10                               perlu
    a d a 1 0 l o t r u ma hja la nm a su k, la nd i ka wa sa n
                                ,               ja
    p e r u m a h a n , gsa m p a h p e r h e n tia b a s,la n ska p ,
                        t on               ,            n
    l a m p uj a l a n , p e r kh id m a ta n       ,
                                          ta liko mp a ipb o m b a ,
                     ,
    l o n g k a n gd a n la in - la in . r ka r a i a d a la h
                                      Pe         in
    projek.Pembinaan membina     ialah             satu-satu   jenis
    pembinaan          bagimenyiapkan         projek.




                                                                         )z
                                        C 5011 PENGURUSAN
                                                        PEMBINAAN



                    Perbezaan    Konseppengurusan
       Pengurusan         Pembinaan Pengurusan    Pro
       Kontraktor     akan            Pengurus Projek pihak
                                                     dari
       meng ruskankerja-kerja Klien
             u                             akanmerancang,
       p e m b i n a a n u p aya
                       s              mengelola,mengarah  dan
       mengikut     masakualiti  dan mengawal  perjalanan kerja-
       kos yang ditetapkan            kerjapembinaan oleh
                                      supayasemua  kerjabagi
                                      sesuatuprojekyang
                                      dilakukan pihak
                                              ofeh
                                      kontraktor tapakbina
                                              di
                                      mengikutmasakualitidan
                                      kosyanoditetapkan.
       Kontraktor    akan             PengurusProjekakan
      memastikan         keseluruhan        memastikan      Kontraktor
      p e m b i n a a n a l a mse su a tu
                        d                   melakukan     kerjapembinaan
      projekditapakbina                     sesuatu   projekdi tapakbina
      d i l a k u k a n e n g i ku t
                      m                     d ila ku ka n e n g iku t
                                                        m
      peringkat      pembinaan       dan    peringkat   pembinaan      dan
      kaedahseperti dalam   di              kaedahseperti dalamdi
      dokumen        kontrak    yang        dalamdokumenkontrak
      ditandatangani Klien  oleh            ya n gd ita n d a ta n g ao le h
                                                                      ni
      dan Kontraktor.                       Kliendan Kontraktor.
      Kontraktorperlu                       PengurusProjekyang
      memastikan penggunaan                 menguruskan projekperlu
      sumber-sumber terhad                  memantau penggunaan
      diuruskansecara cekap                 sumber-sumber terhadoleh
      supayatidakmengalami                  Kontraktor
                                                    semasa
      kerugian.                             melaksanakankerja
                                            dikendalikan
                                                       dengan baik
                                            dancekapsupaya
                                            Kontraktor kerugian
                                                    tidak
                                            danmengelakkan projek
                                            Klie nte r b e n q ka la i.

Jadual perbezaan
               konseppengurusan
                              pembinaandan pengurusanprojek.



                                                                          JJ
                                      C 5011 PENGURUSAN
                                                      PEMBINAAN


                 Perbezaan
                         KonsepPengurusan
B i I PengurusanPembinaan PengurusanProjek
4 . Kumpulanaktiviti-aktiviti Pengurusan                   projekoleh
                        n
      P e n g u r u s a m e n g u r u ska n seorang   Pengurus    boleh
      kerjapembinaan           sesuatu menjadicarayang amat
      projekperlubekerjasama berkesan                  untukmenyatukan
      antarasatusama lainbagi fungsi-fungsi                 organisasi  dan
      memastikan       kerja-kerja          memotivasi    mana-mana
      p e m b i n a a n i u r u ska n
                      d                     ku m p u la n n tu km e n ca p a i
                                                        u
      dengancekapterutama                   tahapprestasi    yangtinggi
      o l e kk u m p u l a ne kn ikad a n dan produktiviti
                           t          l                        terutamanya
      pekerja    dipihakKontraktor terhadap            pihakKontraktor
      bagimenyiapkan           projek       bagi menyiapkan      projek
      Klien..                               Klie n .

5.    PihakKontraktor         perlu      Pengurus     projekperlu
      berpengetah tentang
                        uan              mengetahui      tentang
      perkara-perkara        teknikal,   perkara-perkara kal, tekni
      k o m u n i k a s ia n
                      d                  ko m u n ika sia n
                                                        d
      perhubungan        awamantara      perhubungan      awamsupaya
      pihakKontraktor pihak  dan         bolehmemantau         kerja
      KliensertaPihakBerkuasa            Kontraktor    supayamematuhi
      Tempatan(PBT).                                                ak
                                         ke h e n d a k- ke h e n dPih a k
                                         Berkuasa     Tempatan     supaya
                                         projekpembinaan         Kliensiap
                                         d e n g a n m p u r n a a n b le h
                                                    se           d
                                         mendapatkan Layak Sijil
                                         Duduk(CF)dari atau PBT
                                                             n
                                         Sijilp e m a tu h a d a n
                                         Penyiapan     (CCC)dariAkitek
                                         ya n gd ila n tik.
6.    PihakKontraktor          Kemaskini Pengurus
                                                Projekmemantau
                     t
      m a k l u m ap e m b in a a n a n perjalanan
                                  d              jadual
                                                      dankerja
      perjalanan     jadualdan kerja sebenar   pihakKontraktor.
      sebenar     secarabulanan
      a t a um i n g g u a n .

     Jadualperbezaan
                   konseppenglrmsan
                                  penrbinaan pengumsan
                                           dan       projek

                                                                         .A
                                                                        -)+
                                                               C 5OII PINGTJI<(JSAN
                                                                                  I,IJMI,INNNN


                            1.4 .2 Perbezaan
                                           StrukturOrganisasi                                 '' '')'
                                                                                 ,,-,              /    (       r
                                                                                                                    't\,
                                                                                                                           t::1,



 "
                                   A.     Orga nisasi                        (     \,r
                                                                                       6 J-   \(

         c ' r t r,|
        *)             n r l l q - .1                                                                       r       " t.':,- .'
".,g --
                       3"alf              Organisasi
                                                   adalahsuatukumpulan       yang
                                                                      individu
                                          dihubungkandenganeratdalamsesuatu hubungan
                                          formaluntukmencapai
                                                            sesuatumattamat.

                                   B. StrukturOrganisasi

                                          strukturorganisasiadalahbagi memenuhiputaranera
                                          pengurusan sendiriterutamanya
                                                     itu                   apabilamasalah
                                          baru dihadapiatau akan dihadapi,lanyaberkairapat
                                          denganketepatanmembuatkeputusan     datamsesuatu
                                          projek.

                                        . Sesuatuorganisasi dipengaruhi
                                                                      oleh peringkat_
                                          peringkatyang akan digunakansepertijangkauan
                                          kawalan.organisasi juga akanmemberikesankepada
                                          kitaranhayatdan juga kejayaanorganisasi.

                                         1. KepentirlganStruktur Organisasi

                                            a. Mengeluarkan  ataumenghasilkan
                                                                            output
                                               keorganisasian juga untukmencapai
                                                              dan
                                               matlamat               juga
                                                        organisasi.lanya dapatmencapai
                                               tujuan-tujuan
                                                           yangdirancangataudibincangkan
                                               dengansempurna.

                                            b. Menimimumkan sekurang-kurangnya
                                                            atau
                                               mengaturpengaruh'individu pelbagai
                                                                     yang
                                               dalamorganisasi.Dapat
                                                                  meletakkan
                                                                           perkara_
                                               perkaramustahak
                                                             dalammelahirkan
                                                                           hubungan
                                               yangsistematik.
                            C 5f)I I I,I]NCiTJI{USNN
                                                   i'IiMIJINANN


         c. Struktur
                   merupakan kuasa
                             satu      yang
            dilaksanakan keputusan
                        dan          dibuat
                                          mengikut
            fungsisesuatuorganisasi.lanya
            mempercepatkan sesuatutindakanuntuk
            mencapai pencapaiansesuatumailamat
            organisasi.


C.    KonsepPengurusan Struktur
                     dan
      Organisasi

      Dua konsepasasperludipatuhi
                                iaitu:

      i. suatu kepercayaan
                         atau penerimaan
                                       kepimpinan.
      ii. Penurunankuasa

     Sistempengurusan
                    yang baik amatpentingdaram
     men$uruskan      projekbinaan.pengurusan
                sesuatu
     mempunyailimaaspekutamaiaitu:

        Meramaldan merancang
        Menyusun
        Mengarah
        Menyelaras
        Mengawal

     Pengurusan    melibatkan prosesbukansahajateknikal
     tetapijuga sosial.lanyatidak bolehdijelask-anatau            ('
     difahami,  apatahlagiuntukdipraktikkan  kecuali
                                                   dalam
     erti kata dimensiperlaksanaan juga tuntutan
                                    dan
     perlaksanaan atasnya.pengurusan
                     ke                    juga
     memerlukan'keputusan'     dibuatdan seierusnyu
     keputusan perludijalankan
                 itu               ataudilaksanakan  oleh
     oranglain.lanyamelibatkan    sumberterhad.Melalui
     keputusan,   penghasilanyang maksimum    pada
     penggunaan    sumber  yang minimum  akan
     dicapai-Maka    prosespengurusan mempunyai  ciri-ciri
     ekonomi.


                                                           36
                                        C 501I t'trNai{JI{tJSAN
                                                              I,tiMIrtNnnN

              Struktur           juga
                       organisas.i m.emainkan      peranan  penting
              dafam  projek pembinaan manastruktur
                                        di              pengurusan
              dancarapasukan    dibentuk   akanmemberi   imprikasi
              kepada   seluruhputaran  sesuatu projek.strukiur
              organisasi ditakrifkansebagai  satuiorak perhubungan
              yangtelahditentukan antara
                                    di        komponen-komponen
              organisasi yangmenggariskan     komunikasi,
              pengawafan autoriti.
                           dan          Strukturorganisasijuga
              membezakan    antara perbagai  bahagian orgunirusidan
              menggariskan   perhubungan   antaramerek lujuga
                                                       i.
              merupakan pengagihan
                          satu              tenagadan mekanisrne
             penyelarasan   mengikut  hiraki.Struktur
                                                    organisasi
             dapatdigambarkan    merarui cartaorglnisasi.
                                         satu
             sesuatu   struktur
                              yangboreh    menyumb"rig  kepada
             kej.ay orga isasimestilah
                   aan      n                   pu
                                            mem nyai bebe   rapa
             ciri-ciri
                    serta sifat-sifat
                                    yangdapatmemberi     kesan
             terhadap:

             i.     Kejayaan
                           organisasi.
             ii.    Komunikasi-komunikasi pelbagai.
                                       yang
             Inidapat
                    ditunjukkan
                             seperti daram
                                  di     jaduar bawah.
                                              di
 Ciri              sifat             Kesanatas       Kesanatas
                                     kejayaan        komunikasi
    otruKrur asas      Bolehlentur.
                   a
                                        Menyokong . Tiadasaluran
                   o  Bolehsuai.        perubahan.      komunikasi
                                                        rutin.
                                                     . Tiadaingatan
                                                        keorganisasian.
2. Pembahagian Kuasa                 . Memberi     I . Memerlukan
   buruh              terpancar.       ruang           orangtengah
                                       kebebasan.      untuk
                                                       menyafurkan
                                                       maklumat
                                                       diantara
3. Autoriti                                            tugasan.
                  . Mendatar        . Pakar-pakar . Menggalakkan
                     berasaskan        mengetuai       komunikasi
                     funqsi.           tuoasan         tidakformal.
            Struktur
                   yangmenyumbang
                                kejayaan
                                       polisiorganisasi.

                                                                     1'1
                                                      C 5()II PI,NGURLJSN PI'Mi]JNANN
                                                                        N


                   D. Takrif Struktur Organisasi
I n 9 't, 'a ' n


     ttyV 'fn '
                       a. Child (1977:10)
                                        mentakrifkan
                                                  struktur
    :.. ?.Y '1a           organisasi
                                   kepada komponen
                                          3         utamaiaitu.
                       i. Menandakanperhubunganpelaporanformal
                          termasuk
                                 bilangan-bilangan dalam
                                                tingkat    Hiraki ydu I
                                                                ,   dc
                          danjangkau      bagipengurus-pengurus
                                    kawalan                    dan
                          Penyelia.

                      lt.     Mengaitkan kelompok-kelompokindividukepada
                              jabatan-jabatan kelompok-kelompok
                                            dan                  jabatan
                              kepada organisasi
                                              seluruhnya.
                                                                                          {
                      ilt.   Pencorakan  sistembagimemastikan  komunikasi,
                             penyelarasan pengintergrasian
                                          dan               usahayang
                             efektifkeselu hanjabatan-jabatan.
                                         ru

                     b. Nich ola s(1990: bab dan juga G us wor t h
                                           7)
                             dan Franks91993:bab maka takrif
                                                  4),
                             struktur organisasiadalahseperti
                                                            berikut:

                             corak perhubunganyang telah ditentukandi antara
                             komponen -komponen organrbasi ng
                                                          ya
                             menggariskankomunikasi,pengawalandan autoriti.
                             struktur organisasi
                                               membezakandi antarapetbagai
                             bahagian organisasidan menggariskan                          f
                             perhubu n antara mereka.
                                    nga

                      c . M i n t z b e r g (1 9 7 9 ) p u lam e n g e n ap a sti:
                                                                          l

                            struktur asas organisasi
                                                   sebagaipengagihan buruh
                            (supayasefr'ap ahli membuatsumbaigin yarg
                            berbeza-bezaterhadap kerja)dan mekanisme
                            penyelarasan  (supaya kesemuausahadapat
                            diintegrasikan).



                                                                                     JO
                     C 5 O II I ' I J N(; URI J S A N I ' MI ] I NA A N
                                                    I,


 d. Bfau(1gTg:12)mentakrifkan
                            struktur
    organisasi
            sebagai:
  Pengagihan,sepanjangpelbagaibarisan,
                                     antara
  orang-orang
            a.ntara
                  perbagaikedudukansosiaryang
  mempengaruhi perhubunganperananantaramereka
  itu.

e- Half(1982:53-54) menyatakan takrifBrauitu
   memerlukan  peluasan atasduaperkara, iaitu
   pengagihan (yakniorangyangdiberitugasan   atau
   kerjayang berbeza datamorganisasi),
                     di                 dan
  organisasi sendiri
            itu       yangmempunyai atau
                                      iaraf
  hierarkinya(iaitukedudulianyangorangitu pegang
  mempunyai   kaedah dan peraturan
                                 yangmenyatak-n
  dalampelbagai  tahap;carakewajipan f,enu
  dilaksanakan dafam kedudukan tersebut).


f. Meltsner dan Beilavita (1g83:142):
 sesuatu struktur
                organisasi
                         mengandungi  organisasi
 samaseperti struktur
                    rumah  bagisebuahrumah.
 Struktur
        iarahsesuatu yangr"fltukkun org.nisasi
 dalamsuatu suasana tugai.
        jugaialah
 Struktur        yangmengikat organisasi
                            ahli
 bersama-sama datamusaha
                       hereka me"ncapai
 matlamatdengan menetapkan
                         tugasan,peranan,dan
 tanggungjawab.

Struktur
       iafahsesuatuyangorganisasigunakan
untukmencapai maflamatnyamelalui
                               pinggrnu"n
sumber yangsedikit.struktur memperjeraskan
                        juga
corakperhubunganantara
                di       bihagian_U"h"gi"n
sesuatuorganisasi. menghuiaik;h
                la             kaedahiyang
menentukan bahagian-bahagian
           cara                itu berkait
berinteraksi                             dan
          (Meltsner Belluuitu
                   dan         1983:Si).

                                                              l9
                                                                   C 5 0 1 | P I NG (J f iU. S A N, I : MI ] I NA A N
                                                                                                 I


!i {       f t rr,rlf     cloo,tt\ /,4t,      g. Draft 1989): Struktur
                                                                     organisasi
                                                                              cligambarkan cJi
       r, rt iit        ada     cot\q            dalam cartaorganisasi.
                                                                     cartaorganisasi suatu
                                                                                     ialah
                   r,oohi(dft                    carlayangmempamerkan   semua aktiviti
                                                                              set       dan
                                                 prosesdalam sesuatuorganisasi
                                                                             (Draftl g8g).


                                           E. Tujuanmewujudkan
                                                             strukturorganisasi

                                              struktur
                                                     organisasi  adalahuntukmemenuhiputaran
                                              era pengurusan sendiri,
                                                             itu       terutam
                                                                             anyaapa.bila
                                              masalah  barudihadapi akandihadapi
                                                                    atau           (Galbraith
                                              1s71).

                                              strukturorganisasi
                                                              dibentuk memperlengkapkan
                                                                      bagi                                                  {"
                                              diriorganisasi sendiri.
                                                          itu


                                              Menurut  Paulson,Fondahldan parker (1992),
                                              strukturorganisasimemangberkaitrapatdengan
                                              ketepatan membuat   keputusan dalamsituasi
                                              projek.Jikastruktur
                                                                organisasi pincang
                                                                          itu        dan tidak
                                              teratursertatidakmenepati kehendak  projek,maka
                                              keputusan yangtepat berkaitan projekmungkintidak
                                              dapatdibuat.

                                              Jelasdi sini,sesuatustruktur        yang digubal
                                                                         organisasi
                                              dapat digunakan untukmencapai tujuantertentu.
                                                                                          Maka
                                              strukturorganisasi
                                                               dapatdigambarkan  dengantiga (3)                         (
                                              sifat(Meltsnerdan Bellavita1983:142):


                                              a. Sifat-sifat
                                                           strukturorganisasi.


                                                 i. Bentuknya
                                                            yangtidaktetap.
                                                    Bentuknya tetap
                                                            tidak    danmengikut
                                                                               keperluan.



                                                                                                               40
                           (: 5OII I'IJN(JTJIt(
                                            JSANI'IiMIJINNAN

          ii. Perluadasifatkebolehlenturan.
             perluadasifatkebolehlenturan
                                        dan boleh
             menerima apa_apa perubahandan perkara_
             perKarayangberkaitan.

          iii. perfuadasifatkebolehsuaian.
             perru adasifatkeborehsuaian bofeh
                                       iaitu
             menyesu  aikandengankeadaan,
             kehendak,tugasan lain_lain.
                              i"n


F.    Prinsip-prinsipyang perlu dipatuhi. z) \tc

      Berdasarkan (3)sifatdi atas,semasa
                tiga                      merancang
      dan menubuhkan struktur
                            organisasi, (3)prinsii
                                     tiga
      yangmenjadikonsepasas pertu dipatu-hi
                                          :
     a' suatu kepercayaan penerimaan
                        atau       kepimpinan.
       Suatuaspek perancangan unsur
                                  pengurusan dan
       menitikberatkan
                     tentangpenentuan spesifikasi
                                    din
       segaratanggungjawa tertentu genai'pergeraka
                         b       men
       dantugas samping                          n
               di         segala
                               hubunjun yung
       berkaitan.

     b, Penurunan
                kuasa.

      satu rangka
                kerjauntukmenjatankan  tanggungjawab
      pengurusanuntukmemberikuasa  tanggungjawab
      berkenaan penyerarasan
               bagi            aktiviti oorongan
                                      d"""n
      ahlinya.
             corakstruktur
                         mestirah
                                diarahkan  untuk
      mempertingkatkan kerja
                      mutu    daram  semuabidang
      pengurusan.




 c. Struktur tidak beku atau kekal.

                                                      ,+ l
                                  C 5 0 1 I ' llNG t J I rliS iA N, I , Mt J I NA A N
                                         I                       I



      lanyamestilah dibentuk
                           untukmenerima  segala
      perubahan apabiladiperlukan.Tujuan
                                       konsepasas
      penubuhan  struktur
                        organisasi
                                 ialahsupaya
      organisasiberkembang manaagenatauwakildi
                           di
      setiapperingkatsentiasa
                            bersedia untukmemberi
      tindakbalaskepadaapa-apa keperluanprojek.

      Sebarangstruktur
                     organisasi
                              yangpenuh bermakna
      perlumenunjukkan      jelasgaris-garis
                       dengan             kuasa
      atauautoriti
                yangbergerak ataske bawah.
                            dari


G. Pemilihan
           strukturorganisasi.
                                                                                        {

   Pemilihan struktur
                    organisasiyang relevan
                                         adalah
   penting supayaianyaadalahberbentuk  serbaboleh,
   iaituprojekbolehdibinadi sekitar
                                  tugasan; juga
                                         dan
   apabilatugasanitu berubah.Oleh bentuk
                                  itu
   keorganisasian,padasatuhujungterdapat organisasi
   tulenprojek.

   Pengurus projekdiberiautoriti
                               sepenuhnya
                                        untuk
   menjalankan projeknyaseolah-olah satusvarikat
                                   ia
   satu produk.


   i. Saizdanjangkamasaprojek.                                                          (
    Projek
         yangbesarsaizsertaperbelanjaannya dan
    panjang        perlukepada
           hayatnya,           suatustrukiur
    organisasi
            yangberautoriti luas.
                          lebih




  i i . S u m b e rD a l am a n , p a ka r a n a n p e n g a la m a n
                                 Ke             d
       d a l a ms e s e b ua ho r g a n isa sin ya .

                                                                             A1
                                                                             aa
                         C 501 PIlN(;t_JIttJSAN
                              I               I,tiMfltNAAN



    Bergantungpada masayang ada untukmenyusun
   projekdanjuga peruntukan iewangan yang
   mencukupi.Jika organisasi tida[ aoi pengaraman
                            itu
   atau belumcukup pengafaman   dan masaamat
   terhad,maka strukturmatrikstidakdigarakkan.

 iii. Wujud perbezaan.

   Aktivitiprojekadarahberbezadaripadaaktiviti
                                              atau
   perniagaan  ata-u
                   bidangkerjabiasabagisesuatu
   firma atausyarikattertentu.
                             Jika masaian kos
   adalahpentingmaka autoritipengurus  projek
   mestilah kukuh.

iv.Pengaruhteknologi

  Jika tahappengguhaan teknologi
                               bagisesuatu
  projekorehsesuatuorganisasiberad"a
                                   padatahap
  stabilmakastrukturorganisasi
                             kefungsian
                                      adarah
  diperfukan.

  Jika teknorogiyarg digunakan
                             cepatberubah  dan
  wujud banyakketidakpastian,maka strukturmatriks
  atau struktur
              organisasiseparuhprojekoigatard(an.
  tni semuabergantung
                    padapengataman    organisasi
  tersebut                 jutoriti yang
          dalammengendalikan
  berbeza-beza.

v. Tahap ketidakpastian
                      kewangan

  Hal ini merupakanrisikokepadakrieniaitusejauh
  mana kliendapat mengawai  projek.


 ,!ka projekmenggunakan kontrak kos tambah
 (cost plus)akan.
                mewujudkan ketidat<pastian
 kewangan  yang banyari
                      seperti
                            perubahan teknorogi


                                                    43
                          C 50II I'IJNCJIJI{IJS;AN
                                                PEMI]JNAN
                                                        N

       dan undang-undang peraturan
                      atau        yangpesat
                                          akan
       menimbulkanbanyak
                       kepastian.

       organisasi yangkurangpengaraman  mengendarikan
              yangberbeza-beza
       autoriti                lebihbaikmenggunakan
       struktur organisasi
                         separuhprojek
                                     daripadi
       menggunakan   struktur
                            matriks.

     vi. Bebankerja

        strukturyangmempunyai  autoritiyangkuatperlu
       kepada  penumpuan  masaotehpengurus   projek
                                                  dan
       jugakakitangan projek.Masatah munqkin ikan
             jika
       timbul projek   bagisesuatuotguniiusi berjatan
       serentak, makaperkara autoriti
                                   sukaruntuk
       disalurkan secaraberterusan penumpuan
                                 dan             oreh
       pengurus  projek
                      ataukakitangan  projekakan
       berkurangan sesetengah
                    bagi          projek.
    vii. Kawafan danjadual kerja
               kos

       Jikasesuatu
                 projekmementingkan danjadual
                                 kos
       kerja,
            makaautoriti
                      yangadapadaprojekadarah
       tinggi.

                 pengurusprojek
    viii. Komitmen

       Kedudukanpengurus projek akanmenentukan
       kedudukanstrukturautoritiprojekbagi
       keseluruhan
                 organisasi
                          sesuatu firma.
                                       Semuaini
       adafahbergantung:

       a. Kepada siapapengurus
                             projekakanhantar
          laporan.
       b. Sejauhmanapengurus projek
                                  akan
          menyediakanlaporan
                           sesuatuprojek.
H. Jenis-jenis Struktur Organisasi



                                                     44
                                   C 501i ptiNctJItUSAN I,IIMIIINAAN


      Terdapat beberapafaktor
                            yangperrudiambirki daram
                                            ra
      menentukan  pemirihan
                          strukturorganisasi.
                                           Antara
      faktortersebut
                   ialah:

       i.   Saizdanjangkamasa  projek.
       ii.  Sumber dalaman,kepakaran pengalaman
                                     dan --
       iii. dalamsesebuah organisasinya. '
       iv.  Wujudperbezaan segi ai<tiviti
                           dbri          atau
      v.    perkhidmatan fasa.
                        atau
      ui. Pengaruh  teknologiyangdigunakan.
      uii: Tahapketidakpastiankewangan.
      viii. Bebankerja.
      ix.   Kawalan danjadualkerja.
                   kos
      x.    Keadaanorganisasipemilikatau
                                       klien-
     Terdapat perbagaijenis
                         cartaataustruktur
                                         organisasi.
     struktur
            organisasi
                     mestilahberbentukserbaboleh.
     Hampir kesemua organisasi
                             memformarisasikan
     struktur
            mereka mefarui
                         penggunaan cartaorganisasi.
     Terdapat beberapajeniscartaataustrukturorganisasi.
     Setiapstrukturorganisasi
                            mewakirijenisstruktur
     organisasiprojekdanintergrasinya.
       jenis-jenis
  Antara         strukturorganisasi
                                  tersebut
                                         iarah.
 i.    Struktur
              organisasi
                       menegak(mititari).
ii. Struktur
           organisasi
                    mendatar.
iii. Struktur
            organisasi
                     kefungsian.
iv. Struktur
           organisasi
                    produk.



V.     Strukturorganisasimatriks.

v t. s t r u k t u r o r g an isa si cu ka n /g a b u n g a n
                                   ka                      se m u a d i
       atas.

                                                                    '15
                                                        C 50I I PTJNGUI{IJSAN
                                                                            PI'MT}INAAN


                                vii- struktur organisasiBerbentukRangkaiankerja
                                      keorganisasian.
                                viii. Struktur Berasaskankawasan.


                         t.   StrukturOrganisasi
                                               menegak
                                                     (militari).
*
    ^'(c rhnn
                ohf
                Ir
                      4\Can   fa berdasarkan  amalanpihaktentera.lanyamenunjukkan
                              aliransecaramenegakdari atas ke bawah.Jalinankuasa
                              adalahdaripada   atas ke bawah.Arahanadatah jelas (line
                              of authority).
                                           Alirankomunikasi, kuasa,pelaburan,
                              tanggungjawab   serta rantaianarahandalahsecara
                              menegakdari atas ke bawah.
                                                                                          I
                              Buruhdikelaskan  mengikut
                                                      kepakarandan denganitu
                              arahanam sudahmemadai    namunbegitupenyLlia
                              perlulahdari kalangan
                                                  yang berpengalaman.
                                                                    walau
                              bagaimanapun   Penyelia
                                                    hendaklah
                                                            orangyang
                              berpengafaman ini sukaruntukdicari.
                                             dan


                              Di Malaysiakebanyakan jabatankerajaan danjabatan
                              berkanunmengamalkan  sistemini.Jika ada yangsakit,
                              maka perlulahada orangyangmenggantikannya.




                                              Menteri


                                             Len-rbaga

                                                                                  16
                                   C 5()1 I'IJN(;IJ'{IJSAN
                                         I               I,tlMI]INAAN




                      TimbakanPengurus
                           Besar



Timbakan       Timbakan     Timbakan
Pengurus                                                Timbakan
               Pengurus     Pengurus
  Besar                                                 Pengurus
                 Besar        Besar
                                                          Besar




           Penyelia


            C.ontohcarta organisasi
                                  menegak(rnilitari)


 Daripadacontohcartadi atasdan juga
                                    sifatstrukturorganisasi
 menegak,beberapa perkara yang ieruuanpertudi rihat:
 1.   Perhubungan elaburan.
                p

      Perhubunganpetaburan sebutjuga
                              di             sebagairantaian
      arahan-Menurut  Daft (1989:213), ;;;;n    arahanautoriti
      yangmenghubungkan    semuapihakdi daramorganisasi
      tersebut
             tidak notehputus-ra jrg3 ;u;g;,"barkan siapa
      yang mefaporkansesuatu                 -
                              kepa"d",qup""l
2.    Pengetompokan   bahagian_bthtgia;.

      Setiapkerompok diwujudkan
                              berasaskan
      (tugas                           fungsikerompok
            dan kerjakefompok).
                             MenurutRanson,Hinings

                                                              47
                                  C 501 I'tiNctjftt/SiAN
                                       I                ptlMlilNnn N


        dan Greenwood  (1980),
                             kaedah pengefompokan acJalah
        berkesankerana pekerja
                             dafam setiapkelompok
        mempunyai ketua.
                  satu      setiapkelompok sama-sama
        bertanggungjawab atasprestasi
                        ke            kerjadan mereka
        salingmembantu.Masalah dihadapi
                               yang        ialah
        penyelarasan antara
                   di      satukelompok dengankelompok
        yanglain.
,/..
i3,.r Rantaianmaklumatmenegak.

        MenurutDaft (1g8g)iuga,struktur organisasi   menegak
        sepatutnya memudahkankomunikasidi antarapekerja
        danjuga bahagian-bahagian perlubagimem"nrhi
                                   yang
        tugasanorganisasisecaraam. Rantaianmlklumat pula
                                                                       :.
                                                                       I

        digunakan untukmenyeraras   aktiviti dari atas ke bawah.
        Pekerjadiperingkatbawahperlumelaksanakan       aktiviti
        yang konsistendan ianyajuga akan menjadirantaian
       arahan. Prosidur dan juga peraturan oiwujudkan   yang
       mernberi garis panduanwajib bagi metaksanakan      dln
       juga menyelesaikan  tugas-tugas.

       segala pelandanjuga penjaduatan
                                     dijadikanatat dalam
       rantaianmenegak.perandan penjaduatan metibatkan:
                                          ini
       1.. Kewangan.
       2. Kemajuankerja.
       3. Penyelesaian
                     masalah.




       Rantaian menegak mewujudkan
                       jugu          hierarki
                                           tahapdan
       kedudukan pihak-pihakdalam
                          di     organisasi
       tersebut.sistem
                    maklumat secara
                                  menegak merupakan
       strategi
              untukmeningkatkan
                              keupayaan makrumat
       menegak  kerana:


                                                               48
                                C 50t I I,tiNC;(JI(tJ,SAl.l
                                                        I,t,MIilNAAN

      1.   Menjadikan
                    makfumat lebihdipercayai.
                           itu
      2.   Menjadikan
                    maklumat lebihefisien.
                           itu



il,    StrukturOrganisasi
                        mendatar
      Kadangk projek
               ala      memerlukan perkara_perkara
      berkaitanautoriti,komunikasi har-har
                                dan
      secaramendatar-                       i"in'r"ngarir
                       Rantaianmendatar  kadangkara    amat
      pentin bagi men hubungkan
           g         g           oanag i"nlt'" rtunitdi
      dalamorganisasi yangsei"tum ini derfun!"i
      bebasdan interatiioi-antara                ,""".u
                                orang-orang   yangberada  di
      pelbagaifungsiyang berbezaamalfah
                                         n""nting
      Apabila peningkatan
              ada            kesamaran
                                     dafambeberapa
      nerkall penting    keperfuanpenyerarasan
                    laka
      mendatarperru adeikan-Beberapa         secara
                    di               perkara
                                           penting
      tersebutadafahseperti:
      1.   Kuasa.
      2.   Penyelarasan.
      3.   Komunikasi.dll




                                                            49
                                     C:5OII I'IJNG{
                                                  JITUSANPT'MIJINAAN


                             Timbalan
                             Pengarah


                             Pengurus




 Ketua             Ketua            Ketua         Ketua
 I I nit A        I Init B         I I n it C    I Init I-)



Penyelia        Penyelia        Penyelia         Penyelia


Penyelia     | | Penvetia
                        l
             -1__________t       Penyelia


             Contoh carta organisasi
                                   mentlatar




                                                                       I




         organisasi hanyalah mekanisme
                   ini        satu           rantaiantetapi
                                                          ia
         masihmenjadl  sebahagiqr organisasi.
                                  dari         sebenarnya
         semua oiganisasi sedikit
                                sebanyak mempuny;idan
         mengamalkan   rantaian
                              mendatar manaindividu
                                       di             di
         dalamorganisasi boleh
                         itu      bertukar-tukar
                                             maklumat.
         Antarainteraksiyangmelibatkan pefbagai    yang
                                              fungsi
         berbeza-beza ialah:
         i. Kerja-kerjabertulis.

                                                               50
                         C 501I PINGURUSAN PIMI3IFJN
                                                   AN



   Rantaianmendatarmemborehkan  memo,
   perkara-perkara disebarkan          raporan
                                             dan
                rain         loepaJa ianagianrain.
   Setiapbahagian
                tahusetiapaktiviti dalam
                                di
   organisasi.
            Walaubagaimanapun ini:
                               cara
   a' Tidakdapatmeningkatkan
                           penyerarasan
                                      antara
      bahagian.
   b' Tidakdapatmeningkatkan
                          penyerarasandaram
      membuat apa_apa
                    keputusanbersama.
 ii. Hubungan
            terus.

   Ketua-ketua   Jahagian
                        borehsaringberhubung
   jika ada masarah                         terus
                              perk'ara sangat
                    berbangkit.      ini
   dafam  trry?npenyelarurln.                efektif
                             Kemungr<inanlimnul
   masalah apabitadi antara
             lain              mereka terus
                                      itu
   mencapai   katasepakatyangtidaksefaridenganporisi
   organisa$i  secarakeseluruhannya.

iii. Berperanan
              sebagai
                    penghubung.
  lanyaarnat sesuai ditubuhkan
                             peranan  penghubung
  sebagai arternatif
                   kepadaarternatif
                                 ilil"g"n terus.
  Keadaan memerfukan
           ini           seseorang yangditugaskan
  di satubahagian manaiu n"rt"ndgr-,.r,]ai,ruab
                  di
  berkom nikas dan mencapai koorJi"n         untuk
         u      i                   ari J" gun
  bahagian yangberkaitan.
           lain                           "

iv, Menubuhkan
             satu pasukanpetugas.
 Pasukanpetugasmerupakan jawatankuasa
                          Satu
 sementarayangmengandungi J;"da
                           wakir
 bahagian
        yangierlibal                    setiap
                   dengan  sesuatumasalah.
 Pasukanpetugasnrembual rantaian
 bahagian                       dengan beberapa
        yangberkaitterusdaram ,uruui, organisasi.



                                                5l
                            C 501 P[iNGtItr tJSAN I]tNnAN
                                I               I,tiM

        Ahli pasukanpetugasmembawa   bersama mereka
        rnaklumat jugacadangan
                 dan              yangdiputuskandi
        dalam  mesyuaratkepada bahagianmasing-masing.
        Pasukan petugas sesuaidalammenyelesaikan
        masalah atauisu-isusementara ianyaakan
                                    dan
        dibubarkanapabilatugasmereka telahsefesai.
     v. Mewujudkan
                 integrator
                          sepenuhmasa.

       Biasanyaorganisasiberstruktur
                                  menegak  yangkuat
       akanmewujudkan  jawatanintegratorsepenuhmasa
       bagimaksud  tugaspenyelarasan. dalam
                                     Di     organisasi
       projek,
             pengurus projekmerupakan seoranginlegrator.
       Integrator
                biasanyaditempatkan luarbahagian_
                                   di
       bahagian yangdiselaraskannya.
               lain

     . Pasukan
             petugas.

        Pasukan lebihbersifat
                 ini         kekal.Biasanya
                                          diwujudkan
       bersama   kewujudan        pasukan
                         integrator.     projeti
                                               dalam
       industri
              pembinaan seringmenggunakanpasukan
       jenisini.




iii. Stru ktu rOrga nis as iKef ungs ian,

    Aktivitidikelompokkan bersama-sama,dengan fungsi
                                               satu
    yanglazim bermula  dari bawahhinggalahtlngkatatas
    organisasi Tugas-tugas
               itu-           ataukerjadihubungkaitkan
    berdasarkan  kepadafungsiumum.semua aktiviti
    pengetuaran  dikumpulkan dalamsatu fungsiyang
    melaksanakan    semuatugasyangdiperlukan dalim
           pengeluaran.
    aktiviti            Seterusnyasemuatugaskakitangan
    dikumpulkan  dalamsatu fungsiyang meraksanakan
                                                    52
                       (: 5()II P[N(;I/I{{JSAN
                                               f,[Mt]INAAN

       lugasanyangdiperrukan bawah
                           cli     aktiviti-aktiviti
 :"Luu
 kakitangan.
           Fungsi_fungsi lainjuga mengikut
                      yang
 kaedah yangsama.

 Contoh:
       Jurutera.

semuaJurutera ditempatkan bahagian
                          di        Kejurute
                                           raan
danbagiKetuaJurutera_Juruteraakan
                             itu
                bagi
P:fu.nggungjawab semuaaktiviti   Kejuruteraan.
Melalui
      organisasi manusia aktiviiioig"orngkan
               ini,        dan
olehsumberdansetiap bahagian kefungsiun""*rn
menyediakansumber  misarnyaKejurute"r"un,
perkhidinatan,                         akaun,
            tenderdan lain_lain.
struktur
       organisasi
                kefungsian
                         berjayaapabira
menekankan                               organisasi
            pengkhususan,kebeikesananJan tuariti.
menggalakkan ekonomi                            ra
             skala      (semua  puf,urju
ditempatkandafamtempatyangsama ' boleh
                                dan - -r
berkongsikernudahan)
                   dalamfungsi.
Kelemahan strutkur iarah bertindak
                 ini     ia         perrahan
perubahan                                   kepada
         persekitaran memerrukan
                     yang            penyerarasan
antarabahagian-bahagian.Struktur sesuai
                               ini
organisasi                               untuk
         bersaizkecir sederhana
                     dan           meribatkan
pengeluaran ataubeberapa
           satu             jenisp"ngulrurun
sahaja
     sepertifirmayangmengeluarkan
                                   "u"t-




                                                    5l
                                 (l 5 { )ll I )liNG t J I t t j. SN I , l: MI J I NA A N
                                                                  n



                    I'IINGARA}I URUSAN




  BAIIAGIAN       BAI{AGIAN      T}ATIAGIAN                 BAIIAGIAN
PERKTIIDMATAN      TENDER         AKALN                   KEJURUTI]RAAN




      DOKUMEN             ANALISIS
       TENDER             TENDER



           Strukturorganisasi
                            kefungsian
                                                                                            t



                    PENGURUS
                    BAHAGIAN




                     PENGURUS
                   KEJURUTERAAN
                                                                                           ('
                                                                                           f.
  PENGURUS
   SESAR



                     PENGURUS
                    PEMASARAN




        Struktur
               organisasi
                       ketirngsian


                                                                                54
                               (: 5 O I I P I J N(; UI (US N
                                                                                 N
                                                               ' , I J MI J I NA N


 Dalam  struktur
               organisasi
                        kefungsian,
                                 manusiadan
 aktiviti
       digabungkan sumberdansetiap
                   oreh               bahagian
 kefungsian akanmenyediakan sumber.
                                  Struktur
 organisasikefungsian ayaapabifa
                    berj         organisasi
 menekankan:

1. P e n g k h u s u s a n .
2. Keberkesanan
3. Kualiti.


fa jugamenggarakkan ekonomidatam
                   skara              fungsi.
                                            Satu
kelemahan struktur
                 organisasi
                          kefungsian
                                   iarahia
bertindak
        perrahankepada perubahJnpersekitaran
                                           yang
memerlukan penyerarasanantarabahagian-bahagian
atauuni-unit.


Menurut Duncan(1979),Randolph dan Dess(1gg4),
struktur
       kefungsian
                paringbaikunlukorganisasi
                                       bersaiz
kecildansederhanadanheribatkanpeigetuaran
                                        satu
ataubeberapasahajajeniskefuaran.




                                                                         55
                                          pt:MITtNAAN
                        C 50tI PI:NGIJRUSAN

 Kebaikan:

 a- Kepakaran teknikal
              dan       semuakakitangan
                                      dalam
    organisasi
             bolehdi manafaatkan.

 b- Kepakaran dan teknikaf
                         semuakakitangan
                                       dalam
    organisasi
             bolehdiselaraskan.

c.   Organisasi
              bofehmemudahkan kepakarandan
     teknikal
            semuakakitangan
                          disefaraskan
                                     dan
     dimanafaatkan
                 untukorganisasi.

d- Memaksimakan minatterhadapfungsidi antara
   bahagianatauseksyen.

e.   Penggunaan
              sumberyangcekap.

f-   Menyediakan
               rangkaian komunikasi
                                 yangringkas
                                           di
     dalamseksyenatau bahagian

g.   Menyediakqanrangkaiankeputusanyangringkas
     dikalangan
              ahfi-ahli
                     dararnseksyenuiau nanagian.
h.   Peluangyanglebihbaikterhadap orangseperti
     kakitangan
              sesuatuorganisasiuntukkenaikan
     pangkatdan perkembangan kerjaya.




Keburukan:

a- Percambahan
             minatdaramsetiapseksyen
                                   atau
   bahagian
          mungkin
                bertentangandengankehendak
   umumsesebuahorganisasi.




                                                 5 (,
                                                      C 50I I PENGUITUSNN
                                                                        I,TJMIJINAN
                                                                                  N

                       b.   Sukaruntukmenyelaras
                                               antara
                                                    fungsi
                                                         bahagian_
                            bahagian.

                       C.   Kos penyelarasan
                                           antaraseksyen
                                                       atau bahagian
                            mungkintinggi.

                      d.    Kepuasan
                                   pelanggan/klien
                                                mungkin
                                                      rendah.
                      e. sukaruntukmenyesuaikandengankehendak
                                                            untuk
                         kepelbagaian sesuatu
                                    bagi      produkatau
                         perkhidmatan
                                    yangditawarkan.


            iv.    StrukturOrganisasi
                                    produk (projek)
V tpn
                  fa sebenarnya         membawa   maksu kebahagian disusun
                                                        d
ll b'( Y1                                                                   iaitu
                  mengikut        kumpufan   produk,
                                                   perkhidmatan,      wifayah,     pasaran,
                  pelanggan.gtau         program besar.
                                                      organisasi berasaskan
                                                                      ini
                  projek,    perkhidmatan produk.
                                              atau        betiapprojek
                  menerusi                                                    diuruskan
                                 .satu  bahagianyangterasing. boleh
                                                              Ini
                  menghasirkan          penyerarasa.n. ceklp bagisejumrah
                                                   yang
                  besaroutput         projg_k khususl
                                            yang         pakar-pakar perbagai
                  bidang                                                   dari
                             berbeza     dikumpufkanbersama. bertujuan
                                                              Ini
                  meraksanakan                                                     untuk
                                        semua tuqasanyangdiperrukan          untuk
                                                               r ' r ur \u' uI
                  m e n g h a si l ka n
                                  ke tu a ran utu, ouiputl  '                  ' ILI,.




                  Biasanyaorganisasi-organisasi mempunyai
                                             yang
                  projek,                               rangkaian
                        perkhidmatan proouf
                                     atau           iuu! *urerlukan
                  struktur                      vJng
                         organisasi
                                  seperti struftturlni
                                         ini.         Jiw'uludkan
                  mengikut kumpuran tersendiridaram
                                             di    orgunlu"i
                  berasaskan                                 dengan
                             output
                                  organisasi.
                   la amat baik untukmencapai
                                            penyelarasan
                  bahagian                             antara
                           kefungsian- amatsesuaidaram
                                      ra              situasi:
                  a' Apabilakeadaanpersekitaran
                                              perniagaan
                                                       organisasi
                     tidakmenentu.

                                                                                    57
                              C 501I I,I1NC;IJRUSAN
                                                  I,IMIJINAAN


    b. Apabilateknologiyang digunakanmenjaditicjak
                                                 rutinclan
       salingbergantung anlarabahagian.
                       di
    c. Apabilamatlam atnyaialahkeberkesanan
                                          luarancJan
       penyesuaian (adaptasi).


    Kebaikan:

    strukturorganisasi produkmempunyai
                                     kekuatanyang
    tersendiriseperti:

    a- la bolehdisesuaikan untukperubahan
                                        segeradalam
       persekitaranyang tidakstabil.

    b- Membawakepuasanperanggan   keranatanggungjawab
                                              --                ,
                                                                :. 3
       kepadaprodukdan titikpertemuan
                                    adalah;efas.

    c- Melibatkan
                penyelarasan
                           yang tinggiantarafungsi.

    d- Memberiruangkepadaunitataubahagian  menyesuaikan
       diri denganproduk,
                        wilayah,klien liin_lain.
                                    dan

    e- la baik untukorganisasi
                             besardenganpelbagai
                                               produk.
    f. Kuasamernbuat
                   keputusan
                           diagihkan.

    g. Membolehkan sesebuahorganisasi
                                    mempelbagaikan
       produk,perkhidmatan projek.
                        atau
                                                                i
h. Merekaberupayamenangani/berdepandengan                       i.i
   perubahan
           teknologi
                   denganlebihbaik,sekiianya
                                           perlu.


i- Lebihmudahuntukmewujudataumenambah
                                    bahagian
   ataujabatanyang baru.

j    Memudahkan
              penyelarasan
                         antarafungsi_fungsi.
k. organisasi
            bolehlebihfokuskepadakeperluan
                                         dan
   permintaanpelanggan.
                          (: 501| I,LINCUItIJSAN
                                               I,l,MIJINnnN




 Keburu
      kan:

 u.               skala
      Ygnghifangkan ekonomi
                          dalambahagian
      kefungsian.

 b. Membawa  pe.nyelarasan lemahpada
                        yang
    keluaran                        bahagian
           produk.

 b' Menghifangkekompetenan
                        mendaram pengkhususan
                               dan
    teknikal.

c' Menjadikankesukaranintegrasi
                              dan penyeragaman
                                             di
   antarabahagiankeluaranproduk.
d' Difemma
         dalammenyeraras
                       bidangprojekatauproduk.
e' K.urangk"j"lT,an tentangtanggungjawab
   atau pakarprojek.                   diantaraproduk

f ' Kuranghubungan professionar
                             (kurangkomunikasi
    dikalangan
             kakitangan).

h' Mungkinberfaku
                peniruanataumenciptak
   produkatauperkhidmatan.          sesebuah




                                                    -59
                                          C 5 ()l I I ' liN(; t J I f A N I )t lMI lt NnA N
                                                                    US



                          Kctuallksckutif



PcngumsProjekA              Pcngurus
                                   Projck B                    PengurusProjekC



  U nit A I                    UnitBl                               Un it Cl



  Un it A2                    Un it 8 2                             Un it C2


 Unit ,43                     UnitB3                                Unit C3
                                                                                                  t:

                                                                                                  {.r




 tJnit 44                      Un it8 4                             Unit C4



                     StrukturOrganisasi
                                     produk(projek)



      v.       Struktur Organisasi
                                 Matriks.
               Merupakan suatubentuk keorganisasian yang efektif,
              apabila sejumlah besarprojekbersaing untuksumber
              yangterhad,menghasilkan                                                         :
                                       permintaan terhadap unit-unit                          i ,r
              kefungsian. Satuorganisasimatriks merupakan satu
              jaringan hubungan mendatar, pepenjuru dan menegak
              menerusinya  semuatugasakandilaksanakan.   organisasi
              ini adalahkombinasi penyatuanstrategi-strategi
                                                          struktur
              berorientasikan matlamat. menghimpunkan
                                      ra                 kakitangan
              dan peralatan dalamunit kefungsian
                            di                    yang
              membolehkan   pembahagian  kecildibuatdalamperkara-
              perkara rkaitan
                      be       pengkhususan,pemajuan, pengg unaan
              sumberyang efektif,skalaekonomi  dan seumpamanya.



                                                                                     60
                          C 501I I,fiNCtJI{tisnNI,tiMIilNnAN

  MenurutHunterdan sticknet(1983:9g-101),
                                      struktur
  organisasi
          matriks
                ialah:

  suatu bentukkeorganisasian efektif,
                             yang        apabira
  sejumlahprojek bersainguntuk simber yang terhad,
  menghasiIkan pemintaan terhadap uniFLnitkefu g
                                              n s'in.
                                                 a
  safu organisasi
                matriksmerupakansatu  jaringan
  hubungan mendatar, pepenjuru dan meiegrak
  menerusinya semuatugasakan dilaksanakan.

 Terdapat syaratuntukmenjadikan
         tiga                   struktur
                                       organisasi
 matriks
       merupakan pilihan
                       tepatkepada
                                 sesuatu
           pelkara
 organisasi.      tersebut
                         ialah:
 i-   wujudnya keperrgan mendesakbahawa sumber_
      sumber perru
                 digerakkan digunakan
                            dan         merangkaui
      bahagian-bahagian produk
 ii. VVujudnyakeperluan_keperluanmendesak
      dipersekitaran mengeruarkan ataurebih
                   bagi            dua
      output,
            misalnya kualiti
                    bagi      teknikal produk
                                    dan
      secarakerap.
 iii. Wujudnya domain persekitaran
                                 organisasi
                                         yang
      kompleks jugatidakmenetu.
              dan
Dalam organisasi
               matriks
                     autoriti
                            formar
                                 yangdatang
peringkat akanturun bawah                    dari
         atas        ke        melituiiiraki
                                           dan
kemudiannya berpecah,
                    yangmewujudkan   tanggungjawab
bersama mengenepikan
        dan             kon"eprantaian autoriti
                                             yang
tidakputus.




                                                      6l
                                      C 5 0 1I P I I NG URUS A N , l; Mllt NA n N
                                                                I




                                tJ                   U
                                N                    N
                                I
                                                     I
                                T                    T
                                A                                                       t
                                                     6
                                                                                        :




Yt(a r




                                      XX



         ContohI :Strukttrr
                          nratrikssebuah
                                       organisasi'pembinaan

                 )   \ ,vd l,   ,{lnt t   R,
                                               'ro
                                                                                    i

                                                                                    \it




                                                                            62
                                     C 5 0 1 I P E NG UI { t J S iA I , t : MI J I NA A N
                                                                    N



                           PINGURUSI]ESAR




            PIINGURTJS                     PENGURUS               P E N GU R U S
            PLANT                          PEMBELIAN              PERKIIIDMA'T'i\N




PENGURUS                                        Tanggungjawab
                                                            projek
PROJEK
     A


PENGURUS                                        Tanggungjawab
                                                            projek
PROJEK
     B


PENGLIRUS                                       fanggungjarvab projek
PROJEKC




                         Tanggungiarvab
                                      kefungsian




    Contoh2 : Stnrktursebuahorganisasimatriksorqanisasi
                 pembinaan (Burack I 9ZS)




                                                                                63
                                   C 501I I'DNGUI{USA I,IIMIJINAA
                                                    N           N




                PENGURUSPROJEK




PENGURUS           AKITEK               EKSEKUTIF         EKSEKUTIF
TAPAK                                   PEMBINAN          PEROLEHAN
PROJEKA


PENGLIRUS
TAPAK
PROJEKB


PENGURUS
TAPAK
PROJEKC


                                                         J o in t t a s k s


                                                         Direccttasks



                                                                                   \
  StrukturMatriks (kontrakpembinaan
                                  furnkey) ) lr r u' f..i- |                       (,t
                                       \y

                             lrnciqr        tundrn.qon




                                                                              6l
                         C 5 0 1I I , E NC{ J I < { J S iA,N, MI ilNA A N
                                                         I t

  Kebaikan:

  a . Penggunaan
               sumberadalahlebih berkesancjan
      meluas.

  b' Penyampaian
               makrumat
                      adarahrebihtepatdan
     mef
       uas.

 c. Menggalakkan perkembangan   pengetahuan
    dikalangan
             individudi dalam unit ke"fungsian.

 d' Mengurangka.n percanggahanurusandi antara,rine
    organisation'
               bagi pengurusprojekdan kakitangan
    fungsian.

 e' Mengerakkan   perubahanmendadak   padakerjadi
    dalamorganisasi-Apabira projekturut, I!t"4u akan
    pulangke bahagian  kefungsianasafmerekauntuk
    bersedia menjafankan kerj-a
                              yang baru.Maka
    perubahan  tenagakerjayung mendadak    tidak
    timbur-f tidakmenimbuikan-tekanan
          ni                           kepadamereka
    dalammenghadapi   perubahan tersebut.-

f ' Mengurangkanpengf
                    ibatanpengurus
                                 projekdaramhal
    pentadbiran.Beriau
                  hanya
                      fokus
                          i"puiu iluru oun
   usahanyakepada
                projek.
                      Masalah'plniujuirun
   dikongsi organisasi
         oleh        kefungsiun
                              urui.-"
g. Pengurusprojek
                danorganisasi
                            dapatbertindak
   dengancepatd.an.ber:kongsi
                          menyeferu,Lun
   Keadaan terjadi                    masalah.
          ini     kerana"terah
                            wujudpenumpuan
   penuhkepadatugasan.
h' Pengurus  projekberpetuang menggunakan dan
   prosedur berasingan daripadu             porisi
                                org"u"n Hur,ngsian
                                     i,
   asalnya.                             "ri




                                                                (r-l
                       tl 5(Jt I,tlNCtJItUSn I,tiMIltNAn
                             I             N            N

i- Meningkalkan  tahapkuantiti dan aliranmaklumat.
   Apabilatahappemprosesan     maktumai telahmeningkat
   dan keputusan  yang efektifperrudibuatcraripada
   maklumat makastruktur
            itu,              organisasimatriksamat
   sesuai.

j. Struktur
          matriksmenggabungklan jenis
                                dua
   komunikasi authiriti
             dan      iaitusecaramendatardan
   menegak. akan mewujudkan
            Ini               kestabitan
                                       dan
   kecekapan dalamstruktur.
             di

k. lanyalebihfleksibel
                     dalammenyusunatur
                                    organisasi.
l- Hubungan antaraahlidalamorganisasi
                                    adalahlebih
   tidakformal-                                             ,,
                                                                 ,
m- lanyalebihfokuskepadakeperluan
                                kumpulan
                                       projek.
n- organisasimempunyai
                     hubungan
                            rangsung
                                   dengan
   klien.

o. lanyamembantumenjejaskan
                          siapayang
   bertanggungjawab
                 dalammemastikan kejayaan
   projek.

p. lanyamenyumbang
                 kadarinovasi
                            yang tinggi.
q. Memaksimakan
              penggunaan
                       fungsipakar_pakar
                                      yang
   terhad                                                   {
                                                            \J




                                                    65
                             C 501I I,INCIJIilJSAN |,ITMIJINAAN



 Keburukan:

 a- 'Dualreporting     boreh  berraku   dan mengakibatkan
    konflik - Aktiviti-aktivititidak d iserarasLu"n,
    tertelingkahan    wilayahkuasa,cemburu
    profesion perseng
               al,          ketaa antarakakitanqa
                                   n                 n,
    kesamaranperananterutamanya             paoa pe.ringkat
    pewujudanstruktur                                     awal
                           matriks.peiru dibendung    untuk
    mengelakkan     kekecewaan       ahli.
 b- Mungkinkerewatanatau 'over budget'berrakudi
    peringkat
            fungsian.

c' Pembahagia.nsumbermenjadi
                           sukarapabira
                                      adanya
   projekserentak

d. Memungkinkanrebihbanyakpengurus
                                 diperrukan
                                          dan
   akan meningkatkan pengurusan
                   kos         denganjelas.
e' Mengurangkan  kepuasanbekerja keranamenurunnya
   penglibatanbersamadan kualitiarahanbagi
                                        '
   komunikasiformal.

t. Pe.ngurus      projekamat memerlukan    dan mencari
   sokongan       daripada    perbagai
                                     pihak.Namunada pihak
   Yang   menganggap merekayangperfudiutarnakan
                              diri
   d a n d i m u l i a k an .

g . Konflik
          mungkin
                timbur
                     berhubung
                             dengan            peruntukan
  sumber-sumber
             projek.
h . Mungkin
          mewujudkan
                   konflik
                         berhubung
                                pembahagian
  kuasaantarapengurus
                    projek
                         danpengurus
                                   fungsi.
  Lambat
       membuat
            keputusan.




                                                         66
                                   C 5 0 1I P I I NG UI (US A l, t rMI lt NA A N
                                                            N


A . J e n i s - j e n i s g a n isa sim a tr iks.
                        Or

      Berlakupenguas aan apabitaada pengurus yang lebih
      menonjol dalamorganisasi
              di                tersebut.pelu diingatkan
      bahawadalamstrukturorganisasi  bagiprojek-projek
      pembinaan sepertiyang dinyatakanolehWalker
      (1984:153),bahawaterdapattiga komponen  utama
      iaitu:

      a. Klien.
      b. Pasukanrekabentuk.
      c. PasukanPembina(kontraktor).

sebenarnyaorganisasi     juga ada dua jenis (Hall
                   matriks
1982:871:                                                                          {
                                                                                   ;. 1
                                                                                   \./
      1. Berbentuktetap atau kekal.

        la salingkebergantungan
                              tetapistabil.

        D i M a l a y s iad i g u n a ka n le h p ih a kBe r ku a sa
                              ,          o
        Tenrpatan        (PBT)danjuga agensipembangunan
        w i l a y a h , d ll.
        Sebahagian          syarikat                   juga
                                     antarabangsa bergerak
        ke arahini.Pengurus           wilayahmerekaakan
        berhadapan          denganpengurus-pengurus
        pengeluaran         produkantarabangsa.         pengurus
        produkpulamelaporkan             sesuatuitu kepada
        pengurus       wilayahdan pengurus         produk                          :.
        a n t a r a b a ng sa .

  2 . Struktur matriks beratih(beranjak).

  .     la ditujukan
                   kepadakerja-kerja
                                   dalamsesuatu
       projek-
             wujudsalingbergantungan
                                  antara
                                       unit-unit
       pasaran orang-orang dalam
               dan          di    organisasi
                                          itu
       akanberalihdengankerap.



                                                                          67
                                        C 5 0 1I I , i, NC[ J I (I J S A N, t lMI ilNn n N
                                                                         I


 vi' struktur organisasi kacukan/gabungan
     semua di atas.
     strukturorganisasi kacukan  iarahmerupakan
     kombinasi strukturorganisasi produk dqanstruktur
     organisasikefungsian. Gabungan   kedua-dua  bentuk
     struktur
            organisasi membolehkan
                       ini              sesuatu ,firma
     ataubadan  mendapat   manafaat daripada kebaikan
     kedua-dua strukturorganisasi tersebut.struktur
    organisasi kacukan  akanwujudapabila   sesuatu  firma
    ataubadan   berkembang mempunyai
                             dan             beberapa
    produk ataupasaran.Maka    fungsiyangpenting   pada
    asetiap prqduk ataupasaran   akandipincarkanarau
    diagihkan kepada unit-unitserba rengkap tetapi
    sebahagian  fungsijuga dipusatkan ditempatkan
                                      dln
    di ibupejabat organisasitersebut (Daft1gB9:233).
              c 1h"   l 'h r a J c {"        1.9^(Gn.
Kebaikan.                                                 t/ ? , " A " F

a' Memberi  peruang kepadaorganisasiuntukmencapai
   penyesuaian penyerarasan bahagian
               dan             di           produk
   dan kecekapan bagagian
                 di         kefungsian iung
   dipusatkan.
b- Memberi  kesankeseimbangan rebihbaik di antara
   matlamat pqdaperingkatkorporat v maflamat
                                  dengan
   padaperingkat            '
                 bahagian.
c. Mencapai  penyelarasan
                        bahagian, iaitudi antara
   bahagian keruaran di darambahagian
                    dan                   keruaranitu
   sendiri.

Keburukan.

a' Kemu-ngkinan meningkatkan pentadbiran
                akan            kos
   yang berlebihan.
b' Membawa   konflik antarabahagian
                   di             pengetuaran
   denganbahagian  korporat.




                                                                                  68
                      C 501I I'DNCURTJSAN
                                       l,tiMfltNnnN

vii- struktur organisasi Berbentuk Rangkaian
    kerja keorganisasian.

   Kadangkalaorganisasi
                      mendapatibahawa
   perhubugantidak formal
                        dan secara
                                 langsung(terus
   menerus) antara
          di       pihak-pihak           '
                             menOatan-gt<an
   kebaikan memberangsangkan
          dan                  (Hastings
                                       1gg3).

   Ada pihakseperti Gore daripada
                   Bill             Gore
   Associates (Hastings gg5)menamakan
                        l
   perhubungan sebagai
               ini        organisasiKekisi.Secara
   dasarnya perhubungan  berbentuksarangla6ah_
   labahdi antarasemua  pihakdi dalamorganisasi
   bagimelahirkanrangkaian kerjakeorganLasian.
   Setiap
        orangseolah-otahmemainkanperanaR
   sebagaiPengurusprojek
                       (Hasting
                              1995:260).
   Pengurusprojekperrumempunyaiciri-ciri
                                      seorang
   Pengurusprojek
                yangefektif.




                                               69
                                            C 501I [,tiNa;tJI([JS;AN
                                                                  I,t:MI]tNnAN

         v i i i . S t r u k t u r B e r a sa ska n ka wa sa n .

              sesetengah  struktur
                                 organisasiadarah
                                                bercrasarkan
              kawasanaktivitiatau perniaga Territoryjuga
                                          an.
              dikenafdari segi:
                    i

                i. Geografi.
                ii. Kawasan.
                     W i t a y a h.
                'ii.

             organisasi
                      yang berdasarkankawasanbermakna
             sesebuahorganisasi di str.ukturuntuk
                              itu
             disuaipadankandenganaktiviti
                                        atauperniagaan
i-i *l
             kawasanmereka-

             D i b a w a h r g a n isa sije n is i,m u n g kin m u aa ktiviti
                          o                    in            se
             k u m p u l a n d ala hb e r d a sa r ka n :
                           a

             i. Lokasi geografi (atau kawasanatau
                s e m p a d a n) .

                 Sempadanaktiviti
                                ditentukan
                                         olehbeberapa
                 pertimbangan.
                            Sesetengahnya termasu :
                                           pula     klah
                a. Jarak.
                b. Faktorgeografi.
                c. Liputanperkhidmatan.
                d. Kepuasan  pengguna.
                e. Sempadan  politik.
                f. Tarafsah perniagaan,dll.




                                                                        70
                                                           it
                                                                     1'
                       C 501I PI"lNGtJl{USn I'tlMtitNAAN
                                          N



ii.   Mengelak
             ataumeminima  kesukaran
                                   dalam
      menyelaras
               perniagaan,

      Dapatdiperhatikan setiappejabatkawasan
      bertindakseolah-olahsepertisebuah  organisasi
      Iang berdikariyangberdikari(self-standing=
      bersendirian,tanpabergantung padayungl"in1
      dalammenguruskan   perniagaan tetapimJsih
      mengekalkan  standardperkhidmatan kualiti
                                         atau
      produk yangsama.Semua dikawal
                               ini        seliaoleh
      ibu pejabat.

                                                                t
                                                                !.

                                                                i
                                                                \.,t




                                                            \i /




                                                    7l
                                        C 5011PENGIIRUSANPEIVIBINAAN
                                                                  w r b t \ l qa 4
                                                              7
1.5 PIHAK-PIHAK YANG TERLIBAT SEIVIASA                            {,
                                                                                     9*r   !r '1 'i c'
    PERTNGKATPEMBINAAN PROJEK                                 tiajrtselO         I
                                                                                     tPc*fla,r *'
                                                                   t       \-+r1

   1.5.1 PEIVIAJU/PBMILIIIJPELAI\GGAN

            PeranansertaPerhubungan.

           Pemilik merupakan  tuanpunyaatauorangyang ingin
           melaksanakan  projek.Boleh terdiri dari individu pihak
           kerajaan,badan-badan  berkanun,firma swasta.
           Bagi projek Kerajaan,pemilik selalunya   merupakan
           Kementerian  atauJabatan.Selalunya  Kementerian    atau
           Jabatankerajaan merupakan  pemajuyang terbesar    yang
           melibatkanprojekpembinaan   seluruh  egarakhasnva
           dalampenyediaan  infiastmktur.

           Bagi projek srvasta
                             selalunya lebih mementingkan
           keunfungan dalarnprojek-projekyangdilaksanakan.
           Pemilik biasanyaterdiridaripadasyarikat-syarikat.
           Pemrlikbiasanya merupakan   pemajukepaclaprojek yang
           dimajukan.

           Projekyang dilaksanakan   oleh pemajusamaclauntuk
           kegunaan awamseperti   sekolah,balairaya,
                                                   jalanrayadll
           ataupununtuk kegunaan   persendirian.
                                               Dalam usaha
           untuk mencapai hasrat pemilik perlumenyediakan
                                ini,
           peruntukankewangan  yang mencukupisamadadengan
           mengeluarkanwang simpananataupun      membuat
           pinjaman daripadainstitusikewangan.

          Pemilik ataupemaju juga perlu menyalurkanhasrafnya
          kepada  pihak yangpakardalammelaksanakan  projeli
          ters t. L azimny pemaju akan berjumpad"n gon
              ebu          a
          kumpulanPerunding                Akitek, pJngurLrs
                             Ikhtisasseperti
          Projekataupun  Perunding-perundinglain.

          Namunbegituterdapatjuga pemajuataupemilik yang
          memajukanprojekoranglain. Merekaini cliberikLrasa
          unfuk memajr-rkan
                         projeksepertiini. pemilik seralunya


                                                                  72
                                      C 5011PENGIIRUSAN
                                                      PEMBINAAN

           melantik perundingbagi membantunya   dalam
           melaksanakan
           sesuafuprojek.Pemilik juga perlu memikirkan sumber
           kewanganuntuk pembiayaan    projek dan bayarankepada
           perunding.


7.5.2 PIHAK PBRUNDING

    a. PengurusProjek

       .    PeranansertaPerhubungan.

           Orangyang terlibatdalampengurusan    projek adalah
           salahsatuciri penting.(CIOB1982:14)menyatakan
           bahawa pelantikan  seseorangpeng,rus projek adarah
           bagi meringankan  tanggungja'uvab
                                           majikan ataukrien
           dalammenyediakan    suatuorganisasiunhrk
           menguruskan  perkara-perkaraberkaitanrekabenfukclan
           pembinaan projek.Sepatutnya  pengLrrusprojek perlu
           wujud bermula  padatahapar.r,al projek lagi.t<lien
                                         fasa
           perlu melantikPengurus projekyang akan*.rriugu
           kepentinganklien.

           Beberapa faktor perlu dipertimbangkan
                                               dalam
           perlantikanPengurus  projek:

                 Kelayakan pengalaman
                              dan            yang diperlukan.
                 Orangataubeberapa     orangyang
                 bertanggungj  awab kepadanya.
                 Bidangtugasnya.
                 Had autoritinya.
                 Si fat peribadinyat ermasukdaya kepempinann,va.

       Walaupunada   juga Pengurus  projek yang dilantik oleh
       Kontraktor atauperekabenfuk  tetapi crite;ia pemilihan
       adalahsama  sepertidi atas.Lantikanpengurus    projek
       biasanyadibuatsecara  berfulis.Aclas.ebat ogiu" klien
       rnelantik
               Pengurus   projek hanyamen"iarLri sahaia
                                                 surat
       yang mengandun syarat-
                       gi        syatafdan terma_  terma
                                                                1a
                                                           C 5011PENGTIRUSAN
                                                                          PEMBINAAN

                              lantikan,termasuklah jenis projek yang
                              dipertanggungjawabkan,bayarannya,    tempohkuatkuasa,
                              lantikan,bidang tugas,peranan,kuasa,tanggungjawab
                              danperkara-perkara  yang berkaitan.Biasanyaklien akan
                              membuat  perjanjian rasmi denganpihak yang dilantik
                              sebagaiPengurusprojek selepassuratlantikan dibuat.

                              PihakThe Royal Institution of chartered Surveyors
                              (ruCS 1989)misalnya,telahmengeluarkan     format
                              seragam  memorandumperjanjian di antaraklien dengan
                              Pengurus projek (berserta
                                                      dengansyarat-syarat
                              Gunakhidmat  Peng,rus projek profesiotrui;,diantara inti
                              isi kand,ngannyaadalahberkaitanperkara-perkara
                              berikut:

                              a. Pengurus
                                        projek bertindaksebagaiagenklien / yhv vr, ,,
                               o Bertanggungjawab   dalamhal penyelarasan
                                  pentadbiran,
                                             pengumsan  dan komunikasiprojek.

                              b. Pengurusprojek mestilahboleh:
                                . Berkomunikasi  de'gan kons,rtanberkaitanrinslsan
                                  klien.
                               . Mengawasi   kemajuan,maq\q(
                                  program,professional,kontraktor,pembekal
                                                                         berkaitan
                                  projek,dan
                               . Mengawasi   kos dankewangan   projek.

                             c. Tugasdan tanggungjawabpengurusprojek terhadap
                                klien.
                             d. Tugasdan tanggungjawabklien terhadappengurus
                                projek.
                             e. Feeataubayaranbagi Pengurusprojek. rnr!\h <\''r14\

                             Pengurus projek memainkanperananpenting yang
                             bertindakbagi men canfumkan k esemua b ahigian"projek
                             termasuk para professional ang berbeza_beza
                                                      y
                             bidangnya.
rt qS \,t       yrtq ra

l r nnr" I   f re (lr   n
nrr f 4r. t'(* r\       i'
                                                                                   '7 /1
                              C 5011
                                   PENGURUSAN
                                            PEMBINAAN

 Padaasasnya   Pengurus projek memainkantiga peranan
 (Lorshet al. 1978)iaitu :

       Perananinterpersonal
       Pemaklumatan
       Perananmembuatkepufusan.

 Pengurus   projek mestilahmengintergrasikan
                                           pelbagai
 aktiviti dan elemenyang berasinganuntuk mencapai

i.     masa.
ii.    kos
iii.   fujuanperlaksanaan.

       projekjuga mesti berkebolehan
Pengurus                           unfuk:

       bekerjamelaluiorang
       menurunkantugasantanggungj    ar,vab.
       memahami   personaliti,
                             sikapdan ciri-ciri ahli-ahli
       pasukan projek.
       tahucarannfr-ikmenggunakan   bakatyang ada.
       Pandaimendengar berkomunikasi.
                         dan
       Prihatinterhadapsikap setiappenyumbang
       tentangpolisi,had masakos dll.

 Oleh sebab Pengurus  projek terlatakditengah-tengah
saluran komunikasi,  maka dia juga perlumembuat
keputusan  yang sukaruntuk dibuat.Ada masanya
Pengurus  projek tidak rnempunyaiautoriti unfuk
membuatkeprifusan    besartetapi pengurusprojek masih
lagi orangyang paling sesuaiuntuk *.*p.rrgaruhi
keputusandan tindakanmereka yang ada autoriti
tersebut.
                                   C 5011PENGURUSANPEMBINAAN

 b. Akitek.

       .    Peranansertaperhubungan.

    Menyempurnakanhajat tuanpunyaprojek sertamemberi
    nasihatdancadangan.   Arkitek juga menyediakan
    rekabentukawal dan terperinciberdasarkan     kehendakdan
    modal yang dimiliki oleh ruanpunya   projek. Arkitek yang
    dipilih mestilah mendapatpengiktirifan persatua
    Arkitek ivlalaysia.Kebiasaannya   Arkitek adalah
    perundingyangpertama     sekalidilantik oleh pemaj'dalam
    rnelaksanakan  sesuafuprojek,Arkitek juga perlu
    mengawasi menyeliaprojek semasa
                dan                          pembinaan.  Selain
    dari itu Arkitekjuga adalahsebagai  ketui dikalangan
   Perundingjika sesuatu   projek tidak menggunakan   khidmat
   PengnmsProjek.
   Arkitek akanmemb,at lakarankasartentangin-rpian
   pembinaanPemilik dan JurukurBahan akan membr,rat
   anggaran pembinaan.
              kos             Sekiranya anggaran  yang dibuat
   adalahbersesuaian   dnganperuntukanvu"g clisecliakan   oleh
   pemilik, makaArkitek bolerrrah   melukis pelanbangunan
   yang lengkap.
   Arkitek akanmengubah     rekabentuk  asaratasnasihat
   Jurukur Bahansetelahanggaran     yang dibuat berbez,a
   samadalebih ataukurang daripada    perunfukan.

c. Jurukur Bahan (JUB).                           tu5'
                                       " t *i
                                         t t t + r'i
                                       -
   .       Peranansertaperhubungan.    - !awat     K 't       a ; {a 1 a \
                                        - f^!\     {l o n '

  SebgaiPerunding,   Jurukur Bahanmestilah mendapar
  pengiktirafan Institut surveyor Malaysia. N4erekaini
  boleh dianggap  sebagai Akauntan danlriga peguamatau
  penasihat dalamindustri binaan.Berp..onu.,sebagai
  penasihat padaperingkatawal walaupunlukiian
            kos
  terperinibelumdisediakan.   Bolehbertindaksebasai
  perancang bagimenganarisa
             kos                  secarasistemarif
                                                 setiap
  elemendi dalamsesebuah     bangunanseftamembuat
  perbandingan dengan   kos keseluruhan.


                                                                             i6
                                         C 5011PENGTIRUSAN
                                                         PEMBINAAN



       Antara tugas-fugas
                        fUB :

       i.       Menyediakandokumentawaran.
       ii.      Dalam prosesrekabentuk     Jurukur Bahanakan
                membuatanggaran     berdasarkan   draf yang
                disediakan ditambah
                            dan           dengananggaran    oleh
                Perundingelektrik danJentera.
       iii.     Jika anggaran  tidak sesuai denganperuntukan   yang
                adamakaperunding
                JurukurBahan hendaklah     memberi nasihatkepada
               pihak yang berkaitanuntuk melakLrkan      pindaan.
               JurukurBahanjuga perlu memastikansernua
               dokumenkontraktelahditancla      tangani.
       rzi     Merekajuga perlu memastikan     Kontraktortelah
               menyediakan    kesemua  insuran-insuran   yangperlu
               sebelum  kerja bermula.
    vl1.       Merekaj, gu b ertan ggun ar,vab
                                        gi       rneni ai kemaju an
                                                      I
               kerjadan menyediakan bayaran
                                       sijil         kemajuan
               semasa ek sedang
                       proj           dilaksanakan.
   viii.       JurukurBahanjuga mengarvalkos agar harga
               pembinaan   tidak melebihidaripada   peruntukan  yang
               disediakan_
   ix.         Semua  pindaankerjaperlulahclinilai.                 ]
   x.          Di akhir projek merekaperlr_r menyediakan    akaun
               muktamad.

d. J urutera.

   .         Perananserta perhubungan.

  Juruteraprojek hanyabolehmengawaloperasitapak
  mengikutsyarat-syarat konffak.
  secarapiawainyaseorang   Juruteraperlu merekodkan
  kemajuankerja dan memberitah' Kontraktor sekiranva
  tidak mengikutjadual dan spesifikasi.Jurutera
                                             juga
  mestilahmemben  nasihatteknikalkepadaKontraktor
  tentangspesifikasi
                   yangpafutdiikuti.



                                                                 71
                                       C 5OI1PENGTIRUSAN
                                                      PEMBINAAN

          Juruteramestilahseorang  yang berkelayakan berdaftar
                                                   dan
          dengan rnstitut Jurutera Maraysia.peranannyahampir
          samadenganArkitek tetapi merujuk kepadabiiang
          masing-masing  dan selaluberhubungdenganArkiiek.

          Terdapattiga kumpulanutama iurutera:

                 Jurutera Strukfur
                 JuruteraArvam
                 Juruteraelektrik
                 JuruteraJentera


I.5.3 KOJ\TRAKTOR
                         ^/
          r Peranan sertaperhubungan.

           Merupakanahli kumpuran .Iurubina yang merupakan
          pihak sebenar  yangakanmelaksanakan    keija_kerya
          pembinaan tapakpembinaan.
                      di                  Kontraktoitercli'
          samada   daripadabadan-badan   korporat,syarikat
          perkongsian,persendirian  ataupun usahasama. Biasanya
          dipilih melaluiproses tawaran.Ia menjarankan  keria
          pembinaan   dengan hargadan tempohyang telah
          ditawarkanolehnya.Segala    kerja pembinaan yang
          dijalankanakan.di  arvasioleh pihai perundinj bagi
          memastikan   kerja-kerjamengikutpenentuan rukisan
                                                     dan
          yang ditetapkan.

      .       TanggungiawabKontraktor:

                 Membinadanmenyiapkan projekpembinaan
                 berdasarkan
                           dokumenkontrak.

          n      Menanggung  segalakeq'ayangtelahdilaksanakan
                 dan disiapkan tapakbina.
                             di




                                                            10
                                                            /()
                                  C 5011
                                       PENGIIRUSAN
                                                 PEMBINAAN

     iii.     Melaksanakan  keq'adenganterafurdan cekapbagi
              menyiapkan  kerja mengikuttarikh yang telah
              ditentukan.

     iv.      Memafuhisegalaperafuranpihak berkuasa
              tempatan.

     v.      Menyediakanperlindunganinsuranke ataskeria
             danpekeq'anya.


.         TugasKontraktor:

    i.       N{engernukakan periaksanaan
                           bon                  yang
                                          seperti
             terdapat
                    dalamsuratsetujuterima.
                                          Biasanya5o/o
             daripadahargakontrak.

    ii.      Mengemukakan poiisi insuranberkaitanclengan
             keselamatan
                       orangramai,kebakaran  danSOCSO.

    iii.     lvlelantik
                      rvakil tapakatauagenunt*k menerima
             arahan daripada  Pegawaipenguasa(p.p).

    iv.      IVlernberitahu mengenaisebarang
                          P.P              perfukaran
             alamat.

v'           ivlembenarkan atauwakilnya memeriksa
                         P.P                    rekod
             Kontraktor.

vi.          Mengesahkanarahan perubahansecara berfulis
             dalammasa7 hari selepas
                                   arahanditerima.

vii.        Mengik,t wakf'kerja yang ditetapkan.Jika waktu
            lain perlu mendapat
                              kebenaran dari pegar,vai
            penguasa.

viii.       Tidak menceroboh
                           kar,vasan
                                   seraindaripadatapak.

ix.         lllengemukakanprogramkerja dalambentuk
            kaedah LaluanKritikal atauCartaBar.

                                                          79
                               C 5011PENGLR.USAN
                                               PEMBINAAN


 X.      Melaksanakankerja menggunakan  bahandan
         melaksanakankerja mengikut upayakerj seperti
                                            a
         dalam dokumenkontrak.

o Kategori Kontraktor

 Kontraktorboieh dikategorikan kepacla jenis:
                                     tiga

 a. Kontraktor [Jtama./

      Merupakanpihak yangmendapatprojek daripada
      Pemilik.Mereka bertanggungjar,vab
                                      rrp.nuhnyn
      terhadapperlaksanaan pengenclalian
                          dan              kerja
      pembinaan tapakbina bagi sesuatu
                di                      projekmengikut
      syarat-syarat
                  yangtelahdipersefujui.
                                       Kebiasaannya
      merekaakanmenyerahkan   sebahagian kecil kerja_
      keq'apembinaan tersebut
                            kepadasubkontraktor_

   Ia diibaratkan sebagaikunci kepadasemua    masalah
   danpenyelesaian.  seraindari itu ia juga memainkan
   peranan   utama.
                  dalamsetiappengawasan     projek dan
   dipertan gungj a'u'ab
            g          untuh melaksanakoo    akii,riti -
   aktiviti pembinaan mengikutspesifikasi  penyiapan
   yangdikehendaki   olehpihak pemaiu.


b. Sub Kontraktor. o/

  Sub Kontraktor ataupun  kontraktor kecil akan
  mel;aksanakan  bahagian_bahagian tertenfu  danpada
  projek yang telah diperolehioGn Konffakror
                                              uian a.
  Kontraktoryang ingin melibatkandiri dalamprolek
  pembinaan mestilahmendaftarkan   cliri atausiarikat
  merekadi PusarKhidmat Konffaktor (pKK)
                                              dan
  CIDB' Terdapat  dua(2) kategorisubkonfrokto.iaif':




                                                     80
                         C 5011PENGIIRUSANPEMBINAAN


i.     SubKontraktor
                   Dalaman.
                          " il)lj, il^o
       Sub Konlraktor yang dilantik sendiri oleh
       Kontraktorutama unfuk melaksanakan     yang
       melibatkankerja-kerjafukangbagi pembinaan
       yang dilaksanakanoleh Kontraktor Utama.

l I.   Sub Kontraktor Di namakan. \-/

       Merupakansub kontraktoryans dilantik oleh
       Pemilik ataupunPerundingunhtk
       melaksanakan a-kerjapakar seperti
                      keq
       pemasangan hai,va
                   lif,   dingin, elektrik,clll.




                                               8t
                                                                                           C 5O1iPENGTIRUSAN
                                                                                                          PEN4BINA-AN

                                                            I.5.4 PIHAK BERKUASA NIE]VIBERI I(BLULUSAN

                                                                A. KBRAJAAN TBNIPATAi\

                                                               o Perananserta perhubungan.

                                                                 KerajaanTempatanberperan member keh-rlus
                                                                                            an              an
                                                                 perlaksanaan
                                                                            projek pembinaan   sertamenyediakan satLr
                                                                 pelan pembangunan   yangteratur. N4erekajuga akan
                                                                 mengawal agartidak terjadipenyele\.vengan
                                                                                                         dalarn
                                                                 gunatanahsepefiiyangtelahditenfukan.

                                                                 contoh yangjelas adalahsepertr stratatanahpertanian
                                                                 perlu ditukarkepadastratatanagperindustrianjika
                                                                 Pemilik ingin membina kilang . Stratatanahbansunan
                                                                 hanyabolehdi bina pembinaan  bangunan  sahaja utu,
                                                                                                               di
                                                                 tanahcadangan  projek.

                                                                TerdapatpelbagaiJabatanyang terlibatclalam
                                                                perlaksanaansesuahr projekpembinaan.setiap Jabatan
                                                                mempunyai  kehendak-kehendak perlu dipatuhi
                                                                                                yang
                                                                oleh Pemilikprojek, Selainciariitu peranan
                                                                                                         Jabatan_
                                                                JabatanKerajaan adalahuntuk:

                                                                      Memberikelr-rlusanperlaksanaan projek
                                                                      pembinaan.
                                                                      Mewujudkan satupembangunan    yang teratur.
                                                                     Memastikan  tidak berlakupenyelewengan
                                                                      terhadapgunatanah sepertiyang telahditentukan.
                                                                     Tidak rvujud pencemaran terhadapalam sekrtar.
                                                                     Tidak berlakuekploitasiterhadap sumber_sumber
                                                                     asliyangsediaadadi sesebuah  kawasan.
                                                                     Melindungikehendak   sosialmanusia
                                                                     Memastikan  matlamat sertadasar-da.sar
                                                                                                          keraiaan
                                                                     tercapai.
 V. \ l'\ (r   $ d Yl                                                                                           l rtn
                                                                                            3 e\ra{ a
! \ qn          -       { } v\ }r\i 4   \ r"'rdl t
                                                                                            - 1tr' * l " t
          .srql                          l i Jth r8 l 6 l                                        \1   thl tu\F '/h
                         \,

    q lc \          <qv
                              ,:t'*l                                                               v t '4 "
                                                                                                               no "
   -$ ^        V ltct           u lY

   1/ c :rl rro n                                                                                                       82
                                          C 5011 PENGIIRUSAN PEMBINAAN


Antara Jabatan-jabatan pihak KerajaanTempatan
                      bagi
yang terlibat ialahseperti:

o        P TG   r' p L J { lr h 4 7 a r n ,
o        PBN
.        PPBD
.        MAJLIS DAERAH
.        MAJLIS BANDARAYA
.        DE,WANBANDARAYA
.        KERAJAAN NEGERI



B.        TELEKONI

     Dulu tanyasebuahbadankerajaan   yangclikenali
     sebagaiJabatanTelekomMalarrsia.  Ianvatelal-r
     diperbadankan diswastakan
                  dan             pada1i haribulan
     Oktober 1984dan di tukar kepada syarikatTelekom
     MalaysiaBerhad.yang  dikenaiisebagaiTM dan telah
     disenarai
             dalamBursalVlalaysia  pada9 haribulan
     September 1990.

     .    PeranansertaPerhubungan.

          Telekommemainkan     peranan pentingdalam
          merencaltakansistemyangberkaitan   dengan
          telekomunikasi. sesuatu
                        Jika         projekbaru ingin
          dibangunkan pelu mendapat  kelulusanpelan dari
         TelekomMalaysiaBerhad keranasetiapprojek
         bam perlukepada   liputan danpemasangan  kabel
         Telekom.Ini penting supaya   kemudahan
         komunikasibagi projek yangakandibina aka_rr
         mendapat kemudahandan perkhidmatan      dari
         pihak Telekom.Pihakpemajuperlumendapat
         kelulusandari TelekomMalaysiaBerhacl    semasa
         peringkatkelulusan  pelanpembinaan  projek
         lagisebelumproses  memanggil   memanggil tender
         diteruskan..


                                                              83
                            C 5OI1PENGIIRUSANPEMBiNAAN

c.     TENAGA NASIOi\AL BBRHAD (Ti\B)

     o PeranansertaPerhubungan.

       TenagaNasionalBerhadberperanandalam
       menentukan sesuaiandan kelulusan pendar,v an
                 ke                           ai
       danbekalan
                tenagabagi satu-satu
                                   projek.

      Selaindari TelekomMalaysiaBerhacl,  pihak
      Pemaju juga perlu mendapat kelulr_rsan TNB
                                           clari
      semasa peringkatmemohonkelulusan    pelanbagi
      pembinaan  sesuafuprojek. TNB berperanan
      memberiperkhidmatan kemudahan
                            dan             penyaluran
      bekalan tenagaelektrikkepada kawasan  projek
      yangbarutersebut.

       Segalaperkaraberkaitankedudukan     kabelbasi
      bekalantenaga  elektrik,TNB juga perlu
      memikirkanempangan      hidro barujika perlu,
      iampujalan,bekalanke unit-unitpengguna.
      pembinaan -Station olehpemaju perlu
                 Sub
      ntemafuhi piawai semasa   peringkatkelulusan
      pelanprojek.Pemaju   mestimematuhiapayang
      telahdiluluskanoleh TNB danpihak -fNB juga
      mestimembekalkan   perkhidmatannya    dengan
      sempurna. Selain dari iru semuaperkara_per,kara
      yangberkaitan denganTNB perlu mendapat
      kelulusanpihak TI{8.




                                                  84
                            C 5011PENGIIRUSANPEMBINAAN

D.     JABATAI\ BOMBA

     o Perananserta Perhutrungan.

       Jabatan Bomba merupakansalahsatubadanyang
       teriibatdalamkelulusan sijil Layak ivlendurluki
       (C.F) atauSijit Penyiapandan pematuhan
       (CCC). Pihakbombaakanmemberinasihatdan
       kelulusan dari segikeselamatan keselesaan
                                       clan
       pengguna juga tentang
                 dan             perkhidmatan
       bangunan  yangperlu mematuhikehendak    unclang_
       undangkecil bangunan  supayaapabilaada
      kecemasan   ataukebakatan, pihak yangterlibat
       dapatdiselamatkan  termasuk  premis,pcngguna,
      jiran dan orangawam.

      PihakPemaju juga perlu mendapat kelulusan
      JabatanBombadari peringkatkelulusan  pelaniagi.
      PihakJabatanBombaakanrncmastikan    segala
      kemudahantentang kebakaran, hyclrant,
                                 fire         segala
      kelengkapan
                kebakaran kecemasan
                           dan            sertalokasi
      pemasanganperalatankecemasan  dipafuhi.

      Projekyang dibinaperlu mematuhi Akta
      Keselamatan dan Kesihatanpekerjaan,Llnclan
                                               g_
      undangkecil bangunan tentangkeselamatan,
      kecemasansertakebakaran.




                                                  85
                            C 5Oi1 PENGURUSAN
                                            PEMBINAAN

E,     JABATAJ\ KERJA RAYA, JALA]\ DAN AIR

     o Peranan sertaPerhubungan.

        JabatanKerja Raya bertanggungjawab  terhadap
       pembaikanpenyenggaraan   semuakenderaan   dan
       bangunanKerajaandan berkhidmatsebagai
       penasihatteknikalkepadakerajaan  diperingkat
       Persekutuan negeri.mereka
                   dan               juga merupakan
       Pemilik projek Kerajaanyang terbesar. Mereka
       juga merancang  pembangunan,  rekabentuk,
       pembinaan pengenggaraan
                  dan               jalan-jalanawam,
       bekalanair ar,vam bangunan-bangunan
                        dan
       gunasama  bagi KementerianKerja Raya.

      SecaraantnyaJKR merupakansatubadankerajaan
      yangmemajukan    projek-projek Kerajaan.
                                             JKR
      Jugaadalahsebagai   wakil KerajaanMalaysia
      sebagai PemajuatauMajikan atauKlien kepada
      kerajaan Malaysia.Banyakkontrakdan tencler
      dikendalikanoleh JKR daiammemajukan    Negara.
      Projekyang seringdimajukanoleh JKR adalah
      sepertipembinaan  bangunan, Jalanraya,
                                           saliran,
      bekalanair dan lain-lain.

      JKR juga perlu memdapat          pBT
                             kelr_rlusan jika
      ingin membinasesuatuprojek bagi pihak
      Kerajaan.




                                                  86
                               C 5011PENGTIRUSAN PEIVIBINAAN


F.       PEMBENTTI{\GAI\ (Indah \yater)

     .   Perananserta Perhubungan.

         Pembentungan alunyadikaitkan denganInclah
                       sel
         Water Konsortium (IWK). Ianya adalahsafubadan
         yang melaksaks akankerja-kerja y angb erkaitan
                        an
         dengan kerja-kerja p enyambun
                                     gan, p emasangan,
         pengaliranterhaclap sistempembentungan di
         Malaysia.

G.       JABATAN ALAM SEKITAR.

     .   PeranansertaPerhubungan.

     Jabatan Alam Sekitarpula berfungsiuntuk
     rnemastikanaktiviti yang bakalatausedang
     dijalankantidakmencemar   keaclaan
                                      alam sekitar.

     Segaiabentukpencemaran    terhadap Alam sekitar
     mestilahdiarnbilberat dan dipaftrhioleh semllapihak
     yangterlibatdalamsesuatu  projek.

 Merekajuga mestilahmemastikanagartiada
 eksplortasiterhaclap
                    sumber-sumber yang sedia
                               asli
 ada di sesebuahkalvasan.




                                                      R7
                                 C 5Oi1 PENGURUSAN
                                                 PEMBINAAN

I.5.5 PE1VIBBKAL

       .   Peranan serta Perhubungan.

           B erperanan membekalkanb ahan-bahan   binaandan
           logi yang diperlukandi tapakbina. Terdapatdua
           (2) kategoripembekaliairu:

       a. PembekalDalaman,

           Merupakanpembekalyang dilantik senclirioleh
           Kontraktor unfuk membekalkan
                                      bahan-bahan   dan
           logi ke tapakbina.

      b. PembekalDinamakan.

           V{erupakan pembekal  yang dilantik oleh pemilik
           projek ataupunkumpulanperunding. Laztmnya
           pembekalDinamakan dilantik untuk
                                ini
           membekalkanbahan-bahan peralatan
                                      atau          yang
           khusussepertisistempenggera plaster ceiling,
                                         ,lif,
           pintu kacakalis peluru, dll.




                                                       B8
                                                                        C 5011PENGT]RUSAN
                                                                                        PEMBINAAN

                             1.5.6 SYARIKAT I(EWAI\GAN

                                              .     Peranan sertaPerhubungan.

                                                    Pemilik projek lazimnyatidak mempunyaisumber
                                                    kewanganyangmencukupiuntuk membiayai
                                                    projek yangsedang  dijalankan.Merekaperlu
           t^b4'U
       f
                                                    membayarkepadaKontraktor segalakos yang
       'f
       qro 5rk -.=-1
                                                    telah dikeluarkandalammasatertenfu.
  j1                                               Sehubungan  denganitu pemilik lazirnnyaakan
                    l<                             memiryam daripada institusi-institusi
                                                                                       kewangan
 \
  t                    I       .,-
                                   o/,             sepertibank,syarikat-syarikatker.vangan lain-
                                                                                          dan
ba{x                ban, l
                              \ ,-,,,              lain sumber.
                              \
                                     ^^
                                                 ) h\ , f nr : J
                                  ' ,*u^trtl -,^ _
                                             I Insfirusikervangan juga fumt memberikan
                                                                 ini
                                            6a,i.kemudahan pinjamankepadaKontraktordan
                                               Pembekal.  Perananinstitr,rsi
                                                                           kewanganmemang
                                               pentingdalampembiayaan     sesuatu
                                                                                projek.

                                            o Bentuk-bentukkemuclahan
                                                                    pembiayaan

                                                  Bentuk-benfukkemudahan   pembiayaan  yang
                                                  ditawarkanoleh institusiker,vangan
                                                                                   ialah:

                                                   i.   Pembiayaan  akhir.
                                                   ii.  Overdraf.
                                                  iii.  Pemfaktoran.
                                                  iv.   Pajakan.
                                                  v.    Pendiskaunan  Terhad.
                                                  vi.   PinjamanBersyarat.
                                                  vii. Kredit Pusingan.
                                                  viii. Pendiskaunanbil.
                                                  ix.   PersetujuanJurubank.
                                                  x.    Surat Jaminan.
                                                  xi.   Dll.




                                                                                              E9
                       C 5011
                            PENGIIRUSAN
                                      PEMBINA{N

 Kriteria-kriteria projek untuk pembiayaan.

 Antara kriteria-kriteriaprojek yang boleh
 dipertimban gkan oleh institusi kewanganunfuk
 pembiayaan  terhadapsatu-satu   projek ialah:

 i.    Aspek Lokasi.

      Lokasi cadangan    projekperlulah
      bersesuaian denganpembangunan     kawasan
      sekitar.Jika lokasiprojek perumahan yang
      ingin dibina itu perlulahberhampiran
      dengantempatkerja,kemudahun     u-u* serta
      mudahdihubungi.Selaindari iru projek
      yang akandibinaifu mestilahberpotensi  dari
      segi ekonomi dan dapatmeningkatkan   lagi
      kitaranekonon-ri  sediaadadan berdaya
      maju.

ii.   Aspek ekonomi.

      Permintaan danpenawaran   semasa  di
      kawasancadangan   projek pembangunan
      merupakancriteriautamayans akan
      dipertimbangkan barvahorf.t ekonomi
                      di
      keranafaktor permintaandan penawaran ini
      akanmempengaruhi   secara langsung
      kejayaansesuatu cadangan  projek.

      Projekyang akandilaksanakan
                                mestilahdi
      Kawasanyang dijangkakanterdapatlebihan
      penawaranberbandingdenganpermintaan.




                                             90
                       C 5011PENGURUSAN
                                      PEMBINAAN

lll.   Aspek Harga Jualan

       Cadangan   hargajualan haruslah  munasabah
       berdasarkan kepadajenis pembangunan     clan
       lokasi projek berkenaan.Nilai pasaran
       hartanahmestilahsebanding    dengan  yang
       terdpatdengannilai di sekitarkawasan
       pembangunan    yang pafut dipertimbangkan
       dalammenentukan    cadangan  harga jualan.




                                               91
                                 C 5011PENG{IRUSANPEMBINAAN

1.s.7 PEKERJA/BURUH

      .   Peranan sertaperhubungan.

          Buruh ialah orangyang menyumbangkan    kerjanya
          bagi pihak Pemajumelalui Konkaktor samada
          secaramahir, separamahir atauburuh am atau
          bumh kasar.mengikut bidangkerja terfenfir.

          Buruh secara kontrak biasanyaterbahagikepada
          tiga (3), mengikutkategorikemahiraniaitu:

          i. Tukang

            .   Buruh IVIahir.

                 Jugadikenalisebagai
                                   TukangataLr
                 Craftman.

                 BuruhMahir ini ialah orangyang mahir
                 melaksanakan  sesuatubidangpekerjaan
                 dari segiperfukanganseperti fukang
                 kayu,Tukang  Besi, penurapBata, Tukang
                 Lepa,Tukangpaip dansebagainya.

                Tukangakan dibayarupahmengikut kaclar
                harianataujam sepertiyang dijelaskan
                sebelum ini.IJpah yang mahal akan dibayar
                kepadatukang mengikut hargapasaran
                semasa juga jenis kerumitankerja.
                       dan

            .    Buruh SeparaNlahir.

                Buruh Separa Mahir ialahpekerjayang
                bekerjasebagai pembantu kepacla  Tukang.
                Biasanya pekerjaseparuh mahir cliperlukan
                apabilaterdapatbanyakkerja_keqa  yang
                samaperlu dilaksanakan oleh Tukang.
                Kadarupahnyalebih rendahberbanclins
                Tukang.

                                                      92
                    C 5011PENGTIRUSAN
                                    PEVIBINAAN


ii. Buruh am.

  Dikenalijuga sebagaiburuh kasar.Buruh ini
  merupakan buruh yang kurang mahir
  melakukansesuatu  kerja mengikut yang
  diarahkanoleh tukangatauburuh separuh
  mahir.

  Buruh am ini diperlukanditapak bina Lrntuk
  melakukankerja-kerja seperti
                             :

   .   Mengangkutbahanbinaan.
   .   Membuangbahan-bahan.
   .   Membersihkantapakbina.

  Bayaranuntuk buruh am ini lebih murah
  berbanding
           dengan buruh mahir dan separa
  mahir.

iii. Kepala (Foreman/Supervi
                          sor)

  Ditapakbina juga dikenalisebagaigeng
  kerja.Kepalaialahseseorang yang mengetuai
  sekumpulanpekerja bagi:

  o Tukang
  o Separuhrnahir
  . Buruh kasar.

  Kepalaperlu bertanggungjar,vab
                               untuk
  mengendali dan menyeliakerja-kerjadi tapak
  pembinaan bagi pihak Kontraktor.
  Biasanyaorangyangberpengalaman    dalam
  bidangterlenfutermasuklah mengurusan  bahan
  binaan,alatan logi sertabumh.
              dan

  Kepalaakandibayarmengikutgaji bulanariclarr
  diperuntukan dalamkos pengurllsan
              di                   syarikat
  kontraktorberkenaan.


                                               93
       c 5 0 11                                       PERAN ANG DANKAWALANPEAABI
                                                          C   AN              NAAN


PERANCANGAN
          DAN PENGAWALANPEAABINAAN


PE R A N A N E N 6 U R U s R OJE K
            P            P

           Pengurus   projek bertonggungjowob      mengowol   keseluruhonprojek.Bogiprojek
 yang cukup besor untuk membenorkonposukon penguruson                   sepenuh moso ,dio
 mungkindibontu oleh juruukur bohon berhubung dengonkowolonkeewongon                     don
 penyelrakeria,berhubung dengankemojuontopok don kowolonmutu.pokor mungkin
jugo diperlukonuntuk mengowol            pemosongon  elektrik otou kelengkaponmekonik  yang
 rumit.
           Sering koli pengurusprojek perlu mengowoldengon pujukon,bukon             dengon
menggunokon        kuosonyo  secoro lonsung.ini    odolh solohsotu olosonuntuk membentuk
posukonpenguruson          yong ohlinyo sentioso beruboh podo setiap peringkot projek
,sebogai    contoh ,semoso     dolomparingkotroko bentuk ,paroorkitek yong ditugoskon
untuk projek tarsebut munkin dori KementerranKerlo Royo,monokolo                   pengurus
p r o l o k p ul o d o ri K e me n te ri o n Kesihaton.sekir onyopenghosilonlukison tidak
menepotijoduol, pengurus         projek tidok berhok mengorohKementerion        Kerjo Royo
memPeruntukkonsumber tombohon untuk mempercepot penghosilon lukison
 tersebut.Apoyong boleh don perlu dilokukonodoloh dengonmemoporkon                    keson
doripodo kelewotqn ini terhodop keseluruhon projek.sekironyoorkitek teloh
melibotkondiri dalom peroncongon              projek ,sebagaisebohogion  doripodo posukon
toklimot don rekq bentuk,peluong          untuk gerakbolosyongboikodoloh   lebih tinggi.

Tokrif pengowolon:

      pencopoion      sebenor,oktiviti-oktiviti don pencopoion     terancang otou piawoi
      Ya n g d i te to p ko n o d o l o h somo. Tindokon pem betulonper lu dilokukonji k o
      terdopot sisihonontoro keduonya.
   i' Soiu set oturcoro untuk membondingkon            ontoro pencopoion  sesuotuqktiviti
      denganperoncongon          osol.

Sisfem kowolonyongboik hendoklqh          mempunyoi objektif utomo:
                                                   3
        o. memostikon       perloksonoon    peroncongon
                                                      projek.
        b. Mengeson       seborong     perubohon.
        c " Me n i l o ike so np e ru b ohon m emper bqiki em ohon.
                                           don           ker




                                                                                     I I 1l
       c 50 11                                     PERANCANGAN KAWAUN PEMBINAAN
                                                             DAN


JENIS-JENI5 KAWALAN
I. Kowolonsebelum tindokon(pro-kowolon).
                                      - memostikon bohowo sebelum sesuotu
   tindokondijolonkon,segalakeperluon
                                    termosuksumbermonusio    perlu diombil
   kiro.
2. Kowolonberpondu- mengeson   lencongondori setengah-setengahpiowoiotou
           don
   motlomot membolehkon    pembetulondibuotsebelumtindokon disempurnqkon.
3. Kowolqn selepostindokan- mengukurhosil-hosil  dori tindokon yang teloh
   diloksonokon.

Modelsistemkowolon
                 projek

                                  PERANCAN6AN
                                    &
                                  PERLA
                                      KsANAAN
                                    &
                                  PEN6AWASAN
                                    &
                                   PENILAIAN
                                    &
                                  PEN6UNJURAN

           kowolon:
Kepent.ingon

Mestiloh merongkumi       perkoro-perkoro
                                        berikut:
  o. lukison   don penentuon.
  b . At u r co rod o nj o d u o l .
  c. Koedoh     kerjo.
  d. Orgonisosi     penguruson.
  e. Perhubungon.

Lukisandon penentuon




Afurcorq don joduol




                                                                          2t1l
        c 50 11                                       PERAN AN GAN DAN KAW Ai-/'N PEInIBI AAN
                                                           C                            N




Koedohkerjo




Orgonisosi     penguruson
Mesti terdiri dori kokitongon yong berkeloyakkon don keupoyoonmeloksonqkon
f ungsi-f ungsiberi kut :
                           n
    o " p e n j o d u o l od o n o n o l i si so duol.
                                              j
    b" Belonjowon.
    c . An ol i si s re sto sike rj o .
                    p
    d. Pentodbiron         kontrok.
    e. Penguruson         pembinoon.

P e r h u b u ng o n




Kesinrpulonnyo,       kowolon  diperlukon     kerono:
1. Memberiperhotionkep.odo               penyimpongan yangkeforo.
2. Memberiperbondingqn              yong sebenar  don bermokno.
3" Memberimoklumot            jenis tindokonyongperlu don siopoyangber'tonggungjowob.
4 . R i n g k o s o n mu d o hd i fo h o mi .
                d

      Moso
Kqwolon
  1. Corto bor.
  2. Corogont.

Penivedioon    Corto Gont
  1. Menyediokon             senoroioktiviti projek.
  Z. Menganggqrkon             jongkomoso      don sumber.
  3 . A k t i v i ti d i l o mb o n gme l o l uibqr m endotor yong dilukis mengikutskolo don
      d i p l otko n .




                                                                                       3ttL
      c 5011                                         PERANCANGAN KAWALANPEIABI
                                                               DAN           NAAN


CortoBor
Kebonyokon   projek, wolou bogoimono     kompleks sekolipun,bermulq dengan
digomborkon  meloluisebuohcorto bor. Woloupun     teknik yong lebih sofistikoted
perluuntukperoncongan    Ferperinci,
                                   keputuson-keputuson ditunjukkon
                                                        sering            dolom
bentukcorto bor.
 Prinsip-prinsippenggunoon  CorFaodqloh sepertiberikut;
   o. Menyediokon senoroi
                   sotu        oktivitiprojek.
   b. Mengonggorkon donsumber
                      mosq             yangdiperlukonuntuksetiopoktiviti.
   c. Setiop oktivitidilombongkon        bor
                                 melolui mendotor     yongdilukis menurut  skola
      moso.
   d. Aktiviti-oktivitidiplotkon
                               podocorto dengon  skolomoso  mendotor dengon  itu
      dopot dilihot bilo oktiviti-qktivitiitu dironconskon  untuk bermulodqn
      berokhir.


Kelebihon Corto Bor
  o. Teknik ini sangotmudohsomoodo untuk menyediokonnyo untuk membocq otou
     don memohominyo.            Perkoro ini songot penting kerono semuq pihok dopot
     menggunokonnyo          dengon mudoh. Perlu disedori bqhowo romoi kokitongon
     topok yong tidok mempunyoi            keloyokon otou lotihon khususdolompenguruson
     projek.
  b. Gomboron       tentong keseluruhon       projek dopot ditunjukkonsecoro menyuluruh
     di peringkotowolprojek.
  c. Kemojuon       kerjo sesuotu elemen      boleh ditondokondengonmudohdibowohbor
     o s o l. Ol e h i tu p e n g o w o son
                                          boleh dilokukondon difohomi oleh sem uo p i hok
     denganberkeson.
  d. Teknik ini boleh dijodikonososdqlom mengiraniloi kerjo terhodop mqsodon
     seterusnyodigunokon           dolompenyedioon   unjurontunoi..

           Corto Bor
   Kelemohon

  o ) H u b u n g ko i td o n p e rg o n tungon
                                              ontor o oktiviti- oktiviti binoon tidok oopoT
      ditunjukkon.fni bermqknqcorto bor tidok dopot menunjukkon               uruton ontoro
      oktiviti ioitu mqnq yang terdqhulu,monoyong boleh dilokukonserentok don
      monoyang kemudion.           Perkoroini pentingbogi projek yong besor don kompleks
      yongmelibotkon         bonyokoktiviti.
   c 5 0 11                                       PERANC
                                                       ANGANDANKAWALANPE/ABI AAN
                                                                          N


b) Kesonkelewqtonsesuotu oktiviti terhodop keseluruhonprojek tidok dopot
   ditunjukkon dengan nyoto. fni kerqno tiodo sotu rongkoion yang dopot
   menghubungkon semuooktiviti.

c) Seteloh semokondibuot, perubohonyong dimosukkonke dolom Cortq Bon
   tidok dopot dilihot kesonnyoterhodop keseluruhonprojek seperti keson
            di
   kelewotqn otos.
Bogi mengqtosikelemohon  diotos corto bor berkoit teloh diperkenolkon.nomun
dernikion,
         teknik corto bqr berkoit tidok begitu digemoridon jorong digunokon.
Seboliknyokoedoh loluongenling merupokonteknik yong semokindigemori di
somping corto bor.
                    Teloh ditunjukkon bohowo corto bor merupokonsotu doripodo
koedoh penjoduolondon kowolon pembinoonprojek yang poling tuo. Tetopi
semosostruktur modendironcong,                 hod yong besor dikenokondiatos koedoh ini.
Hod ini timbul kerono peroncang             mengalomi kesukoron dolommenentukon  susunon
nktiviti. Operosiyong dipilih biosonya           mempunyoi skop yong besor don keputuson
rnemilih     oktiviti yong monohorus di-loduolkan       dohuluodolohsukor keronobonyok
berloku pertindihonmosoperloksonoon.               Seterusnyohubungon yong ujud diontorq
o p e r o s i -o p e ro si d o k d o p o t ditunjukkon dengon jitu woloupunio m un gk i n
                         ti
diketohuisepenuhnyo            oleh peroncong.
             Woloupun corto bor mempunyoikekurongon,io teloh diterimq
secoro meluos kerono senong difqhomi oleh hompir semuo orong. Corto ini
menunjukkon  roncongon progrom di dqlom sotu formot yong podot don senong
          di
digunokon dolom roncongon    don kemqjuonprojek. Keboikon-keboikon tidok
                                                                 ini
seharusnyo diketepikon. Seboliknyo ospek parhubungon corto ini harus
dipertingkotkonlogi meloluipenggunoon
                                    peroncongqn rongkoion.


      LqluonKritikol (CPM)
Kcredoh
Satu teknik yong digunokonbogi membolehkon        sesuotu projek dironcongdon
dikqwolmeloluikefohomon     yong lebih boik terhodop keseluruhon projek. Koedoh
l-qluonKritikol berdosorkonrongkoion    lojik yang merupokon gombor rojoh yong
ditukis dengan  menggunokqn  simboltertentu. Rongkoion lojik pulo ioloh rongkoion
oktiviti-oktiviti bogi peloksonoonprojek yong disusunmengikuturutonyong lojik.
           in
K q e d o h i me l i b o tko n tu te k nik yong lebih r umit don sukor untuk disediok on.
                             so
Kqedqh    tersebut biosonyo     digunokon    sebogoioturcoro indukyong digunokon   bogi
me.gowosi     kemojuon    keseluruhon   projek.


                                                                                  5 I rl
    c 5 011                                        PERANC
                                                        ANGANDANKAWALANPEIABI AAN
                                                                            N


Keseluruhon  rongkoionboleh dipecahkonkepodo beberapo bohogionkerjo don
dinyotokon dolom bentuk corto bqr bogi memudohkonkokitongon topok.
Keistimewoonnyq     terletok podo kebolehonnyo
                                             untuk menunjukkqnkeseluruhon
oktivifi dolom sotu rongkoionsohojo. fni bermokno hubungkoit ontoro semuo
oktiviti dopot dilihot dengannyoto.
cr. Simbolyong Digunokqn

               i . A n o kP o n o h



   Menunjukkon oktiviti yong memerlukon mosodon sumber-sumber Anok
                                                              loin.
ponoh dilukis
            tidqk mengikut skolo.Kepoloonokponohmenunjukkon
                                                          okhir sesuotu
oktiviti monokolo
                nomqoktiviti diletokkon
                                      diotosonokponoh
                                                    tersebut.
              i i . B u l o to n e ci l
                                K

                  progrom




             mulo
          moso                                     m ulookhir




Si m b o l b u l o to n ke ci l me n u n jukkon istiwo ioitu titik m oso otou per silongon
                                              per
sesuotuoktiviti itu bermulo            qtou berokhir. Peristiwodi kepoloonok ponohmesti
lebih besqr doripodo nombor peristiwo ekor onok ponoh ioitu mosoterowol don
mosoterlewot.



                  AnokPonoh
                          Terputus-putus




Simbol onokponohterputus-putusmenunjukkon
                                        oktiviti domi(dummy). Aktiviti
domi digunokon
             honyountuk memqstikonsupoyotidok odo duo olternotif yong
memPunyoi nomborperistiwoyongsomodi keduo-duokepolo don ekor. Aktiviti



                                                                                  6 l ll
        c 5 0 11                                      PERANCANGAN KAWALANPEIABI AAN
                                                                DAN           N



                      moso don oktiviti kerono io odoloh simbol perhubungon
   domi tidok mempunyoi
   semoto-moto.


fstiloh

   '    Aktiviti - Sotu-sotukerjo yong melibotkonsumber don moso. Contohnyo ioloh
        mengkonkrit, pemosongqn    tetulong don penggolion. diwokili oleh onok
                                                           fo
        ponoh.
   .    Peristiwo- Nodonyang menunjukkon   permuloonotou okhir sesuotuqktiviti.
   '    Anak Panoh- Mewokiliokfiviti don orohnyosentiosomenuju ke nodonyong
        terlebih besor.Ponjong         onokponoh    fidok merujuk kapoda  moso.
   .                    (D)
        Jongkomoso - Mosoyongdiperluuntuk menyiopkon                    sesuotuoktiviti.
   '    Tempoh- Moso keseluruhqn             untuk menyiopkon   sesuoiuprojek.
   .    M o somu l oo w o l (E S T ) - Moso poling     owoloktiviti boleh dim ulokon.
                                                                                    Diket ohui
        dengon   melokukon       "kiroonke hodopon".    Moso muloowol Aktiviti B = MosoMulo
        A w o l(A kti vi ti A ) + Jo n g ko m oso
                                                ( Aktiviti A) .
   .    Mososiopowol(EFT) - Mosopolingowaloktiviti boleh ditqmqtkon.
   '    &\ o s o l oo kh i r (L S T )- Mosopoling
               mu                                     lewotoktiviti bolehdimulokon.
   .    M o sosi o po kh i r (L F T )- Mo sopoling   lewqtoktiviti bolehditom oikon.
   .    Apungon    (Floot) - Aktiviti kritikol yongmempunyoi        lebihonmcso.
   .    Loluon  kritikol - rongkoion      oktiviti yongmesti dimulokon   seboiksohojooktiviti
        sebelumnyo.
   "    Aktiviti Domi (Dummy)- Aktiviti khoyolonyong dilukis untuk i'nengekolkon
        logik.Domitidqk mempunyoi            mosodon dilukisdengon    gorisonputus-putus.


   Annlisodon Pengiraon
                      Mqso
      Ap o b i l ote mp o h te l o h d i m osukkon"loluonkr itikol" okon dopot dikir o i oi tu
          oktiviti yong menentukon
   ur'u.ton                                  tempoh kerjo keseluruhqn. Seborongkelewoton
   dqlommeloksonokon        oktiviti dolom loluonkritikol okon mengokibotkon    kelewoton
   yong somo bogi seluruh karjo. Anolisis ini jugo mengenalposti selomo mono
   sesuotu oktiviti itu boleh ditongguhkonsebelum ia menyebobkon                kelewoton
   keseluruhon     dolommenyiopkon         kerjo.
   Ierdopot tigo bohogion
                        dolomonolisis:
       o) Kiroon ke depon yang menentukon      moso poling owol untuk memulokon
                                                                              don
          m e n yi o p kose ti o po kti vi ti.
                         n
       b) Kiroon ke belokongyang menentukon      moso terokhir untuk memulokondon
          manyiopkon     setiop oktiviti.

                                                                                        Tttl
     c 50 11                                           PERANCANGAN KAWALAN
                                                                 DAN           N
                                                                          PEIABI AAN


    c) Pengiroon"opung" ioitu moso kelewoton yang dibenarkon untuk setiap
       oktiviti sebelumoktiviti lointerjejos.
             Apungonbebos ioloh moso sesuotu oktiviti boleh diponjongkon
                                                                       tonpo
          \ mengesoni oktiviti-oktiviti seleposnyo.
       k \ npungon   bebos =-         Moso siop owol - Moso mulo owol
           )*-"*-                     Jonqkomoso
                                                          l --' .-l   - Jcr:.ri r,-,
                                            i   Ft r                                 ' r.   )
              Apungon bersqndor
                    tok         iolqhmososesuotu oktiviti diponjongkon
                                                                    tonpo
              mengesani       oktiviti somq
                      mono-mono            odosebelumqtouseleposnyo.


                              =
              Apungon bersondor Moso siop owol -
                    tok                                                  Moso mulo lewot
                                Jongkomoso
  Prosedur        Koedoh
         Mengonoliso        Kritikol
                       Loluon
  o . Senoroikqn    semuooktiviti don jongkomoso         setiopoktiviti,
  b. T e n tu ko n fu ru to n o kti vi ti ioitu oktiviti didahului,qktiviti ber ikutnyo don
     o k t i vi ti se ra n to k.
  c. Lukisrongkoion oktiviti denganmeletokkonoktiviti don peristiwomengikut
     logik.
          Gunokon Domi jiko perluuntukmengekolkonlogik.
  d. Letokkonnombor nodondengonperistiwodengonmemostikon          nombordi
     hujung onokponoh lebihbesordoripadodipongkolnyo.
  e. Lqkukon kiroqnke hodopon kiroonke belokong
                               don                  untukmendopotkon moso
     muloawol, mosotomot okhirdontempoh  projek.
  t. Tqndokon LqluonKritikol.
  g. Sediokon       (LihotJoduol
              Joduol.             3)
  h. Lokukon penjoduolonsumber.
  i. Dopotkon maso optimum.
  j Bino CortoBor.


            loluqn
Syorot-syorot    kritikol
  o. Sebelumsotu oktiviti dimulokon,
                                   kesemuo
                                         oktiviti yang tendohulumesti
     disiopkon.
  b. Anokponoh
             honyo        rongkoion
                 menunjukkon      logik.
          peristiwo
  c. Nombor       tidokbolehberulong dolom
                                   di     soturongkoion.
  d. Penyombungon peristiwo
              duo         tidokbolehdigunokon     sotuoktiviti.
                                           melebihi



                                                                                                t t i ll
            c 50 11                                            PERANCANGAN KAWAUN PEMBINAAN
                                                                         DAN



          e. Rongkoion honyo boleh bermulo dengonsotu peristiwa don berokhir dengan
             peristiwotqmot.

     Keboikon
a-
     1.    Hubungkoitontoro semuooktiviti dopot dilihot dengon1elos.Aktiviti-oktiviti
                                                                            itu
           yang pentingotou kritikol ditunjukkonoleh loluonkritikol. Dengon tumpuon
           yong lebih dopot diberikon kepodooktiviti-oktiviti kritikol bagi mengelokkon
           kelewoton penyiopon projek.
     2.    Sekiranyo berloku kelewqton yong tidok dopot dielokkon, rongkoiony-ong
           terlibot dopof disemok don diuboh suoi dengan mudoh. Jikolou terdopot
           o k t i v i ti kri ti ko lp o d o ro n g ko i on sebut, jongkomoso
                                                          ter                 oktiviti kr itikol ter sebut
           p e r l u d i p e n d e kko nP e ru b o hon m ungkinm elibotkonkos yong lebih tin ggi
                                             .             itu
           keronojumloh pekerla don loji yongdiperlukqn                jugo befomboh.

     3.    Kemojuon                         dopot diketohui don diowosidengonlebih
                    prolek secoro keseluruhan
           mudoh.Kesonperubohonsesuotuaktiviti terhodop keseluruhon   projek dopot
           dikesonkeronosemuooktiviti mempunyoihubungkait dolomsotu rongkoion.


{-   Kelemohon
 '
     l.  Teknik rongkoionogok sukor untuk memohominyo.  Lotihon tertentu diperlukon
         don ini tidok dopot diberikon dolsm syorikot kontrokto? yang kecil don
         sederhono.
     ?" Romoikokiiongontopok yong tidok dopot menggunokon     koedoh ini. Oleh itu,
         teknik rongkoion tersebut perlu ditukor bentuk kepodo corta bor bogi
         mengotosi mosolqhtersebuf.
     3. Teknik ini honyo sesuoi untuk projek-projek yong besor don kompleks.Bogi
                                         Corto Bor lebih sesuai.
         projek-projekkecil don sederhono,

     Kowolon  Kos
)t   Tokrif :
     - Horpol Singh, 1981 - Sotu proses kowolon                    bogi sesuotu
                                               terhodop perbelonjoon
       projek binoon podo semuq peringkot pembinoon  bermulo doripodo peringkot
       permuloon, rekobentuk pembongunonhinggoloh projek diloksonokon don
          pemboyorqn       okhir dibuot.
     -    Horold Byrne,L9B4- Aktiviti untuk mengekolkon              jumloh keseluruhon pro.lek
                                                                                      kos
          s u p o y o d o k me l e b i hjiu ml o hyongteloh diper untukkon.
                    ti




                                                                                                    9t11
           c 50 11                                          PERANCANGAN KAWALANPEMBINAAN
                                                                      DAN


-n
     Objektif Kowolon
                    Kos
      l. mengenolposti mqno-mono   bohogiondolqm kerjo yong didopoti tidok beroperosi
         otou dilqkukondengon  ekonomi.
      2. Memberi moklumbolos kepodo juruukur bohon untuk membolehkonnyo
         menganggor  horgo unit kos bogi projek seterusnyodengonlebih tepot logi.
      3. Merekodkonoktiviti-oktiviti kerjo denganlebih kemqs supoyo mudoh untuk
         melokukon opo-opo tuntuton ferutomo dolomkerjo-kerjo perubohon.
      4. Menyediokon  sotu 'commonplotform' di mono kokitangonpejobot don topok
         dopot bekerjosomq  keo roh mencopoi  soiu objektif.


   YAW ALAN KOs
 7" Kawalankos sehorusnyo bertujuon untuk memostikon kos okhir prolek tidok
    melebihi belonjowon.Kemungkinon                     yong poling besor dolom mempengoruhi      kos
    projek okhir berodo podo peringkot tqklimot don peringkot reka bentuk.
    Pemeriksoon             kos secqra terotur perlu diloksqnokon        semosoproses reko bentuk.
    Bontuon       yong boik dolom kerjo ini ioloh pelonkos, berdqsorkon           onggaron kos kosor,
   yong memoporkon                  mutu, kuontiti don horgounit bogi unsunkos utamoseperti kerjo
   t o n o h , l o n to i d o n b u mb u n g .A pobilo r eko bentuk dikem bongkon      dengon lebi h
   t e r p e r i n c i , re ko b e n tu k se ti q p unsur boleh disemokogor ber odo dolom r ongk o
    lingkungon         kerjo yongditentukondolompelonkos.
               Bontuon yang penting untuk kowolon kos ioloh romolon kos okhir, yong
   sentiusodisemokbogi monggomborkon                      keodoon  semosoprogek.Sekironyoterdapot
   penyimpongon                ontoro romalon ini denganbelonjowonprojek, tindokcn membetul
   p e r l ud i o m b i l .
               Bontuqnyong boik untuk mengemaskinikon               romolonkos ioloh "diori kos" bogi
   setiop okoun, yang mengombil                   kiro segoloperistiwo yong okon mempengoruhi     kos
   o k h i r . D i o r i i n i p e rl u me mo su kkomoklumot
                                                     n        seper ti -
         D Semokon yongdisediokon
                                kos                    ketiko peringkatreko bentuk;
         tr Kontrok dengan               perunding, kontrqktor,pembekol   don orgonisosi
                                                                                       loin;
         tr Arohonpindoon                don pindoon yong diromol;
         n Jongkoon perubohonkos yong disebqbkonoleh gongguon                        dolom kemojuon
               kerjo yongteloh dironcong;
         a Perbezaanontqro kuontiti sebenor dengon kuontiti yong dinyotokon serto
              turun noik horgo.




                                                                                             r0/ 11
                      c 5011                                                                                                                       PERAN
                                                                                                                                                       CANGAN               NAAN
                                                                                                                                                             DANKAWALANPEIABI



Kostetop/ TidokLongsung

      Mutu
Kowolon
Kowolonmutu dolom projek pembinoon  sehorusnyobertujuon untuk memenuhi
        don kehendok
keperluon            klien yong dinyotokon.
                                          Kowolonmutu perlu diloksonokon
podosemuo         projek,sepertiyongditunjukkon
          peringkot                           dibowoh.


                Peringkat                                                                                                                         Peringkat              Peringkat
                takiimat                                                                                                                          Pembinazrn             'fugasan


                 Membuatkeputusan                                                   Prakelayak-an                                                 Kawalan            Kawalan
                                                                                    untuk                                                         dalam              bangunan
                                                                                    menolak
                                                                                    kontraktor
                                                                                                                                                  memenuhi           sedangdi
                      keseluruhan
                 secara                                                                                                                           syarat             gunakan
                                                                                    tidak lavak




                       StesenKawalan                                                                                                        Pemeriksaan             Ujian Khas

                                                                                                         ,!,      . a.l c           \       r i \..1r
    I




                                                                                                                . -.   , ri , : !       l




                                                         i .-c   l;r    r. I
                                                                                          .     t,-                                         \'"
                                                    lv                                                  \t!r..:r'g.r

                                                                                                                                                                                     ol '
                                                                                                                                                                                                                      'r'
                                                                                                    I

                                                i
    l, . r              ! . i r - - - . !"- "


t
                                                                               '        l: r
                                                                                                                                                                    91
                                                                       t-
                                                                            r      l\          \t




    f1
    \ . iiJ {    i'

                                                                                                                                                                                      l     ! . .,       -   ,i   l
                                                                                                                                                                                                     '




                                                                                                                                                                                      , , i t , \'.."
                                                                                                                                                                                           1l / ll,
    \:"'rit''
                                                                                                                                                    f'   ,   * ""
2.0       AMALAN PENGIIRUSAN PEMBINAAN

2.1       SistemJawatankuasa

       Dalam pengurusan satuprojek pembinaan, melibatkanbeberapa
                                             ia                    individu bersatu
tenagake arahmencapai  matlamatprojek. Mereka ini akanbekerjasamadalam satupasukan
                    jawatankuasa.
yang dikenali sebagai            Tujuanjawatankuasa  ditubuhkanialah:

          1      Bagi mengagih-agihkan   kerja diantarapelbagaiahli pasukan,pengawasan   dan
                 pengawalan  kemajuanperlaksanaan    projek.
          2      Bagi menyelesaikan  masalahyang berbangkitdan membuatkeputusan
          3      Menyampaikankeputusanyang telah diambil dalam kumpulan lain atau
                 maklumatyang relevankepadaprojek, kepadapihak-pihakyang ingin
                 mengetahuinya.
          4      Pengutipan maklumatdan idea.
          5      Menguji dan mengesahkan    keputusan.
          6      Penyelarasan perhubungan
                               dan              diantarapelbagaibidangprojek.
          7      Meningkatkan   komitmen dan   penglibatanahli-ahlinyadalamprosesperancangan
                 dan membuatkeputusan.
          8      Membolehkan    perundingan  dan penyelesaiankonflik yang wujud di antara
                 pelbagaipihak dan atauperingkatdidalamprojek.
          9      Bagi tujuan inkues atau penyelidikan perkara-perkarayang telah berlaku.



                Projek
2.1.1 Jawatankuasa

      *   Gabunganpihak-pihak tertentu dan bukannyasatupasukan.
      *   Setiapahli ingin mencapai  kepuasan   objektif yangberbeza-beza   antarasatusamalain.
      *   Ini dapatdiatasi dengankeupayaanuntuk menterjemahdan         memahamiorganisasisatu-
          satu j awatankuasa ek.
                             proj
      'i' Ahli-ahli dalam jawatankuasaprojek selalunyadipinjamkan dari bahagian-bahagian        atau
          organisasi-organisasi berlainan.
      * Kebarangkalianuntuk kesemuaahli bertemubagi sesuatu           projek yang baru selain dari
          projek asaladalahamattipis.
      * Pemilihan ahli jawatankuasadari segi kaedahdan syaratadalahberbeza-beza          mengikut
          keperluan satu-satu projek.
      'i' Perlu mencapaimatlamatpenubuhannyayangakankelak menjadi aktiviti jawatankuasa
          tersebut.
      .:. Pada asasnya  terdapatdua cirri aktiviti jawatankuasa  projek:
          i.      Tugas- berkait denganobjektif keseluruhan     bagi projek.
          ii.     Proses- carapasukanitu berfungsi sepertimembuatkeputusan,        pemberian
                  tanggungiawab,  perlaksanaan   aktiviti dan caraahli berhubungsesamasendiri.
                                Tapakbina
                     Penyelarasan
    2.1.2 Jawatankuasa

       {. Semuaorangyang bekerjabagi sesuatu   projek yang dipertanggungjawabkan
                                                                               samada
          secaralangsungatautidak langsungkepadapengurus    projek.
       {. Tidak termasukpenguruskananbagi pengurus    projek, samada daripadaorganisasi
                                                                    dia
          dalamanklien ataupunseorang perundingbebas.
       i. Menyiapkan sesuatufugasankhusus (projek pembinaan)dan kemudian mereka akan
          dibubarkan.
       {. Dilantik untuk menganggotaiprojek tersebutkeranakemahirandan pengetahuankhusus
          yang dia miliki.



                               Kontraklor
                      Penyelaras
    2.1.3 Jarvatankuasa

          *   Ahli jawatankuasapenyelaraskontraktor boleh dikelompokkan seperti berikut:
              i.      Pakar teknologi - mempunyai kelayakandan pengalaman kepakaranyang
                      diperlukanditapakbina (1%)
              ii.     Pekerjamahir - tukang-tukangdanjuruteknik (29%)
              iii.    Pekerja separuhmahir dan tidak mahir (70%)

    2.2                      Keria
              Struktur Pasukan

           Pasukan kerja yang efektif ialah pasukanyang mencapai  kecemerlangan
                                                                              dalamtugas
    yang diberikandan dapatmelepasimasalah     yang timbul. Kejayaansesuatu
                                                                          pasukanprojek
    diukur melalui:
       i. Mencapaiobjektif yang telah dipersetujui.
       ii. Perlaksanaanny^diselesaikanpadatempohyang ditetapkan.
       iii. Perlaksanaannya
                          mengikutbelanjawan  yang telah dipersetujui.

t   Perananahli pasukanamat penting dalam menyumbangkeberkesanan            pasukanprojek. Antara
    perananahli pasukanialah:
       i. Sebagaikoordinator iaitu berkebolehan      bertindak sebagaiketua dan bersikap tenang,
            matang dan pandai menarik sokonganahli.
       ii. Sebagai   pelaksana iaitu menjadi tenaga  kerja kepadapasukannya bersikappraktikal,
                                                                               dan
            logik, setiasertarajin.
       iii. Sebagai  penyemaiiaitu banyakidea,imaginasi,     kreatif dantidak ortodoks.
       iv. Sebagaipenyiasatsumber iaitu menjiwai dan penghubungsertaberkomunikasi.
       v. Sebagaipengasahiaitu dinamik, positif dan bersemangat       untuk mendapatkan     hasil dan
                keputusan.
       vi. Sebagaipenilai pengawasan     iaitu bersikapsederhana,  analitikal dan praktikal.
       vii. Sebagai  ahii pasukaniaitu kaunselor, sosialdan harmoni.
   viii.   Sebagai                        denganteliti, tertib danjarang melakukan
                  penyiapiaitu melaksanakan
           kesilapan.

      yang seimbang
Pasukan            perlu ada sifat-sifatyangberikut:

   i.   Menyiasat: tentukankerja yang dibuat, tetapkansasaran,   menetapkanparameter,
        mengutip maklumat relevan dan menganalisanya    dan bukan mengecamukkannya.
   ii. Meninjau: skopmaklumat,mencaripendekatan        alternatif,menanyaianggapan-anggapan.
   iii. Menentu: mencapaihalatuju dan kemuktamadantujuan dan mewujudkan ketegasandan
        ketabahanterhadaptekanan.
   iv. Mengemuka:mengelaskan       isu-isu,meletakkan keutamaan kepentingan,
                                                                  dan              membuat
        penilaianbagi keperluansegera   dan menerimasituasisukar.
   v. Menentukan:mewujudkan rasapengaturan,memulakantindakan mengikut keutamaan
        dan kepentingandan kebolehlenturandalam tugasan.
   vi. Menjangka:melihatke hadapan,      memandang  jauh, melihatsebabakibat,menilai
        kepraktikalnya, memprogram    secaraberkaedah.
   vii. Menyampai: mewujudkan hubungan dan kesefahaman         diantarc y angberkenaan,
        memanfaat   dan berkongsiaktiviti-aktiviti.
  viii. Mengenali:mengaturkerja dan orangdengansegera       apabiladiperlukan,mengawalmasa
        tindakan,memotivasimanusiaterutama      yang berkaitan'menentukan'dan 'menjangkai'.
  ix. Dinamis: mengambilinisiati{ usahadan dorongan.
  x. Kebolehsuaian:     keupayaan  untuk menuruti,menerimadanbukan melawannya.
  xi. Merigenalpasti:   bersediauntuk bersama-sama   terlibat secara menyeluruhdidalam
        memikirkan sesuatu  kerja dan keupayaanmendorongorang lain sama-sama
        melakukannva.

Mekanismeuntuk membinapencapaian   pasukan ialah:
  i. Menetapkansatutujuan penting dan yang memerlukantindakan segera.
  ii. Memilih ahli berdasarkankemahirandan potensi kemahirandan bukannyaberdasarkan
       personaliti.
  iii. Memberikan perhatiansepenuhnya kepadamesyuaratpertamadan tindakan yang harus
       diambil.
  iv. Menetapkandenganjelas beberapa  peraturankepadaahli.
  v. Menetapkandan menghentikanbeberapa    tugas dan matlamatyang berorientasikan
       prestasi.
    vi. Sentiasamemberikancabarankepadakumpulan ataupasukandenganfakta-fakta dan
         maklumat terkini.
    vii. Menghabiskan  banyakmasabersama-sama.
    viii.      Mengeksploitasitenagadaripada          yangpositif, salingmengenalidan
                                            tindakbalas
         pemberianganjaran.




                                                                                               a
                                                                                               ')
2.3       Kepentingan maklumat-maklumatberikut dalam pengurusanpembinaan:


2.3.1 Dokumen Kontrak

      *   Dokumen kontrak biasanya    disediakanoleh pejabatyang mengeluarkan   tenderdan
          mempelawa    tender.
      * Secara   amnyaia mengandungi                          dan
                                         borang-borang,lukisan dokumen-dokumen         yang sama
          dengandokumenmeja tender.
      * Dokumen kontrak hendaklahdisediakanawal untuk memastikanianya siap untuk
          ditandatanganisecepat  mungkin setelahSurat Setujuterimatender dikeluarkan.
      .i. Pegawaiyang diberi kuasaunfuk menandatangani    dokumenkontrak dan kontraktor akan
          menandatangani    semuadokumen seperti  perkara-perkaraperjanjian, spesifikasi,senarai
          kuantiti dan lukisan-lukisankontrak.
      * Dokumen kontrak hendaklahmengandungidokumen tender dan dokumen-dokumenlain
          yang disusunmengikut aturanberikut:

             a) Kontrak berasaskan senaraikuantiti:
                i.    Perkara-perkara perjanjian dan syarat-syarat
                                                                 kontrak dan lampiran yang
                      disertakan.
                ii.   Borangtender
                iii.   Suratsetujuterimatender.
                iv.    Suratpindaankepadadan dari kontraklor ataupengesahan    tender asal atau
                       sesuafuyang memberi kesanke ataskontrak.
                v.     Spesifikasi
                vi.    Senaraikuantiti.
                vii.   Lukisan.

             b) Kontrak berasaskanlukisandan spesifikasi:
                i.    Perkara-perkara perjanjian dan syarat-syarat
                                                                 kontrak dan lampiran yang
                      disertakan.
                ii.   Borangtender
                iii.  Suratsetujuterima tender.
                iv.   Suratpindaankepadadan dari kontraklor ataupengesahan     tender asal atau
                      sesuatuyang memberi kesanke ataskontrak.
                v.    Spesifikasi
                vi.   Ringkasantender
                vii.  Jadualkadarharga
                viii. Lukisan.
     .i. Pembatalanmana-manabahagiandalam dokumen kontrak hendaklahdinyatakan dengan
         jelas.
     *    Dokumen kontrak mestilah mengandungidokumen-dokumen     yang samadengan
          dokumentenderdan dokumenmeja tender.
     *    Segalapindaanyang telah dibuat dalam dokumen tender yang diserahkankepada
          petender danJatatdokumen meja tender,mestilah dimasukkandalam dokumen kontrak.

2.3.2 Laporan lawatantapak.

      *   Laporan ini membentukkefahamantentangkeadaandan halanganyang mungkin
          mempengaruhikerja. Laporan ini juga membantudalam penyediaansenaraisoalanuntuk
          dibentangkankepadaperekabentuk, perunding dan pihak berkuasaawam untuk
          penjelasan        kehendak
                     mengenai         mereka.

No             Maklumat yang diperlukan                         Tujuan/kesan

 I        Keadaantapak- jenis tanah,parasair              kerja penggalian, dan sokongan
                                               Mempengaruhi               loji
          bumi, kekuatantanah.                 tanah.

 2        Tempat membuangbahanbuangan          Mempengaruhikadar bahanyang telah digali.

 3                banzunan
          Perobohan       vans ada.                       kos
                                               Untukmenilai

 4        Jalan masuk                          Menilai kerja permulaan, dan kenderaan
                                                                      loji
                                               melaluinya sertapenghantaranbahan binaan.

 5        Halanganlokasi tapak.                Kemudahanmenyimpan,adangyang perlu
                                               disediakan.

 6        Buruh                                Untuk tujuan kadar harga dan bekalan tenaga.

 7        Perkhidmatansediaada                 Untuk memastikanbekalan mencukupi dan
                                               kemudahanuntuk tapak bina dan pekery'a.

 8        Pembekal, subkontraklordan loii.     Untuk membuatkadar harsa.

 9        Keselamatantapak                     Persediaan
                                                        terhadap
                                                               tapakbina, bahan-bahan,
                                               barang-barang pekerjasupayasentiasa
                                                           dan                     selamat.

 l0       Faktor lain                          Kemungkinanperkaraluar jangkaan yang mungkin
                                               mempengaruhiperjalananproj ek.




                                                                                              1..
      2.3.3 Kadar Harga

         *   Kadar harga dikira dalam borang kadar unit berdasarkan kos bersih untuk buruh, bahan
                                             tambahan
             dan loji, tidak meliputi sebarang         perbelanjaanasas.
         *   Ini membolehkankontraktor mengira nilai bersihjumlah anggarandiperingkat tawaran.
         *   Kemudian nilai bersih kos akan dijadikan asasuntuk sistemkawalan yang akan
             digunakan oleh kontraktor dalam tempoh projek.
         .i. Faktor pembazirandan pemadatanhendaklahdiadakanuntuk elemen bahan.
         * Antara maklumat yang diperlukan untuk mendapatkankadar harga ialah:
                i.  Hasil dan angkatapburuh.
               ii.  Kadar hargadan hasil loji.
              iii.  Hargabahan.
              iv.   Sebutharga untuk kerja subkontrak.

                         (Overhead)
      2.3.4 Kos pengurusan

      Kos pengurusan   biasanya  merangkumi:
          i. Elaun pengarah    dan perbelanjaannya   (berkaitanprojek)
         ii. Gaji pengurusdan pekerjanyatermasukbayarankerja lebih masadan tuntutan lain lain
             berkaitan projek.
       iii.  Faedah  keataspinjaman.
        iv.  Sewapejabat.
 ':      v.  Cukai pendapatan/    keuntungan.
        vi.  Bil-bil air, telefon,elektrik dan lain-lain.
       vii.  Kenderaan.
      viii.  Insuran.
        ix.  Surat-menyurat.
         x.  Peralatan  pejabatdan alat tulis.
        xi.  Yuran pendaftarankonktraktor.
 )
,1,    xii.  Lain-lain perbelanjaan  mengurusyang tidak terdapatdalamsenarai atas.
                                                                           di

      2.3.5 Kadar keuntunsan

      Kadar keuntunganbiasanyadiambil beberapa  peratusdari hargaprojek dan selalunyatidak
      melebihi 25o/o.Tinggiatau rendahnyaperafusanyang diambil bergantungkepada:
         i.  Keadaanekonomi negara
        ii.  Bilanganprojek dalamtangan
       iii.  Senang/sukar/ risiko untuk melaksanakansesuatuprojek.




                                                                                                    la
    2.3.6 Programpembinaan

    Programinduk selalunyadisediakandalam bentuk cartabar dan bagi projek yang lebih kompleks
    ianya disediakandalambentukanalisa  rangkaian.Programmestilahmerangkumi:
        i. Fasautama bagi kerja mengikut urutan operasitapak.
       ii. Tarikh permulaandan penyiapankontrak.
     iii.  Cuti tahunandan cuti umum.
      iv.  Tarikh penting peringkat utama kerja.

    Program induk juga menunjukkanburuh yang dirancangkandan keperluanloji.

    2.3.1 Sebutharsa.

    Dalam penyediaansebutharga, kuantiti dan bahanyang diperlukan mesti disediakandahulu dan
,   dapatkanmaklumbalasdaripadapembekal.Jadualbahanuntuk pertanyaan       kepadapembekal
    mestilah merangkumi:
        i. Spesifikasibahan
       ii. Kuantiti bahan
      iii. Programpenghantaran
      iv.  Alamat tapakbina
       v.  Laluan masuk'
      vi.  Tempohmasasebelumsebutharga     diterima
     vii.  Tarikh akhir pembayaran
    viii.  Kaedahbavaran.

    2.3.8 Laporankepadapengurusan




                                                                                                I
    2.4                     yang perlu diambil kira dalam .perlaksanaan
              Perkara-perkara                                         kontrak

    2.4.1 Skop dan kuantiti kerja

    Terdapat9 prosesutama yang terlibat semasaperlaksanaan
                                                         kontrak dibuat :

              i.      Penyediaan Ringkasan Projek.
              ii.     Penyediaan Rekabentuk Permulaan                   TapakBina.
                                                       Dan PelanSusunatur
              iii.    RekabentukPerincianArkitek Dan Kejuruteraan.
              iv.     Penyediaan AnggaranAwal Dan KawalanKos.
              v.      PenyediaanDokumen Tender.
              vi.     Pelawaan  Dan Penerimaan Tender.
              vii.    PenilaianDan Setujuterima Tender.
              viii.   PenyediaanDan Menandatangani   Dokumen Kontrak.
              ix.     Perlantikan Subkontraktordan Pembekal.

|   2.4.2 Buruh


    Setiaptahunstatistikkeperluanburuh meningkat.


                              JUMLAH KEPERLUAN BURUH (.000)

    TAHLIN             1990    r99I    r992   1993     1994    r99s      2000

    JUMLAH              421     449     481     538     s66        604    772

    JADUAL : Jumlah keperluanburuh dalam sektorpembinaandi Malaysia.



    Pengambilanburuh

    Pengambilanburuh untuk bekerja perlu dijalankan mengikut peraturan-peraturan  yang telah di
    tetapkansepertiberikut:
        o Hanya warganegaraMALAYSIA diambil bekerja. Namun begitu pekerja luar boleh
           diambilsekiranya terbukti tiada peke4'ayangboleh didapati dinegaraini serta mendapat
           kebenaran.

          .   Nisbah pekerja di tapak ikut nisbahkaum di Malaysia.

          o Buruh yang diambil bekerjamesti dari dalam daerahkerja (projek) dijalankan.

          .   Mengambil pelatih bekerjajika diarah oleh kerajaan




                                                                                                  3
2.a.2@)                langsung kontrak
                 Pekerja      atau

  i)      PekerjaAtau BuruhLangsung

          * Buruhlangsung merupakankakitangan                         syarikat.
                                             ataustaftetapbagi sesebuah
                                            yang telah ditetapkan
          i. Perlulahmenurutiprosedur-prosedur                   dalam pengambilan
             pekerja.
          {. Mengisi borangtentangmaklumatdiri, tahappendidikandanpengalaman     bekerja.
          * Majikan perlu mencarumkan pekerjanya dengan Kumpulan Wang Simpanan
             PekerjaatauEPF untuk simpanan    hari tua pekerjamereka,SOCSO sertainsurans
             yang berkenaanseperti insuranskemalangandi tempat kerja dan sebagainya.
          * Pekerjalangsungini akan dibayar gaji secarabulanan atauharian.
          * Waktu bekerja mereka adalahselamalapanjam sehari.
          * Pekerja langsung ini adalah tertakluk kepada peraturan-peraturanyang telah
             ditetapkanoleh majikan atau syarikat dimana ia bekerja.




                  Perlu:-
                                                                 MajikanPerlu:

            i.     lsi borang
           ii.     Memiliki
                   kelayakan



                                       Pekerja@ Buruh
                                          Langsung



           - Tertakluk                                                        gaji
                                                                       -Dibayar
             kepada                                                        bu
                                                                      secara lanan
            peraturan                                                   atau harian


                                          Kerja jam sehari
                                               8
                                          Jikakerjalebihmasa
                                          dapatelaunlebih
                                          masa




                                                                                            Y
  ii)    PekerjaAtau Buruh SecaraKontrak

   {. Kakitangan atau staf yang tidak tetap.
   .i. Boleh didapati daripadasyarikat yang membekalkanburuh secarakontrak.
   i. Sekiranyaperkhidmatanmereka diperlukan,kontrak akan ditandatangani.
   * Perlu menuruti prosedur-prosedur   yang ditetapkan.
   * Menandatangani                                                           tertentu.
                        perjanjian dalam kontrak denganberdasarkansyarat-syarat
   * Jika tempoh kontrak tamat, maka tamatlah perkhidmatannya tetapi     jika projek belum
       siap, buruh secarakontrak ini boleh menyambungkontrak mereka mengikut keperluan
       perkhidmatannyadi tapak bina tetapi mereka perlu menandatanganisemula perjanjian
       kontrak yang baru dengansyarat-syarat  yang baru.
    n Sekiranya majikan pecah kontrak, buruh tersebut boleh membuat laporan di Jabatan
       Buruh dan boleh menuntut gantirugi daripadamajikan.
    i. Tetapi sekiranyaburuh pecahkontrak, majikan boleh tidak membayar gaji atau memecat
       buruh tersebutwalaupun kontraknyamasih belum tamat.
    * Buruh ini biasanyatiada carumanKWSP / SOCSOtetapi ada perlindunganinsurans.


Buruh secarakontrak ini biasanyaterbahagikepadatiga, mengikut kategori kemahiran iaitu :

   1) Tukang ( Craftman )
   2) Buruh biasa ( GeneralLabour )
   3) Kepala/ Penyelia( Foreman/ Supervisor
                                          )


Hari dan waktu beke{a untuk buruh adalah seperti yang dinyatakan di dalam Borang Kontrak
Setara2}3{bahawa tiada apajua kerja boleh dijalankan:
          * Padahari rehat mingguan
          * Padamana-manahari kelepasanam yang diiktiraf dalam daerahdi mana kontrak
             ini dilaksanakan
          * Di antarapukul enampetangsehinggaenampagi esoknya.




                                                                                             ,n
2.4.2(b)       JadualKeperluanBuruh


Keperluan bagi buruh mestilah mencukupi dan memadai bagi projek yang bakal dijalankan.
Dalam erti kata lain, jumlah buruh mestilah mengikut saiz projek yang bakal dijalankan.

Contoh JadualKeperluanBuruh:


      Kumpulan Pekerja                Bilangan

      PenyeliaTapak

      Kepala

      TukansBatu

      Tukang Paip

              Kerja
      Pengendali

      Formen

      Tukang Letrik

      Tukang Cat

               Jubin
      Pemasangan

      Tukang Kayu


2.4.3 BahanBinaan

2.a3 @)        Bahanbinaan yang perlu dibekalkan

Bahan binaanyang dibekalkandi tapak adalahbergantungkepadajenis projek yang ingin
            Antaranya adalah:
dilaksanakan.

  i. Bahanbinaan yang digunakandalam pembinaanjalan raya.
 ii. Bahanbinaan yang digunakandalam pembinaanbangunan




                                                                                          ,l
2.4.3 (b)    Jadualbekalanbahanbinaan


1. Panduanbagi kontraktor berkaitan tentangbahanbinaan yang diperlukan"
2. Berpandukankepadasenaraikuantiti.
3. Untuk pemesanan bahanbinaanke tapakbina oleh kontraktorbagi tujuan menjalankankerja.


Pemesanan Tempoh                        Contoh Bahan

Biasa       t hingga 2 minggu           Simen,keluli, bata dan sebagainya.

Khas        Minima 1 bulan              KemasanLarfiai



Jumlah pemesananbagi bahan binaan adalah bergantung kepada kelancaran sesuatu kerja
dilakukan. (Klause 47 -Borang JKR 203 A)

Pemesanan BahanBinaan
1. Pemesanan bahan binaan dilakukan menggunakanPurchaseOrder oleh syarikat kontraktor
   kepada pembekalbahan.
2. Di dalam PurchaseOrder terdapatbutiran sepertikuantiti bahan,jenis bahan,harga bahan,
   namapembekaldan kontraktor dan sebagainya.


               BahanBinaan
       Perolehan
Prosedur


1. Mengeluarkanarahanpesanan      bahanbinaan.
2. PMC akan mengenalpasti    pembekal.Katalog pembekal,Profil syarikat diteliti bagi menilai
   pembekalyang berkuatili.
3. Pembekalakan dinilai berdasarkan   :
    i.   SenaraiPembekalLulus - Merupakan senaraipembekal sedia ada atau pembekal yang
         berpotensi.
   ii.   Rekod urus niaga yang lepasdan kemudahankredit yang diberi.
4. Pembekal-pembekal    yang dipilih dan dibuat penilaian sebutharga.
5. Untuk pembelian segeraatau pembeliandibawah bidang kuasa mutlak PurchaseOrder akan
    dilakukan terus tanpamembuatpemilihan pembekal.
6. Setelah  pembekaldipilih dan sebutharga   telah dinilai , prosespengeluaran
                                                                             PurchaseOrder
    akan dilakukan dalam borang Purchase   Order.
7. Pengeluaran   PurchaseOrder perlu kelulusan.
8. Setelahkelulusan diperolehi, Purchase  Order dihantarkepadapembekal.
9. Pembekalakan menghantarbahanbinaanyang dipesanke tapak bi4a setelahPurchaseOrder
    diperolehi.
10. Kontraklor perlu menyemakbahan binaan yang dihantar ketapak bina supayabahan binaan
    yang dihantarmencukupi dan dalamkeadaanterkawal.




                                                                                               l.
11.Pengesahan ataspenerimaan
              ke              bahanbinaanperlu dilakukanoleh personelyang bertauliah.
12.Penilaianprestasi       perlu dilakukansekalisetahun.
                    pembekal
13.Pembekalyang kurang berprestasi akan disenaraihitamkan denganmengemaskiniSenarai
   Pembekal  Lulus.

2.4.4 Peralatan
              BerjenteradanKelengkapan

2.4.4 (a)    Pemilihandanpenghantaran tapak
                                    ke

       Walaupunpenggunaan    jenteramelibatkanmodalyang tinggi, tetapimempercepatkan
prosesbinaan dan mengurangkan buruh akan dapatmenghasilkankeuntunganyang banyak-
                                kos
Keadaan  tapakbina akanmenentukan   jenis jenterayang sesuai         Kedudukandan saiz
                                                            digunakan.
bangunan  juga menentukan tempatyang paling sesuai  diletakkanbahandan kelengkapansupaya
tidak perlu dipindah-pindahkansehinggabangunansiap dibina.
       Pemilihan jenis jentera yang digunakan adalah bergantung pada keq'a yang perlu
dilakukan serta fungsi dan keupayaanjentera masing-masing.Jentera-jentera boleh didapati
                                                                           ini
sama ada denganmembelinya ataupunmenyewa      jentera-jenteraini dari syarikat khas sama ada
secarakontrak, sewaharian ataupunmengikutjangkamasaia disewa.


                                 PERALATAN




        JENTERAUNTUK
                                                  JENTERA
        PENYEDIAAN TAPAK                          PEMBENAMAN
        ASASDAN PENGO                             CERUCUK




                        JENTERA                                 JENTERA
                        PENGEPAMAIR                             PENGANGKUTAN




                                                                                               /),

				
DOCUMENT INFO
Shared By:
Categories:
Stats:
views:1166
posted:4/21/2012
language:Malay
pages:116