PEDOMAN PENGENDALIAN INFEKSI NOSOKOMIAL DI RS

					                   :-::---::::' - : ?":i:lits-.
                                                                  :11r   i:




                                                  P.EDO[ffN
                                ttAru fti(,l5rti[tiill
                        |;ff\rcF|i!I;l
                                     ii\rfl-tiSt l
                                |J iitifh titi
                                 ill i{5I




/A                        n
         Depar t e m eK e s e h a t aR l .
                                         n
{b /   | Direk t o r a te n d e r aP e l a y a na M e d ik,6 p e sia listik
                     J             l              n
                          KataPengantar
Puji syukur kita panjatkankepadaTuhan Yang Maha Kirasayang ielah
memberi bimbingandan petunjuk kepada kita, sehingga kita berhasil
menerbitkan    Buku Pecloman  pengendalian                    di
                                             infeksin*esokomial Rumah
Sakit. Rumah Sakit merupakansalah satu sarana penyedia pelayanan
ke se h a tan y ang sekaligus bertangg u n gja wa b d a la m me la k u k a n
perlindungan   tefiadap pasien.Hal ini seringmenjaditantanganbagi rumah
sakil karenamemeilukanperhatiankhususdalarnmemberikan         pelayanan
kesehatanyangbermutusecar:r     keseluruhan.  Dapatdisadaribahwa bentuk-
perhatian tersebr:taCalah rnasih kurangnya kualitas dan kuantitas
pengendalian                     di
                infeksinosokomial rumahsakit,sebabinfeksinosokomial
sangat erat tei-kaitdengan ha[ pasien akan pelayananyang baik dan
bermuiu. lnfeksi nosokomialpada prinsipnyadapat dicegatr,walaupun
tidakdapatoihilangkan    sama sekali.

Buku "Pedoinan Pengendalian  InfeksiNosokomialdi Rumah Sakit" ini
sangatpentingbagi pietugas
                         rumahsakitdalammelaksanakan  pencegahan
di rumah sakit masing+nasing.Namun kami menyadari   bahwa buku.ini
masihjauh dari sernpurna,untukitu masukandari pembacasangat kami
harapkandalam.penyempumaan     buku ini dimasayang akan datang"

fim Penyusun.
      SAMBUTANDIREKTURJENDERALPELAYANANMEDIK

Rumah Sakit harus mampu memberikan           pelayanankesehatanyang
berianggungjawab terhadaptuntutanatas hak pasien.Undang-Undang
Pedindungan    Konsumen   yangmelindungi  pasiendarikesalahanpelayanan
kesehatanmenjaditantangan       yanEharusdiantisipasipara sejawatpraktisi
medis dengan peningkatan       kualitaspelayanan yang.menyeluruh.    Perlu
Jisadari, bahwa di Indonesiakuafitas     pengendalianinfeksi nosokomial
nasih rendahdan kurang menCapatperhatian.       Sehubungandengnanitu,
;aya nnerasahal ini sangat pentig cian perlu diangkat karena berkaitan
 lengan hak pa'siene.hanpelayananyang bertanggungjawab- Pada
 rrinsipnya,semua infeksi nosokomial     mudah dicegah, apabila semua
 'elayanan   sudah mengacukepadastandarPelayanan         Rumah Sakitdan
  itandar PelayananMedisdalamJnenuju       pelayanan yang terakreditasi di
  .rmahsarkit. Melaluibuku "Pedoman    Pengendalian InfeksiNosokomialdi
  lumah Sakit" ini, saya mengajakselawatdan semua petuga.s rumah  di
   akituntuk rnelaksanakan  pelayanan kesehatan secarara:;iaiieldansesuai
   errganStandar PelayananRurnahSakitdan Stadar PelayananMeC:s.
   aya percayabahwapeningkatan     kualitaspengendalian infeksincsckcmia  I
   emberi keuntungan    bagisejawaf rumahsakitdan pasien.
   :kali lagi melalui buku ini saya mengajaksejawat senrua terlibat dan
   lrtanggungjawab atas pelaksanaan      pengenclalian infeksi nosokcmiai
    rng dilakukandi iingkungansejawatterutarna    dalam hal merubahdiri
    :nuju pelayanankesehatan     yang rasionaldan bertanggung   jawab.




                            PEI-AYANANMEDIK


   tf. DR. Dr. M. Ahmad Djojosugito, MHA
         .   NtP 140 030 236
                 TIMPENYUSU}i
                            BUKU
        'PEDOMAN
               PENGENDALIAN
                          INFEKSINOSOKOMIAL
                   DIRUMAH
                         SAKIT

KETUA             : Dr.AchrnadHardiman.
                                     MARS.
                    Direktur
                           Pelayanan
                                   MedikSpesialistik.            Jakarta

SEKREIARTS Prof.DR.lr.Djoko
         :                 Roeshadi.
                                  FICS                     I
           RSIiDDr.Soetomo                                I     Surabaya
                                                  .V \/
ANGGOTA           :

Dr.NurulAini
           Sidik            DirektoratP eia y a n a n Me d ik     Jakarta
                            Spesialistik.

Drg.NikenInvaii             DirektoratP ela y a n a n Me d ik     Jakarta
                            Spesialistik.

RamahSurbakti,
            SKM,Skp. Direktorat
                              Jendera!PPM & P!_                   .lakarta

Dr-Sri Pandam               RSPIProfDR.Sulianti
                                             Saroso               Jakarta
Pulungsih,MSc

Dr.Liliana                  Badan Penelitiandan Pengem-           Jakarta
Kumiawan,  MScID.TMH        banganKesehatan

lr. Edha                    RSPtProfDR SuliantiSaroso             Jakarta
Barapadhang,
          BSc-

Dra. lrmawati -             RSUDDr Soetomo                      Sui'abaya
Prasetyo,Apt.




                                                                       uI
                                   JenderalPelayana;r
                          Direktorat                        Jakarta
Dr.Abdultah
Act,,ndd,MARS             MedikSPesialistik

                                   Jenderal
                          Direktorat        Pelavanan       iakarta
lda Ayu Shinta
Drwi, SH, M- Kes          MedikSPesialistik

                          DirektoratJenderal Pelayarran     Jakarta
Dr- L.ndangWdyaswati
                          Medik SPesialistik
Dr. Asih
                                   JenderalPelayanan
                          Direktorai                        Jakarta
Widowaii,MARS
                          MedikSPesialistik

  Hartati M Kes
Dr.    Ramri.                                   Peravanan   Jakarta

                    .:'
                          ;,'::,T"i::,fl1;J"'
                                   Jenderal
                          Direktorat        Pelayanan        Jakarta
Dr. Fidiansyah, KJ
             Sp
                          MedikSPesialistik

                                    JenderalPelayanan
                           Direktorat                        Jakarta
               l'4Sc
 Drg. Sastrawati,
                           MedikSPesiaiisiik

                                    JenderalPelaYanan
                           Direktorat                        Jakarta
 Dr. Sumiati. Kes
            M.
                           MedikSpesialistik




 iv
                         Daftarlsi
Kata Pengantar
             .........                                          i
               JenderalPelayanan
Sambutandirektur                Medik                          ii
Tim Penyusun Buku                                              iii
Daftarlsi                                                      v


BAB I PENDAHULUAN                                              1
      A. LATARBELA}<ANG                                        1
      B. TUJUA.N                                               3
          C. SASARAN                                           3


AAB II PENATAPELAKSANAANPENGENDALIAN
                                   INFEI<SI
          NOSOKOMINAL                                          4
       A. BATAS-BATASAN                                        4
          B. ORGANISASI DAN KEDUDUKAN A NI T I AP E NG E N-
                                      P
                    INFFKSINOSOKOMINAL
             DALIAI.I                                          E


          c. TUGASDAN FUNGSI                                   7
          D. SUSUMN KEANGGOTAANDAN TATAKEF.JAPAI.IITLq
                       INFEKSINOSOKOMINAL
            PENGENDALIAN                ........              1O


BAB III     PENUTUP                                           17
DAFIAR PUSTAIG                                                18
LAMPIRAN I      INFFKSINOSOKOMINAL
LAMPIRAN II                 PENYIMPANAN
                PENGAMBII-A,N,        DAN PENGIRIMAN
                               MTKROBIOLOGI
                BAHANPEMERIKSAAN         ...............111
LAMPIRAN III ISOLASI
                     INFEKSINOSOKOMINAL
LAMPIRANIV SURVEII-ANS                                        130
                                BAB I
                             PENDAHULUA

A.   LATARBELAKANG

     Kejadianinfeksinosokomial adalahinfeksiyang didapatatau timbtfipaOa
     waktu pasiendirawatdi rumahsakit.Bagipasien rumahsakitia nnerupakan
                                                 di
     persoalan seriusyang dapatmenjadipenyebab    langsr:ngatau tidak dapat
     langsungkematianpasien-  Beberapa  kejadianinfeksinosokomial  mungkin
     tidak menyebabkan kematianpasien                    penyebab
                                      akantetapiia menjadi          penting
     pasiendirawat lebihlamadirumahsakit-  Iniberartipasienrirem.bayar lebih
     mahaldan dalarnkondisitidak produktif,
                                          disamping  pihakrumahsakit iuga
     akan mengeluarkan  biayalebihbesar.

     Penyebabnya kuman
                  oleh       yangbe;-adidilinjkungan rumahsakitatauoleh
     kumanyangsudahdibawa     olehpasiensendiri,yaitukumanendogen.  Dari
     batasanini dapat disimpulkanbahwakejzrdian        nosokomial
                                                 infeksi          adalah
     infeksi yang secara potensialdapatdicegahatau sebaliknya juga
                                                                 ia
     rnerupakan infeksiyangtidakdapatdicegah-

     Infeksinosokomial merupakan masalah global  danmenjangkau palingsedikit
     sekitar97"(variasi - 217'")
                       3%        lebihdari I.4 jutapasien    rnapoi rumah
                                                         rawat
     sakit di seluruhdunia.Angkainidilaporlcan WHO.dari
                                               oleh         hasilsurveynya
     di 14 negara,meliput;28.861pasiendi 47 rumahsakityang berada di 4
     vrilayah(region)V\IHO padatahun1986

     SurveyWl-'lO juga menghasilkan
                ini               :
              !
     1. lB %idaripasienyangterkenainfeksi
                                        nosokomialmenderita lebihdari
        satujenisinfeksinosokomial,
                                 terutama padapasienkronis.

                                                      penyebabnya-
     2- Adanyakemiripantentangienisinfeksinosokomialdan

     3.   Infeksi
                nosokomial                      yangseringteriadidi
                                 salahsatuinfeksi
                         merupakan
          negara-negarl               di
                               maupun negara-negara
                      berkembang                    industri-

     4.   Sebagianbesarmasalah         yangdihadapi
                             dan kendala                  negara
                                                   berbagai
          untukmencegah mengendalikan
                       dan            kejadian
                                             infeksi        tidak
                                                   nosokomial
     jauh bc..reda sehinEgastrategi dan pelaksaneanpencegahar-r     dan
     pengendalian  irJeksinosokornial
                                    dapatdisusununtuk ciiierapl-:arpada
     kcndisi nrasingrnasingnegara dan rumah sakit-

Akibat lain dari keqadan infeksi nosokomial adalah :

1.   Lama perawatan (LOS) lebih lama- DiAmerika Serikat sebagai akibat
     infeksinosokornial diperlukanB hari tambahanpertempat tidur setiap
     tahunnya.

2. Be rlamba h nya tfaya operasional rumah sakitda n rr.eningkat nya beb an
     biaya oleh pa:ien.

2    DiAmerika Serikaltambahan tersebutmencapaisatu juta dola: per
     tahun di runrahsakit tlangan kapasitas250 tempat lidr.rr-
             a

4-   Selain hal-Jul tersebrrt ciiatas kejadiar' inleksi nosokcrnial akan
     mengganggu pasien yang memerlukanperawatan (u;aiting l'srl serta
     berkurangnyaproduktivitas  dan tambahanbiayayang dikeluarkanoleh
     keluarga pasien-

Gambaran infeksi nosokor;:laldi lndcnesia hingga.saat ini belum begitu
ielas mengingat penanganan secaia nasional baru dirntrlai. Namun
mengingat gambaran dan akibat infeksinosckomialyanoteqadi diArne;!ka
Serikat. ientunya dapat dibayangkan bagaimana kejadran infeksi
nosokomiat di Indonesia-Walaupun belum ada angka yang pasti secara
nasional temyata@berapa rumah sakit telah melaksanakanpengendalian
infeksi nosokomial sejak beberapa tahun yang lalu.

Sebagai contoh pengalaman RSUD Dr-Sutomo- Surabalia menunjukkan
                         di
bahwa dengan pengendalianinleksi nosokomialuntuk infeksi luka operasi
(lLO) didapat:

a-   Hari pemwatanyang dapat dihemat tahun 1985, 552 hari,
     tahun 1987,416 hari.
b.   Dana yang dapat dihemat tahun 1986 Bp. 136.000.000,-
     tahun 1987 Rtr 102-OOO.OO0,-
c.   Biaya yang @rlukarr untuk pengendalian infeksinosokomiat
                    per
     Rp. 2.O0O.OOO,- lahun-
      se.hubungan  denganbesarnyamasalahdan akibatinreksinosokomial
      sebagairnana  dikemukakan    diatas, daram rangka oencegahan darr
      pengendaliannya diletapkan sasaranbahwa untuknreningkatkan dan
                                                               mutu
      efisiensi
              pelayanan  akandltingkatkan
                                        pengendalianinfekiinosokomial
                                                                   dan
      kesehatan ringkungan sertaakandilaks:,rakankegiatarr
                                                        pengendarian
                                                                   dan
      peningkatan mrltu.

     sebagaimanasalah satu syarat agar rumah sakit dapat
                                                         melaksanakan
     pengendalian
                infeksinosokomialdenganbaik dan terarahacalahadanya
     bu!<upedonnan dalam pengorganiJasian  penanggur"ng^n    dan cara
     mencegahteiadinyainfeksi
                            nosokomial-,
I




B.   TUJU!.N

     Tujuanutamadari prcgrampengendalian  infeksinosokomiar
                                                          disarana
     kesehatan adalah                terjiidinyar.ndemi*d.a.n
     rrosokorniat     !:ngYry                              -qpide-r!i
                oada          aural p-ejugas peruvlrllg
                                             O:l
     Tujuan Umum:

     Terciptanya kondisi lingkungan rumah sakit yang melle.nut-rlqqMqralan

     T::T:1l.t,   p=fg_gg!g!_J!ip_!gi_!9sq[q!m oan nremuantu proses
                                             iai
     p@yemOunin "                penderita,sehinggarumah sakitdapat
     meningkatkan
                muttrpelayanan,
                              cakr.rpan efisiensi.
                                      dan
     Tujuan Khusus:

     1- setiap Jumahsakit mempunyai
                                  buku pedomanpengendarian
                                    \+                   infeksi
        nosokoinial

     2 . Se ti ap rumah sakit dapat melak s a n a k a npengendalian infeksi
         nosokomialdengan  baik

     SASARAN

     Semuarumahsakitmilikpemerintah
                                  maupunswasta

                                   .'. J4.'.
                              BAB II
                         PENATAL,\KSA}IAAN
                   PENGENDALIAN      NOSOKOIdIAL
                              IIiFEKSI

A.   BATASAN-BATASAN
         /--      --'-- ._. -..\
                          -
     1. f- Infeksi nosokomiafadalahinfeksiyang teriadiatau didapat di rumah
         tstn:Suatotrnfcl6iyang didapatd; rumahsakitapabila :

           a. Pada saat marsuk
                             rumahsakittidak ada tanda/ gejala atau tidak
              dalam merasainkubasi     iersebut.
                                 infeksi
                       z----_____r
           b. Infeksi     3               pasien
                    t6rjadi x24 iln setetah     dirawat rumahsakitatau,
                                                      di
                     \- - .- - _
                                   - . - - .- .2
           c. Infeksi pada lokasi sama tetapidisebabkan oleh mikroorganisme
              yang berbeda dari mikroorganisrne pada saat masuk rumah sakii
              alau mik;oorganisme  per:yebabsama tetapilokasiinfeksiberhreca.

     2. ,rPengendalian    infeksii nosokomiat adatah kegiatan yang meliputi
         pEi e-n-eE-n n;80 tdGggel
                   ZI
                    a                 da n p eng_1ryas-ase- a i e :n!@a n ciaIah
                                                       n rt
         upEyEmen-urunkan     angka kejadianinii:ftsiiiosokomiairli rumah sakit.

         -.--=--\
     3. r€gg-qitglq.jadalah k_q-.g_g!9n pegamatan sistematis aktif dan rerus
         m ene rus te rhadap tim6,-rTnya* pdnyeba r.aninfeksi nosokomiat pdda
                                       dairi
         6uat, pdristiuray"ng r,onylbabkan meningkaiatau menurunkan resiko
         tersebui.
     .
     4.   Kejadian yang rnenarik perhatian umum dan mungkin menimbulkan
          kehebohan / ketakutan di- kalangan masyarakat, atau menurut
          pengarnatanepidemiologisdianggapadanyapeningkatanyang berarti
          dari kejadian kesakitan/ kematiantersebul.

     5. Suatu kejadiandi rumahsakitdapatdisebur
                                                       &Cgr..l lugr_-Bjq-sg-(f!g)
        bila p ropo rtional rate penderitabaru dari suatfflenyitii menutai Atiam
        waktusatu bulan,dibandingkan      dengan  proportional penderita
                                                               rate          b?ru
        dari penyakit menular yang sama selamaperircde         wakiu yang sama
      ' dari talrun yang lalu menunjukkan     kenaikan   dua kali atau lebih,atau
        terdapat  satukejadian    padakeadaan   dimina!-eUelumnVa    tidati-pernah
          a da .                                                i -----:   l
                                                 : OU-i
                                                     i,r1-i

"i   ORGA}.IISASI
     NOSOKOMIAL
               DAN KEDUDUKANPANITIAPENGil;LIAN                    INFEKSI


     Tujuandan sasaranprogramtersebutdicapaimelaluikegiatan       surveilans,
     pencegahan    infeksi terutama penerapankewaspadaan       universaldan
     penanggulangan   infeksinosokomialtermasuk  didalamnya penanggulangan
     KeiadianLuarBiasa (K!B) infeksinosokomial-  Untukitu perluditunjangoleh
     perencahaan rlnci ila'Idrn strategi-strategidan langkah-langkah   yang
     memerlukan   koordinasidari banyakpihak, baik individu,bagian,ataupun
     unit-unitpelayanandi sarana kesehatan  r"r"sbt{-

                                                      dan meniadidasar
     Programtersebut haruslahdijabarkansecara tertq.lis
                 pe
     perencanaan ngendalidn eksi nosokomial;"serta
                             inf                           unsu
                                                     mernuat   r-unsur
     standaryang dipersyaratkan
                              oleh PanitiaAkreditasiRumahSakitdan juga
     ketentuanpemerintahyangberlaku.-

     Berdasarkan penjelasandiatas makakegiatan  dalamprograin tersebutharus
     dilaksanakan  dalam suatu strukturilg?.lisg:! I?ag--!y_?! rapi, yang
                                                             dan
     mampu menjabarkanprogram secara'-kcjlribiimenSif,'rinci jeias,
                                                                 dan
     Organisasiyang dimaksudadalah suatu P:ftllg_len.gjndalianInfeksi
     Nosokomial   (Pantia PIN) sebagaikoordinator     dan bekerjadi tingkat
                 S6bagaipembuat kebijakanprosedur- prosedurkeria yang
     instrtusional
     berkaitandengan program pengendalian         infeksi nosokomial. sbrta
     mengeiuarkan  rekomendasi,laporandatasurvelans   yangrelevan,yangakan
     difiEipi6ak mafiernai struKilial rumahsakit dalamrnenjalankan    lugas
     dan fungsinya.

     Semuakebij4kan,rekomendasi sernuaprosessertahasilkegiatan
                                dan                           harus
                  secara rapi dan segera-
     terdokumentAsi

     Temuan temuankuncidadkegiatan
             -                        pengendalian         nosokomial
                                                     infeksi         dapat
     pula digunakan ofeh PanitiaPeningkatan   Mutu Pelayanan sebagaiacuan.
     Dalamhal inidiperlukankoordinasidari  berbagai pihakdanolehkarena   itu
     diperlukanjalur komunikasidan garis komando yang tergambar       iefas
     terhadapstruktuL-organisasi  rumah sakit secara keseluruhan,    serta
                                            - --'
                 r<Jn
     dikomunikasi r<6pli;-sE tuiirnstaf :-

     Panitia PIN biasanya dipimpin oleh seorang dokter yang mempunyai
     pengalaman dalam pengendalianinfeksi,mungkin seorangmi[glrolog':,_
            /:.,-. ,.1,-

             a: '   .-:-.




atau yang nlemrliki lirar iielakang epidemioiogi rumah sakit lepidemioloEi
kliAik).Seorang ketua dibantuoleh sekretaris dan banyak anggota-

PanitiaPIN memiliki keanggotaan   intiyangsetidaknyamencerminkan    wakil-
fiakil"ad= staf meCik, staf perawatan,administrasidan pihak yang berperan
langsung dalam suryeilans, upaya pencegahan / penanggulangan infeksi
yang dalam hal ini adalah orang yang terlibat langsung dalam perawatan
pasien di ruangan.

Anggota tambahan bersifat konsultatifa.iaubersifat ad hoc, maupun dapat.
pula sebagaianggota tetap adalahdari :

1.   unit pelayanan klinik yang terbesar
2.   panitiapeningkatan mutu pelayanan
3.   farmasi
4.                   dan disinfeksi
     pusat sterilisasi
5-   sanitasi
6.   laboratoriummikrobioiogi
7.   kesehatan pegawai
8    Etzi

Panitia PtN dibantu oleh Jlm (Pelaksana) PengendalianlnfeksiNosokomial
(nm PIN) yang bekerja langsungditingkat ruangandan berhadapanld,ngsung
dengan pasien, petugas perawatan dan pengunjung.

Meskipun dalam mengambil keputusanpertu keterlibatanyang luas dari
anggota seperti diatas, namun akan efekti{apabila dibuat penita-panitiakecil
untuk mengumpulkan rdata.-



                                                          i','        i
                                                           J              '                ,L
                                                                                   '. - j ,L7: ': :
                                                           lre.,:J,?,..-.         !. .'
                                                                   n:
                                                            )     f,-         b-w-+---.'--',
                          STRUKTUR ORGANISASI
                 PROGRAM PENGENDALTANtNFEKS! NOSOT(O^M|AL r
                                                               i'lii,    ;-. :it i'' '
                 Struktural               PanitiaPlN             DokterPIN
                                                                 PerawatPIN
                                                                 Wakildokter ,
                                                                 Wakilperawat :-
                                                                 Farmasi
                                                                 CSSD
                                                                 Telnisi-
                                                                 Administrator
                  Ruang ravrat             Tlm PIN               Dokter/Perawat PIN
                                           .., I                 Staf pelayanan
                                                I                ditingkatruangan
     tl

          Suryeilans                Upaya Pencegahan               Penanggulangan
                                 [KewaspadaanUniversal]          [Tim lnvestigasiKLB]


C.        TUGAS DAI.IFUNGSI

          Panitia Pengendaiian Infeksi Nosokomial ( Panitia PIN )
 *
          PadadasamyaP3$g llN adalah        p.ernUuglSeliiahndalam    semuakegiatan
          p e n g e n dalianinfeksi nosokomia l-P a n it ia P ! N me mp u n y a i t u g a s
          mengevaluasi     dan menetapkankelayakan     lgglgtgg s'1q4.gilans,    upaya
          pencggglan dan penaLOgrlt3lggn     infeksinosokomial-.  Tugasdan tangung
          jawab pokok dari Panitia PIN adalahmenelaahdan meny.etujui       kelayakan
          dan kemampuan      pelaksanaan semua kegiatansurveilans        nosokomial,
                                                                   infeksi
          upayapencegahan       infeksidan penanggulangan   infeksinosokomial,      serta
          prosedur-prosedur    yang dibuatdan akandilaksanakan.

                        te4uli: ielas,-
          Kghfig[an,harus                    prosedurjprosedur
                                      termasOk               yang dipakai
          dalampelaksanaansurveilans kegiaian
                                     dan       program-yanglain-

                                                jarvabatas:
          Secararinqkasmaka PanitiaPINbertanggung

          1. Terlaksananya
                         surveilansPlN.
    2.   T erlaksananya upaya pencegi.han infeksi dengan penerapan
         kewaspadaan universal

    a    Terlaks nan/a penartggulan infeksideng ;nvesitig_asi adaKLB
               a                  gan         an          bila

    4-               pendidikandan pelatihan
         Terlaksananya                      dalambidang pengendalian
         infeksi.

    5.   Pengembangan prosedur keria dan kebijakanyang mencakup semua
         kegiatan dalam bidang pengendaiian infeksi.   .

    6.   Pemilihan dan pengusutan pengadaan bahan dan alat yang
         berhubungandengan pengendalianinfeksinosokomial-

i   Tim Pelaksana Pengendalian lnfeksi Nosokomial(Tirl_P_lN)

    t , , , n 0 ", . , , "n n ; ;;;';.;p *a l .^n u l n   n;, atas piosr am
                                              ""n,,
    pengendalian infeksi adalah Tim Pelaksana Pengendalian Infeksi
    Nosokomial. Daiam hal ini Doktef P-lNdan Perawat PIN merangkappula
    sqbagai1 rm (PeiaksanaHarian)PlN.

    Jumlah personiidari llm Pelaksana PIN dan waktu yang akan dihabiskan
    untuk menjalankan program PIN tersebut diteniukan oleh panitia plN
    bersama-sama dengan rnanajernen rumah sakit-

    Jumlahindividudan wa!<1uyang digunakan
                                         akan sangattergantung
                                                             dari
                         adalah:
    banfak hal,diantaranya

    1. Besarkecilnyarumah:sakit
                              dan kompleksitas
                                             pelayanan
                                                     yangdiberikan

            risikountukinfeksinosokomiai
    2. Faktor                         yangadadiantara      pasien.
                                                    populasi

                        dan pelatihan
               pendidikan
    3. Kebutuhan                    bagipetugas
                                              kesehatan rumah
                                                      di
     - sakit.

                         yang berkaitan
               perundangan
    4. Peraturan                      denganprogram.

                 sumberdayadan sumber
    5. Ketersediaan                 dana.

            seorangtenaga pelaksana
    Contohnya,                    dapatdiserahitanggung
                                                      jawab
        pelaksanaan dan kcordinasik:giatan surveilans. pencegahaninfeksi,
        penanggulangan infeksisatu kelompokkecildi rumatrsakit (misalnya10O
                    Ataudibentuk
        tempattidur).             satu bagiar:pengendalianinfeksinosokomial
        yangdikelola tirr profesional
                   oleh                bekerjauntukareaperawatan  yangluas.

        Apapunbentukorganisasidan                   tersebut,
                                  iumlahtim pelaksana       semuaindividu
        yang terlibat
                    dalamkegiatan          pencegahan
                                 surveilans.          ataupenanggulangan
                                yang memadaidalammelaksanakan  tugasnya.
        Brusj1a{gkgTg.T-q3an
        UraianTugas

        Uraiantugasharus dibuat untuk sernua individuyang tedibat dalam pro-
        granrPiN-

                                                             [-.per-slaratan ]ang
        Dalam uraian tugas te rseb ut te rm u at pe r5Jala-t-a
        dibutuhkauuntuk melaksanakan   tugas-iugas yang digariskan dalam pro-
        gram, yaitu:

        1-   pengetahuan
        2-   keterampilan
        3-   kualifikasi-

        Anggota llm PIN berasal dari multidisjpllQ.9enganlatar pendidikan formal
                                                      analis kesehatan, kesehatan
        yang berareka, seperti perawatan, keciok;teran,
        masyarakat,ataupun kesehatan lingkungan,    namun yang tak kaiah penting
...t,
        adalah bahwa rnereka pernah metggggl-pg3llsn         atau berpengalaman
        dalam big1q surveilans, upayllelggg.aha.l dan penanggu ian gan infeksi.
t:
        Pengetahu# dasar yang akan banyak membanlu dalam melaksanakan
        tugas llm PIN adalah :
        1- Dasar - dasar epidemiologidan penyakitinfeksi,                              2.i, .
                                                                 't'''' '',..i i:
        2. Sterilisasi,disinfeksi dan sanitasi, ---. ----- ---:'
                                                                  Pa" /'tt*r''           i
        3. Metoctependidikan/ belajar-mengajar andragogi,
                                                                     &-,,d*       -iti'ti+;,
                                                                                  -q
        4- Perawatanpasien,
        5- Kemanpuan berkornunikasi secara efektif, baik lisan maupun tertulis.

        Secara ringkassetiap anggota Panitia PIN mempunyai peranan sebagai
        berikut:

        1.                                            pasien.
             Merumuskandan memantau kebijakanpelayanar:
2. Memberika:r masukan
                     tentang          peralalan
                            pem!:.:l;an       klinikdannon klinik
   sepanjang menyangkut
             itu         secaralangsung atautidakiangsung pada
            infeksi
   terjadinya     nosokomial.

3. Bekerjasama denganstaf medisdan staf paramedis
                                                untuk menyusun
   kebijakandan prosedur
                       perawatanyang baru.

4.   Melatih semua staf rumah sakit dalarnbidangprogrampengendalian
     infeksi

              seluruh rumahsakitbahwapengendalian
5. Meriyadarkan     staf                           infeksiakan
   menghemat biaya yang dapat dipakai sebagaipeningkatanrnutu
   pelayananpasien.

6.                pada'hedical audit alaumenjadi
     Berpartisipasi                            sasa'ran
                                                      medicalaudit
     itu sendiri.

SUSUNANKEANGGOTAAN          DAN TATAKERJAPANITIA
PENGENDALIAN     INFEKS|  NoSoKOMtAL        --{_
                                                     D,...;_.,r-r', : r.l .
                                                                  f
PanitiaPengendalian  infeksiNosokomial
                                     (panitiaFlii; i:arus memilikr
anggotainti sebagaiberikut:

1. Dokter pengendali  infeksinosokomial (Ketuapanitia'plN)
2- Perawatpengendati    infeksinosokomial,(sebagai
                                                 Ketua1-irnFIN).
3. . AdministrasiatauSekretaris
1. Perwakilanstaf medis
5. Perwakilansiaf perai,,ratan
6. Farmasi
7. Sanitasi
B. TenagateknisInstalasi   pemeliharaan saranaRumahSakit(lpSRS)
9. PengelolaPusatsteritisasi  dan disinfeksi
                                           (CSSD)
i 0- Laboratoriummikrobiotogi.

Dokter Pengendali Infeksi Nosokomial

DokterPengendaliInfeksiNosokomiat  (Dokter  plN)seharusnya
                                                         orangyang
cukup maqggdan betul-betul   berminat pada pengendatian infeksi,dan
mengg unEkan sebagian besar w aktUfr
                                   ydTfr-tlk-itu
            Biasanya adalahseorans mikrobiolog!
                                    ahli          dapatpulaseorang    dokteq
              p:11:t q kilj$g$i. aF         ulSi
                                   ti{1@n-ala n{,a yans cukupdisesani, cul up
            :         L"
            berpengalaman dalam ha! pengendalianinfeksi, nrau menyediakancukup
            waktu untuk menjalankantugasnya,dan mempunyai dasar pengeiahuan
                p19."-A9]o.s inik.
                          i kl
            "
    -)r-    Do_!!1!:y,:gd                               harustahmamp*u:
                                     Infeksi r.losokomial

            1. Menjalin
                      hubungan         semuapihakdi rumahsakit,baikmedi r
                              kedadengan
               maupun non medis.                                   I

            2- Bersedia
                      menjadi
                            narasumberyang
                                         memberi
                                               masukan
                                                     ientangsemua
               aspekpengendalian
                               infeksi.

            3. Ber sa ma
                       denganICN menganalis isa t a s u rv e ila n s a n me mb u a t
                                            d                      d
            '  rekomendasi,
                         tindaklanjut-

    +       P".:!                 lnfeksi       (tnfection
                                        Nosokomiat                 =
                                                               Nurse !CN).
                                                         Contro!
                        l:!9.gnd"!i

,           PerawatPIN harus terlatihdalam aspek klinik tin,rakanperrcegairan   dan
            surveilans perumahsakitan,terutama. area-area dengan resiko infeksi
                                                 di
J           nosokomialyang cukup tinggi, seperti ruang operasi, ruang rawat intensif.
            r!?09 p.erinatologi-
                              Mareka harusmampu bet<e4asama iecara erat denqan
    r       pengendaliinfeksidan semua staf perawatan.

        .   Perawat PIN bertanggungjawab atas :
                           i
                           i
            1- Menerubkan kebijakanpengendalian
                                              infeksi dengan melatih staf
               perawatan.

            2. Memberikansaran perbaikanperilaku perawat di ruangan untuk
               penerapan
                       kewaspadaan         (universal
                                   universal        precaution).

            3.    Mengidentifikasikan      bahandan sarana.
                                   kebutuhan

            4. Mengumpulkan surveilans-
                         data

            5,    Invesligasi penanggulangan Infeksi
                           dan            KLB      Nosokomial
          6. ' Me;-nbantu
                        penerapan dan penrantauankebijakanpe.rgendalianinfeksi

          7.    Menyusurrdan ntelaksanakanprogrampelatihan-

 .        B.    Penelitian.
     -i
    'r-iPerwakilanStaf Medis      !
- \J  i'D
. .i , Biasanyaseorang bedah,ataudckleryangpedulipadamasalah-masalah
                          a.hli
.' yang berhubungan         dengan infeksiseda mampumemberikan     konsuliasi
        kepada  panitia.Merekaberhubungan   erat dengandokteratau tenagalain
        dan diharapkansarannya tenta;rgperkembangan     medis baru yang ada
        dampaknya   padapengendalian  infeksi. medis
                                             Staf     tersebutadalairseorang
        dokter dari unit pelayananyang terbesar rumahsakitdan diutamakan
                                                di
        yang mempuny'ai belakang
                          latar        epideniiologi.

          Perwakilan Star Perawatan
:>
          Sebaiknyaadalahperawatsenioryang berpengalaman bidangadministrasi
                                                       di
          dan pelatihan.
                       Peran dari perwakilaniniadalah:

          1.                   setiap kebijakanpanitia plN kepada seiuruh staf
                Menyebai'luaskan
                perawatan.

          2.     tvlemastikan
                            bahwa program pelatihanyang dilaksanakanmeliputijuga
               . kebijakandan prosedur pengendalianinfeksi.

          Dalam hal ini harus ada hubungan dengan Instalasi pendidikan dan
          Pelatihan. Perwakilanstaf perawatan bertanggungjawab untuk memberikan
          masukan tentang masalah yang terkait dengan kebijakan pengendalian
          infeksiyang terjadi di ruang perawatan kepada panitia plN.


!Farmasi.
          Rekomendasi-rekomend?si  rnengenai
                                          penggunaan  antibiotik dis!n,[eElgr
                                                              dan
                     la
          disdlu?kanEEt'lrtnsEtasiFarmasiApoteerharus m@[.ra rka keurjaR-a
                                        -    f                   n       n
          tentang masatahyang terkait dengan kebijakanpengendalianinfeksi yang
          terjadidi ruangperawatankepada PanitiaPlN.
 t'{)     fenaga Teknik Instalasi Pemeliharaan Sarana Rumah Sakit (IPSRS)
 e./
                                     sebagaibagiandari PanitiaPlN, yang
          Tenagateknissangatdiperlukan
          bertanggung
                    iawabuntuk:

          1. Menguji dan merawatperalatan yang digunakan pada program
             pengendalian      sepertimisalnyaautoclave,
                        infeksl,                                  dsb.
                                                       incenerator,

          2.   Memantau          penvediaan dan listrik.
                       dan merawat        air
            ,
                                     peralatanagar memenuhistandar
          3. ilemasang dan memperbaiki
             operasional.
              --
          Teknisi harusselalu
                ini                 pendapatnya
                             dimintai          sebelumsuatupetalatandibeli,
          untuk memastikan bahwaperalatan tersebutsesuaidengankebutuhan
          prosedurperarrratan rumahsakit-
                            di

          Pengelola Pusat Sterilisasidan Disinfeksi (CSSD)

          Pengelola CSSD adalahanggotaintidari PanitiaPlN. Mereka periu bekerja
          sama cengan Tim PIN Aan hffisi      TAAikTefig ada serta merniiiki
          pengetah,.ianyang cukup mengenai ca€ disinieksidan sterilisasi.Mereka
          lugJnarus .".p,   melakukanjaga mut@n.

          Dalam menetapkan kebijakan, maka llm PIN tersebutharus nrelaiuitata
                                =-
          cara sebaoai berikut:

     . _tr'1. Menimbgng apakahsistim yang saat ini berlaku sudah memadai.
 -':-Ei. i )Bila ya, tirnjukkanmasalah potensialsehubungan dengan pengendalian
i , ;i,th     infeksi.
'-'f          Bila tidak, apakahada saran lain dari staf.
      ^r,-
;tD"-.i1t'

 ,,t'''   2-   Menintangapakah       yang
                             kebijalcan barudapat         perilaku ini.
                                                menpengaruhi     saat

                                       dalamrapat,mintapendapat
                            yangterlibat
          3- Ajak semuabagian                                   mereka,
             buatperubahanaerubahan
                                  seperlunyapadakonsep yangdiajukan
                                                                  agar
                         semuapihak.
             dapatditerima

          4.   Ajukan usulan kepada PgdllaflN  untuk mendapatkan persetujuan
               dan dapat dibuatkan
                                 Surat Keputusanoleh Direksi.
                                                                          l3
  5.     Tuniuk salah seorang anggota -ilm PIN sebagai ldnanggung iawab
                  baru tersebut.
         lcebijakan
                                                         ,   r^           i ''
                             bagiandi rumahsakir         i            '-i 'i-ti;'" .'
  6. S;;^          ke seh.rruh                               "'i'''                   '

  7. segera cantumkan dalambukupedoman
                    di                           infeksiyang
                                      pengendalian
     telah ada-

                                                             2la-
                                                      memiliki
   Mungkinakan Iebihmudahapabiladalamstrukturorganisasi
               denganhubungan
  ,pisorganisasi             keria                  dibawahini-
                                   sepertidigambarkan

   Contoh:
                                                                        -----_t
UraianTugasTim Pelaksana ( Tim PIN)
                       PIN

   l.    Tugas Umum

         Bertanggungjawab menjalankanfungsi rumah sakit dalam bidang :

   .     .   surveilans infeksi nosokomial dan investigasi K'-B infeksi
             nosokcmial-

         .   Pencegahandanpenanggulanganinfeksinosokomial.

   ll.   Tugas dan Tanggung Jawab

         .   Sebagaianggola-,PanitiaPlN

             Mengumpulkan menganalisis
                         dan             datadatamikro-organismeyang
             bermaknasecaraepidemiologis
                                       sertadata infeksinosokomial

                        laporannaratifdan statistik
             lr4enyiapkan

             Bedanggung    jawabatas peiaksanaansurveilansinfeksinosokomial
             de n g a n melakukan kunjunganrutin k e b a n g s a l p e ra wa t a n ,
             memeriksa         medikpasien,laporan
                         catatan                  laboiatorium    mikrobiologi,
             datapasien   masuk,meyakinkan kebenaranlaporan meyakinkan
                                                             dan
             penerapan   kewaspadaan umumdanperilaku  yangmungkin       berisiko.
              Memberikanbimbingan kepada staf di bangsar
                                                           dan merakukan
              pengarnatan
                        atas semua haryang beii.artan dengan pengendarian
              infeksincsokomiar, sekiranyl
                              karau      aoakerawanan
                                                    padapenerapan
              kevraspadaanuniversal-
        .     Membantu mengembangkan,   menelaahdan penerapankebijakan
              daribagianaraurumahsakityang berkaitand"ngan'p"ngendatian
              infeksinosokomiar serun'hiumah sakit, untut
                               di                           mlnunlang
              kesinambungan kepatuhan
                           dan           padaprosedursiandarpencegahan
              dan penganggulanganinfaksirumahsakit
        ,     Menelaah memberikan
                        dan            ,rp.n baliknya kepadaO,n"* r..n
                     tentangdata surveilans:pencegahan pengendaiian
                                                       dan
            ' letai! nosokomialyang
              infeksi              relevan.

             l'/engembangkan beruartisipasi
                            dan            daramprogram pe ndidikanda n
             pelatinanpencegahandan penanggula;rgan
                                                  infeksi nosokomialbagi
             staf yang membutuhkan-

             Bertanggungjawab dan mengkoordinasikan
                                                  peratihankewaspadaan
             universal seluruhlapisankaryawanrumah sakit.
                     di

             Membinahubungandenganbagianpelayanan
                                                      kesehatan pegawai
             rumah sakit untuk rnemantauadanya infeksi
                                                        nosoromiaiatau
             paianan.pada karyawan rumah sat<it
                                               Oait<yang ada hubungan
             dengan kerianya atau tidak

    '                penyeridikan
          ft_gtgtcrkan          sewaktu,ada indikasi kejadianiuar biasa
        . (KLB}di rumahsakit, dan mengevaruasi  efektivitasdan dampak
          dari kebijakan
                       pengendatianinfeksi;prosedur dan peralatan.lkut
          sertadalampeneritian
                             khususyangdirancang  untukmeneriti wabah.
lll. Kuatifikasi

   A. Pendidikan pengalaman
               dan
            . SarianaKeperawatanatauD3 Keperawatan
            ' sarjanaKesehatanMasyarakatatau D3 Kesehatan
                                                        Masyarakat
            . AnalisKesehatan D3
                            :
         Sarjana muda /.D3 dari bidang kesehatanlain.

B. Pengalamanyang lebih diutamakan
     . Pernah berkecimpungdalam epidemiologi   rumah sakit-
     . Pernah mengikuti pelatihan pengandalianinfeksi nosokomial.

c.   Persyaratan Khusus

     .    lr4emiliki pengetahuan dasar dalam ilmu kdperawatan.
          mikrobiologi, faham btas istilah kedokteran Can dasar-dasar
          statistik. Mampu rnemahainistrategidalam pengendalianinfeksi
          nosokomial,mau melaksanakan    secara konsiste.ndan mengikuti
          perkembanganperaturanperundangan       yang berdampak pada
          program pengendaiianinfeksinosokonrial

     .              wavrasan tentang kebijaksanaanrumah sakit dan
          lv'lerniliki
          prosedur perumahsakitan,    menguasaiteknik pendidikandan
          pelatihan, keterampilan berorganisasi- keterampilan
          be rkomunikirsis ecara lisanrnaupuntertulis.

D. Pelaporan

     .   Menerima laporan dari       lldak ada
     "   Lapor kepada                Ketua Paniiia Pll.I




                              ***
                                 BAB III
                              P E NUTU P

PedomanPengendalian    lnfeksiNosokomial RumahSakit,merupakan
                                        di                        pokok-
pokokpemikiran   dasarberbagai    pencegahan
                              upaye                     infeksinosokomial
                                               terladinya
yang masihpeJg.dii+barkql dalambentukprogrammaupunpe1g.{.q[,p9_!ynjuk
                          ke
                                           *_-*
t9!rri" bagi semuapihakyang berkepentingan.

Pada hakekatnya,upaya pengendalian   infeksinosokomialdi rumah sakit baru
akan terselenggarabita ginr&31 dan ctaf rumeh salljt Xglg lgrkgit
                                                                  -mempunyai
motivasidan itikad                          kesadarandan tanoourroiawab.

Bukupedomanini diharapkan               pelayanan
                        dapatmeningkatkan        rumahsakitsecara
berdayaguna berhasil
          dan        guna.




                                  .:r.*.:.




                                                                         t1
                        DAFTAR PUSTAKA

Abdullah Nasrun(Eds),1988,Naskahlen5:kao                  Nasior:al
                                       simposiurn-Lokakarya
Pengendalian                  RSUD Dr. Soeiomo- FK Unair.Surabaya.
             InfeksiNosokomiat,

Anglin Am, Farr BM, 1996, Nosocomial Gasirointestinal Tract Infection. in
Mayhall CG, Hospital Epidemiologyand Infection Control, Baltimore, William
and Willems,175-189

Benenson, AS (ed), 1990, Controlof CommunicableDlseases in Man : The
Amer- Pubi, Fiealthp.SS, V/ashington.

                                                    Litle, Browr. & Co.
Bennet JV & Erechmen PS (Eds).1936,HospitalInfectiorr
Boston.

                                   in Hcspita!lniectionCon'rrolAPP-A-?.
CDC Definition [',losocomiallnfeciion
             of

                                                             dan
Dep. Kes. Ri, 1997. PedomanKeananan LaboratoriumN'liilrobiologi
Biomedis, Jakarta.

Dep. Kes. Rl- Dirjen.Pelayanan      1993, PetunjukPenyusunanPedcman
                             tvledik.
Pengendalian   !nleksiNosokcrnial Jakarta.
                                RS,

Dep. Kes. Rl, Dirjen P2M & PLP. 1992, Pedoman SanitasiRS lndonesia,
Jakarta.

Dep.Kes. Rl, Dirjen P2M & PLP.1996, PedomanTeknisPengelolaanLimbah
Klinis, Disinfeksi dan Sterilisasidi RS, Jakada.

Dep- Kes Rl, Dirjen P2M & PLP.1993, SDP Jakarta.

Dep. Kes Rl. Dirjen P2M & PLP, 1998,SDP of Standard PrecautionsAgains
HIV/AIDS and other lnfection in Health Facility,Jakarta.

Mandell, Douglas, Bennett, 1979, Principlesand Practice of infectrons Dis-
eases, Wiley Medical Publ, USA.

                               and Safe PracticePacket Guide Series.
Masby, 1996, InfectionPrevenlion
14. Mayhall 1996,Hospital
          G,            Epidemiology ,nfection
                                  and        Control.

15. Perkembar:gan   lsclasi,Pelatihan
               Tekn!k               lnfeksi
                                          Nosokomial.

16. RSUDDr. Soetomo, Unait 1988,Naskah
                       FK.           Lengkap      N:sicnal
                                           Senrinar
    InfeksiNosokomial,
                    Surabaya.

17. SchaefferSD, GarsonLS, HerouxDt- Korniewiz                  Pre-
                                               DM, 1g93,lnfecticn
    ventionand Save PracticeST. LouisMosbyYearbook, 279-91.

18. WanzelRP,1993,Preventionand Control Nosc.comial
                                      of         Infections.




                               **-l




                                                                   r9
I-AIVIPIRAN
     ISI
DAFTAR LAMPIRAN
              :                                                           H al


         INFEKSI                                                           z9
               NCSOKOMTAL

                                                                               I



         A OEFINISI
            DafiarKode*ode Mair dan Specifn Site dan Deskdpsinya          27
         B. JENISINFEKSI}|GSOKOI,0AL                               -; 29
            I. INFEKSI  SALUBANKEMIH       (iSK)                          29
                 a- InfeksiSahrar Kernh flSKl Simotomatik                 29
                 b- lSKf tseckte{ilia Asirndornafk                        JZ

                 c. lnleksiSaluranKernrh  hnr                      r ?1

            2. INFEKSI  LUKA@ERA.SI                                       38
                 a Superfici5lkrcisi:nal
                   b Cperasi Profuda/ Deep Incisional
                   c Orqan / Rcngqa    .'                                 41
                                                 _
            'r.   PNSUMONIA                                               JU

            4.    IT.|FEKSIALIRAN
                                DARAHPRIMEFI{IADP}
            5. SEPSISKLINIS
                          {qJMCALSEPSIS)                                  62
            5. OSTEOMYELTNS
            7. SE}]DIATAU
                        BUBSA
            8.    RUANG DISCJS
            9.  INFEKS!INTRAKFAIIAL                                       67
            10. MENINGITISataUVENTRIKUUIS
            11. ABSES SPiiiALtarpa MENINOffiS                             tl

            12. INFEKSIARTERIALATAU  VENOIJS                              n
            13. SNDOCARDITIS
            14. MYOCARDITISAIAUPERICARDMS
            15. MEDIASTINITIS                                             78
            16.   KONJUNTIVITIS                                           79
            17.   MA T A                                                  81
            I8.   TELINGAMASTOID                                          oa
            19.   RONGGA MULUT(mulut.    atau qusi)
                                    liCah,                                8a
            20. stNUslTrs                                                 85
            21.   INtrEKSI SALUFAI.I
                                  MPASATAS                                86
            22.   GASTROENTERMS                                           88
            23.   INFEKSI  TRMTUSDIGESTIVUS                                on
            24.   H E PA T IT IS                                           OJ

            25.   INTRAABDOMIT'IAL                                         _
                                                                           J'

           25. NECFIOTIZING
                          EI.ITEROCOLITIS                                  ,a
                                                                                   ZI
          27.   B R ON C H IT IS                             94
          28.   II'IFEKSILAINPADI.SALURAN
                                        NAFASBAWA!{          96
          29.   ENDOMETRITIS                                 96
          30-   EPISIOTOMY
          31.   VAGINAL   CUFF                               9B
          32.   OTHERINFECTION THEREPRODUCTIVE
                                 OF              TRACT       98
          33.    KULIT                                      100
          34.   JABINGAI'I
                         LUNAK                              101
          35.    ULCUS
                     DECUBITUS                              1$2
               DISSEMINATED      INFECTION                __19.3_
          37. LUIGBAKAR                                     104
          38. ABSESBUAIIDADAatau       MASTITIS             106
          .tY. O M F H A L IT Ig                            107
          40. PUSTULOSISANAK                                108
          41. CIRCUMCISION       NrcNATUS                   103


                PENGAITIB;LAN,        DAN PENGIRI[,tAN
                            PENYIMPANAN
                BAHAN PEMERIKSAANMIKROBIOLOGI                11i


                PETUNJUK
                       UIIUM                                 ttl

                       KHUSUS
                PETUNJUK                                     112


LAMPIRAN III    ISOLASI                                      it5

          E_ PEBKETVIBANGAN
                         KONSEPISOLASI                       117
                                                          ---=;
          B. AIRBORNEPRECAUTIO},iS                           I tn

          c. DROPLETPRECAUTIONS                              121
          D. CONTACTPRECAUTICNS                              123
          c  KEWASPADMNDENGAN PENDEKATAN
                                       SINDROMIK             126
             DANKEWASPADMN TFRHADAPORGANISME
                                           KHUSUS.

                SURVEILANS     NOSOKOMIAL
                         INFEKSI
                                                          _ 130
         B. B.eNQAIUL!4I!                                    131
         ,8. TUJUANDANKEGUNMNSURVEILANSINFEKSI
                                             NOSOKOMIAL      132
         c. PENGERTIANPENGERTIAN
                       .                                     137
          D. METODE SUBVEILANS
                             INFEKSI
                                   NOSOKOMIAL             *l-4'o
                      INFEKSI
          E . PENERAPAN     NOSOKOMIAL                        141


22
LAMPIMAN
       1
       NOSOKOMIAL
 INFEKSI




                    L)
                                                                   LAMPIRANI

                             INFEKSI NOSOKO[,IIAL


A"   DEFINISI

     Pengumpulan data kesehatan secara sistematik. dianalisa dan di
     irttC&relagLan, ke mudian ciigunakan untuk perencanaan-Erelapan da n
     evaiuasi yang sistematik, analisis dan interpretasi_-vang.Jerus
                                                                  menerus Cari
     data kesehatanya ng penting,Ili-tuk digunakit datam perencanaan penerapa n
     dan evaluasi suatu tindakan yang berhubungan dengan kesehatan
     rnasyarakat,yalg didiseminasikansecara berkala kepada pihak-pihak'yang
     perlu mengetahuinya.

     Kemampuan pengumpul data untuk mendefinisikan infeksi sebagai
     nosokomialcian menentukan letak infeksinvasecara konsistenmerupakan
     halyang sangat penting- Penggunaandefinisiyang seragar:lmerupakanhal
     yang sangat kritis untuk rnembandingkandata dari satu rumah sakit dengan
     rumah sakit lain atau dengan kumpulandatabase(seper-ti sistinrNNIS),suatr-:
     tindakan yang berhubrrngan dengan kesehatan masyarakat. hasilnya
     didiseminasikan secara berka.la kepada pihak-pihalk yang perlu
     mengetahuinya.

     lnfeksi nosokomialdidefinisikansebaoai suatu kondisi lokal atau sistemik:

        sebagai akibat dari reaksi tubuh terhadap adanya kuman infeksiusatau
        toksinnyai

     2. yang tidak ada atau tidak dalam masa inkubasipada waktu masuk rumah
        sakit.

                  dasaryang penting
            prinsip
     Bebe;apa                     dalamdelinisi
                                              infeksi       adalah
                                                    nosokomial   :

     1. In for masiyang digunakan untu k me n e n t u k a na d a n y a in f e k s id a n
        klasifikasinya
                     sebaiknyamerupakan  kombinasi     hasilpemeriksaan          klinis
        dan hasiltest           alau
                     laboratorium test{estlainnya.

               klinis
        a. Bukti    adanyainfeksi     dari             pada
                                didapal observasilangsung lokasr
                                                                                    /!
        infeksi pada ;asien atau dari sumber-sumber
                                                  data yang lai.r.seperli
        status pasien.

   b. Bukti labcratoriumberupa hasil biakan,test Ceteksiantigen atau
      antibodi, atau visualisasi rnikroskopik.

        Datapendukung  diambildaripemeriksaan         yanglain,seperti
                                             diagnostik
        sinar-x, ultrasounC, scan, MRl, radiolabel
                            CT                        scan, prosedur
        endoskcpik,bioosiatau aspirasijarum.

   d.   Infeksi pada neonatusdan anak kecil.dimanamanifestasi
                                                            kliniknya
        berbedadengandewasa,diberlakukan           khusus.
                                            kriteria

2. Diagnosa infeksioleh cjokteralau ahlibe-dah, yang.didapat  dari'observasi
   langsung 'waktu pembedahan,pefrreriksaan      endoscopydan prosedur
   diagnosa lainnya, atau juga dari pemeriksaan   klinisrnerupakarr  kriteria
   yang dapat diterima,terkecualiterdapatbuktikuatyang tidak mendukung.
 . Untuk lokasi-lokasitertentu diagnosis klinis dari dokter tanpa data-data
   pendukung harus diserlaiOengai pemberian    antimikroba untukmemenuhi
.  kriteriatersebut.

   Terdapat dua keadaan khusus dimana infeksi dianggap merupakan
   nosokomial, bila:

   a.   Infeksiyang didapatdi rumah sakit teiapiba;-u
                                                    tampak setelahkeluar
  .     rumah sakit-

   b. . Infeksi pada neonalus sebagai a!<ibat
                                            keluarnyamelewatiialan lahir.

Ada juga keadaan khusus dimana infeksi dianggap bukan nosokomialbila'.

1. lnfeksiyang ada hubungannyadengan penyulit  atau kelanjutandariinfeksi
   yang sudah ada pada waktu rnasuk rumah sakit,terkecuali kuman atau
   gejala-gejalajelas mdrupakan suatu infeksibaru,

2. Pada anak, infeksi yang diketahuiatau dibuktikanmenular lewat plasenta
   (mis, toxoplasmosis, rubella,cytomegalovirus, atau syphilis)dan timbul
   sebelum 48 jam setelahkelahiran.
       jugadua.<eadaan
Terdapat             yang dianggapbukan infeksibila :

                yaitu
    i. Kolonisasi, adanyakuman{pada kulit, mukosa,luka terbuka,
                                                              atau
       dalamekskresi            yangtidak menimbulkan
                    atau sekresi)                             klinis
                                                    tanda-tanda
       adanyainfeksi,

               (peradangan),
    2. Inflamasi             yaitu keadaan sebagai akibat reaksijaringan
              cedera(iniury)atau stimulasioleh zat-zat non infeksircseperti
       terhadap
       bahankmia.

    Definisi-def;njsi
                  dibawahdiambitdari NNIS Manual, terdiriatas.l3 tempat
  - utamadan48tempatspesifikinfei<si     dengan kriteria-kriterianya,
                                   sesua.i                         disusun
    berurutanmulaiyang palingseringterjadi di rumah sakit (lnieksiSaluran
    Kemih,InfeksiLuka        pneumonia, primeralirarrdarah)diikuti
                      Operasi,          dan                          infeksi
    di tempat{empat yang disusun
                    lain             secara alfabet sesuai Cengan  kategcr:
    tempatutama infeksi(mis,boneandjoint infection,
                                                  Central  Nervous System
    Infection).
Daftar Kode-kode Majar dan Specific Site dan Deskripsinya :

UTi    Urinary Tract lnfection
       SIJTI SymptomaticUrinary Tract Infection
       ASB    Asymptomaticbacteriuria
       OUTI Other Infection of the UrinaryTract

SSI    Surgical Site Infection
       KIN     SuperficialIncisional Site (lLO superficial),terkecuali
           . . setelah CBGB (Coronary artery Bypass Graft) ,

       KNC     SetelahCBGB, laporkanSKNC untuk superficialincisional
               infection pada dadarchest

       KNL                                               incisional
               SetalahCBGB, laporkanSKNL untuk superficial
             ..infectionpada kaki / leg (donor)

      SI'      Deep incisional                   (lLO profunda),
                             surgicalsiteinfection
               kecualisetelahCBGB

      STC      SetelairCBGB, laporkanSTC untuk deep incisiorral
               surgical site infection pada dada/chest

      STL      Setelah CBGB, laporkanSTL untuk deep incisional
               surgicalsite infection pada kaki I leg (donor)

      Oigan/Space Surgical site infection

      Tunjukkan spesific site :

      BONE, BRST, CARD, DISC, EAR, EMET, ENDO, EYE, GIT, IAB,
      IC, JNT, LUNG, MED, MEN. OREq OUTI,SA, S|NU,UR, VASC,
      VCUF

  EU Pneumonia
     PNEU Pneumonia

      Bloodstream infection
      LCBI LaboratoryConfirmedBloodstreamInfection
           CSEP Clinicalsepsis

    BJ     Bcne and Joint lnfcction
           tsONE Osteomyelitis
           JNT Jointataubursa
           DISC Space
    CNS    CentralVenousSystemlnfection
           lC    Intracraniallnfection
           MEN Meningitis   atau veniriculitis
           SA    Surgicalabcess,tanpa:'neningitis

'   CVS    CardiovascularSystem Infection
           VASC Arteriaatauvenousinfection
           ENDO Endocarditis
           CARD Myocardit'is pericarditis
                           alau
           MED Mediastinitis

    EENT Eye,Ear,Nose,Throat,or Mouth tnlection
         CONJ Conjunctivitis
         EYE Semuayang bukanconjunctivitis
         EAR rnastbid
         ORAL Cavitv(mului,lidah,ataugusi)
         SiNU Sinusitis
         UR   UpperRespiratory tract,phary-ngitis,
                                                laryngitis,epiglotitis

    Gl    Gastrointestinal
                         System Infection
          GE    Gastroenteritis
     .    GIT Gllract
          HEP Hepatitis
          IAB                 yangtidakdisebutkan tempatlain
                lntiaabdominal,                 di
          NNEC Necrotizing enterocolitis

    LRI   Lower RespiratoryTract Infection,di luar pneumonia
          BRON Bronchitis,
                         tracheobronchitis,tracheitis,
                                                     tanpa adanyabukti
                pneunronia

    REPR ReproductiveTract Infection
         EMET Endometritis
         EPIS Episiotomy

                                                                         ?8
                                                                                !




        VCUF Vaginalcuff
        OREP Infeksilain pada reproductive
                                         tract,baik laki-laki waniia
                                                            &

;ST     Skin and Soft Tissuelnfection
        SKIN Skin
        ST     Decubitus
        DECU Decubitus   ulcer
        BURN Lukabakar
        BRST Abses buah dada atau mastitis
        UMB Omphalocele
        PUST Infantpustulosis
        CIRC Sirkumsisi  Neonatus

YS      Systemic lnfection
        Dl    Disseminaied lnfection

      J E N ISINFEKSI OS OK OMIA L
                    N

      1. |NFEKSI     KEMIH(rSK)
               SALURAN
       ' Definisi dan Klasitikasi


         a.   Infeksi Saluran Kemih (lSi<)Simptomatik

              Letak infeksi                       (lSK)simptomatik
                               lnfeksisalurankemilr
         '    Kode             UTI-SUTI
              Definisi         t'nfeksisaluran kemih.(lSK)s;mptomatik harus
                               memenuhipalingsedikit  satukriteria     ini
                                                                 berikut :

              Kriteria'1.      Didapatkan palingsedikit
                                                      safudaritanda-tandadan
                               gejalagejala berikuttanpaada penyebab lainnya:

                                            (t
                                    derra:r=. 38'C)
                               -    nikuria(anyang-anyangan)
                               -    polakisuria
                               -    disuria
                               -    atau nyerisupra pubik
                               -    atau biakanurinporsitengah
                                                             (midstream)
                                                                       >''|0'
            f,uman ml urin denganjerriskurnaniidak leliih
                    per
            dari 2 spesies-

Kriteria2   Ditemukan                               a
                      palingsedikitdua oai tanda-tand cian
                        berikuttanpa aCapenyebablainnya:
            gejala.gejala

            salah sahodari hal-hal berikut :
            - suprapubikdemam (>38"C)
            - nikuria(anyang-anyangan)
            - polakiuda
            - ' .disuria
            - ataunyerisupra pubik.

            dan
                                       berikut:
            salahsatudari hal-halsebagai

            1). Testcarikcetup(dipstick)positif
                                              untukleukosit
                esterasedan atau nitrit

            2). Piuria(terdapat> 1O leukositper nrl atau
                                          urinyangtidak
                terdapat bkosit per LPBCari
                       )3
                dipusingi-

            3). Ditemuicrnkuman dengan pewarnaangram
                dariurinyarg tidakdipusing(dicentrifuge).

            41. Biakan palingsedikitdua kalibedurut{urut
                      urin
                menunjukkan  jenis kumanyangsama (kuman
                                                   dengan
                gram- negatifatau S. Saphrophyticus)
                jumlah > loo koloni kurnanper ml urin yang
                diambildergan kateter.

            5). B iakan urin me n u n lu k k a n s a t u ie n is
               -ur:cpatogen (kuman gram-negatifalau S.
                Saphropffiicus) denganjumlah > 10' per ml
                pada pend e rit a y a n g t e la h me n d a p a t
                pengobatan anti-mikroba  larre sesuai

                         ISK         yang menangani
            6). Didiagnosis olehdokter

                                                             30
                7). Telah mendap a t p e n g o b a t in a n t imik ro b a
                    yangsesuai
                             olehdokteryangmenangani.

Kriteria
       3        : Pada pasienberumurs 1 tahunditemukan   paling
                  sedikii safu dari tanda-tandadan gejala-gejala
                  berikuttanpaada penyebablainnya:

                   - demam(t38"C)
                              (<37"C)
                   - nipotermia
                     apnea
                ',-
                     bradikardla 100/menit
                               <
   -'              - letargia
                   - rnuntah-muntah

            '     dan
                  hasilbiakanurirr10. kuman / ml rrrindengan tidak
                  lebih dari dua lenis kunran.

Kriteria4       : Pada pasien berumur s 1 tahun ditemukan paling
                  sedikit satu dari tanda-tanda dan gejala-gejala
                  berikuttanpa ada penyebab lainnya .
                  - demam (> 3B"C)
                    hipotermia (<37.C)
                  - apnea
                  - bradikardia< 1OO/menit
                  - letargia
                  - muntah_muntah

                 dan
                 palingsedikitsatu dari berikut:

                 1). Testcarikcelup(dipslick)positif
                                                   untukleukosit
                     esterasedan atau nitrit

                 21. Piuria (terdapat 10 leukositper ml atau
                                     >
                     terdapat 3 leukosit
                              2        per LpB dari urin yang
                     tidakdipusing).

                 3). Ditemukan
                             kumandenganpewarnaaan
                                                 gram
                       d a ri u ri n y a n q tidak di nusi nn /rri non+ ri r,,^^\
                          41. Eliakan palingsedikitdua kali berturut-turut
                                    urin
                              menunjukkan jeniskumanyang sama (kuman
                              gramnegatlfatau S. Saphrophyticusldengan
                              jumlah> 100 kolonikumanper rnl urin yang
                              diambildengankateter-

                          5). B iakan urin me n u n ju k k a rr s a t u ie n is
                              uropatogen(kuman gram-negatif atau S.
                              Saphrophyticusldenganiumlah > 105per ml
                              pada pen d e rit a y a n g t e la h me n d a p a ' r
                              pengobat a n a n t imik ro b a -y a n g s e s u a i
                              pengobatanantlgnikroba    yangSesuai

                                       ISK olehdokteryang menangani
                          6). Didiagnosa

                          7). Talah       pengobatan
                                  rr,endapal                 yang
                                                   antimikroba
                              sesuaiolehdolceryarigmenangani

Catatan:

.   Biakan positifdariujung kateterurin bukan merupakantest laboi'atorium
    yang bisa ciiterinra
                       untuk tSK-

.   Biakan urin harus diambildengan tehnik yang sesuai, seperti koleksi clean
    catch atau kaleterisasi.

.   Pada anak kecil biakan urin harus diambil dengan kaieterisasi buli-buli
    atau aspirasi suprapubik; biakan positif dari spesimen dari kantung urin
    tidak dapat:diandalkan dan harus dipasrikan dengan spesimen yang
    diambil secara aseptik dengan kateterisasi atau aspirasi suprapubik.

b. ISK / Bakteriuria Asimptomatik

    Letak lnfeksi :   infeksisalurankemih (lSK) asimptomatik

    Kode              UTI-ASB (Urinary Tract Infection Asymptomatic
                      Bacteriuria).

    Definisi          lnfeksisaluran k e mih (lS K ) a s imp t o ma t ikh a ru s

                                                                              32
                                                                                 :ilI1
                                                                                  .'
                                                                                  'i



                     memenuhi paling sedikitsatu krrteria berikut ini :

   Kriteria 1    ;   Pasienpernah memakai kateterkandung kemih dalam
                     waklu 7 hari sebelum biakan urin.

                     dan
                     ditemukan                          per
                              dalambiakanurin > 1O'kuman ml urin
                     denganjenis kuman maksimal spesies
                                               2

                     dan
   '                 tidakterdapatgelalagejala keluhan
                                              /         demam,suhu>
                     38"C,pclakisuria,      disuria
                                     nikuria,      dan nyerisuprapubik.

   Kriteria2     :                     kandung
                     Pasien tanpakateter      t"min menetapdalam7 -
                     harisebelum biakanpertama'posiiif.

                     dan
                     biakan urine 2 kaliberturu!-turuiciitemukantidak lebih
                     2 .ieniskuman yang sama denganjumlah < 1O'per ml.

                     dan
                     tidakterdapatgejalagejala/keluhan    demam, suhu > 3Bo
                     C , polakisuria, nlkuria,disui'iadan nyerisupra pubik.

)atatan :

  Biakan positif dari ujung k4teter urin bukan merupakan test laboratorium
  yang bisa diterima untuk bakteriuria-

  tsiakan urin harus diambil dengan tehnikyang sesuai, seperti koleksi c/ean
  catch aiau kateterisasi.

. lnfeksi Saluran Kemih Lain

  Letak infeksi :    Other infection of Urinary TracVlSK lain (ginjat, ureter,
                     kandung kemih, uretra, jaringan sekitar retro - retro-
                     peritonealatau rongga perinef  rik)
   Kode          :   UTI-OUTI (UrinaryTract lnfectionOther Infectionso{
                     the Urinary Tract).
Def..risi    lnfeksisalurankemih (lSK) yang lain harus rnemenuhi
             paling sedikitsatu kriteria berikut ini :

 Kriteri 1   Ditemukan kuman yang tumbuh dari biakan cairan
             bukan udn atau jadnganyang dlarnbildari lokasiyang
             dicurigai terinfeksi

Kriteria 2   Adanya abses atau tanda infeksi lain yang dapat dilihat,
             baik s?cara pemeriksaan langsu;rg, selan-:a
             pembedahan atau rnolaluipameriksain histopatologis.

Kr;teria 3   Terdapat dua dari tanOa berikut : demam (> 38' C),
             nyeri lokal, nyeri tekan pada daerah yang dicurigai
             terinfeksi

             dan
             paling sedikitsatu dariberikut :

             1). Ketuarpus atau aspirasipurulendari tempat yang
                 dicurigaiterinfeksi.

             2). Ditemukankuman pada biakan darah yang sesuai
                 dengan tempat yang dicurigai.

             3). Pemeriksaanradiologi,mis, uttrasound, CT-scan,
                 M Rl, radiolabel
                                scan (gallioum,technetium) abnor-
                 mal, memperlihatkan  gambaran infeksi.

             4). Didiagnosainfeksioleh dokter yang menangani.

             5). Dokteryang menanganimemberikan pengobatan
                 antimikrobayang sesuai.

Kriteria 4   Pada pasien berumur < 1 tahun ditemukan paling sedikit
             safu dari tanda-tandadan gejala-gejalaberikut tanpa
             ada penyebablainnya :
             -   demam (> 3B.C)
             -   hipotermia(<37'C)
                                                                                      ',:5:
                                                                                          i
                                                                                      .5"
                                                                                       ,!r j




                              -    apnea
                             -     bradikardia < 1Co/menii
                             -     fetargia
                             -     muntah_muntah

                            dan
                            paling sedikit safu
                                                  dari berikut :
                            1). Kefuar pu:
                                            ?t3y aspirasi puruten dari ternpat yang
                                dicurigai terinfeksi.  -' rr" v'r

                            2). Ditemukan kuman
                                                 pad-abiakan darah yang
                                dengan tempat y"ng                      sesuai
                                                   oi"urigI..
        _               3)- pemeriksaan radiologi,
                        '                         mis, ultrasound, CT scan,
                                  MRt,  radiotab,et.9";i;;iilm],te*rneriurn)
                                  mal, rps5nperlih211"n                 abnor_
                                                        l"urnU=ro,,
                                                                  infeksi.
                        4)- DiCiagnosa
                                     infeksiolehdokter yang
                                                            menangani.
                        5). Dokteryang menangani
                                                 memberikanpengcbatan
:unjuk pelaporan                       yang sesuai.
                   ,        "ntirn;kroba

                               noa s bs i
iHxl i li L":,,T""5ffffi ;:il.,1e n ru se a a ssr-crR (ski a d
                  i:::                               c nn
:tor Riiiko Infeksi
                    Saluran lfemih
 Kateterisasimenetap:    I
   Cara pernasangan
_.                   kateter
-         pemasangan
.  .:ama
            perawatankateter
  ^Kualitas
           pasien(umur)
l::e?t?nan
uecubitus
Pascapersalinan.

rnjuk pengembangan
                    Surveilans lnfeksi
                                       Saluran Kemih
Faktorrisikoharusdicatat
                       denganrengkap   padacatatanpasien
                                                        orehdokter
perawa.tatau angEota tim keseh'atan yar.g menanganipasien (Ketegori l)-
                                  lain

b.   Pelaksanaan surveilans menghilung rate menurut faktor resiko spesilik
     (pemasangan kateter) minimaisetiap enam bulan sekali dan melaporkan
     pada Panitia PIN dan sekaligusmenyebaduaskannya  dalar,: buletin runrah
     sakit (Kategori lt).

c.   Pelaksana surveilans membrratlaporan ISK kasar pada but:tin rumah sa.kit
     tiga bulan sekali (fategori l)-

Pencegahan lnfeksi Saluran Kemih.

Untuk mencegah terjadinya infeksi saluran kemih nosokomial perlu diperhatikan
beberapa hal yang berkaitan dengan pemasangankateter urin.

a-   Tenaga Pelaksana:

     1). Pemasangan kateter hanya dikerjakan   oleh tenaga yang betul-betul
         memahami dan terampildalamleknik   pemasangankatetersecara aseptik
         dan perawatan kateter (Kategoti l)

     2).   Personil yang memberikanasuhan pada pasien dengan kateter harus
           mendapat latihansecarabeftala khususdalamtehnik yang benar tenlang
           prosedur pemasangan kateterkandungkemih dan pengetahuan tentang
           kornplikasi poiensi yang timbul (Kategori ll).

b. . Teknik Pemasangan Kateter-

     1). Pemasangjankateterdilakukan    hanya bila perlusaja dan segera dilepas
         bila tidak diperlukanlagi.Alasanpemasangan    katetertidak boleh hanya
         untuk kemudahan personildalammemberiasuhanpada pasien (Kategori
         I t).

     2).   Cara drainase urin yang lain seperli : kateterkondom, katetersuprapubik,
           kateterisasi selang - seling (intermitten)dapatdigunakan sebagai ganti
           kateterisasi menetap bila memungkinkan(Kategori lll).




                                                                                36
                                                 kateterharuscuii tangan
                                       manipr.rla.si
         3). Caratangan Sebelum sr-sudah
                       :       dan
             (Kategoril).
                                   r
;.       TeknikPemasanqan Kateter

         1). Gunakanyangterkeciltetapi   tetaplancarCantidakmenirnbulkan
                                    aliran
                     darisampingkateter(Kategori
             kebocoran                         ll).

         2)- Pemasangan   secara aseptikdenganmenggunakanperalatansteril
             (Kategori
                    ll).,

         3). Pemakaian drain
             Penakaiandrain harusdengansistem tertutup, baik dengan cara
             penghisapan dengan
                        atau       caramemakai  gayatarikbumi(gravitasi)dan
             drainharusmelalui
                             lukatusukandi luarluka operasi(Kategorit).

J.                pascaOperasi
         Peravvatan

         1).   Untuk luka kotor atau infeksi,kulittidak ditutup primer (Kategoril)

         2).   Petugasharusmencucitangan   denganstandar cuc; iariganyang baku
               sebelum dan sesudah merawat iuka. Pelugas tidak boleh menyentuh
               luka secaralangsung dengantangan.kecuali setelah memakaisarung
               t.angansteril iKategori i)

         3).   Kasa penutup luka digantiapabila:

               .   Basah
               .              tanda-tandainfeksi(Kategori l).
                   Merrunjukkan

               Jika cairan keluar dari luka, lakukan pewarnaan gram dan biakan
               (Kategoril).

     .   PengendalianLingkungan

         1). Semua pintu kamar operasi tertutup dan jumlah personil yang keluar
             masuk kamar operasi dibatasi(Kategoril).

         2.)   Ventilasi
                       kamar operasiharusdiperhatikan
                                                    dalam hal :
          .     Udara yang sudah disaringmasuk ke kamar operasi ciari atas
                     usrktt ke bavrah.
                dik-ol

          .             pergantian x / iam (Kategori
                Frekuensi        25               l).

    3). Alat-alat operasisetelahdibersihkan jaringan,Carahatau sekresi,
                                           dad
        harus disterilkandenganotoklaf.Kesempumaan ke{a otoklaftersebut
        harus diperiksaseminggu  sekali(Kategori
                                               l).

    4)-   Kamaroperasiharusciibersihkan

          .     antara2 operasi
          .     tiap hariwalaupun  kamar operasitidakdipakai
          .     tiap minggu  (satu        operasi
                                  haritanpa       untukpembersihan
                                                                 meqyeluruh)
                (Kategori l).
                                       _    j
    5).                                                karnaroperasi
                                       padapintu l-nasuk
          Pemakaiankesetdenganantiseptik
                                 i).
                          (Kategori
          tidak clianjurkan

    6)- Biakanudara  danbiakanyangdiambil personil
                                        dari               secara
                                                kamaroperasi
                            (Kategori
        rutin,tidakdioerluka;r      l).


.                      (ILO)
    INFEKSI LUKA OPERASI

    a.    Su p e rficiallncisional

          Letak Infeksi       lnfeksilukaoperasisupedicial
                         i
                         l

          Kode                S S I-(S K IN)Su rg ic a l S it e I n f e c t io n S u p e rf ic ia l
                              lncisionalSite.

          Definisi                      operasi
                              lnfeksiluka                             paling
                                                          harusmemenuhi
                                                superficial
                              sedikit_safu
                                        kriteria      ini
                                                bgrikut :

              Kriteria        Infeksiyangteriadipadadaerahinsisidalamwaktu
                              30 haripascabedah



                                                                                               33
                        dan
                        hanya meliputikulit,subkulan atau jaringanlain diatas
                        fascia

                        dan
                        terdapat palingsedikitsatu keadaan berikut:

                        1). Pus keluar dari luka operasi atau drain yang
                            dipasang diatas fascia

                        2)-   Biakan positif dari cairan yang keluar dari luka
                              atau iaringanyang diambii secara aseptik

                        3).   Sengaja dibuka oleh dokter karena terdapat
                              tanda peradangan kecuali jika hasil biakan
                              negatif (palingsedikit terdapat satu dari tanCa-
                              tanda infeksi berikut : nyeri, bengkak lokal,
                              kemerahan   dan hangat lokal).

                        4)- Dckter yang menangani menyatakan terjadi
                            infeksi

Petunjuk Pelaporan :

'   Jangan lapcrkanabses jahitan (inflanrasi dan Cischargeminlmalterbatas
    pada titik-tliikjahitan) sebagai infeksi

    Jangan melaporkansuatu infeksilokalpada tempat tusukan (stabwound)
    sebagai SSl, tetapi laporkan sebagaiinfeksikulitatau soft tissuetergantung
    kedalamannya         i

.   Laporkan infeksi pada circumcisibayisebagai SST-CIRC (Skin and Soft
    Tissue Infection Sirkulasi Neonatus).Circumcisi bukan merupakan
    prosedur pembedahan bagi NNIS.

'   Laporkan infeksip.adaepisiotomisebagaiREPR-EPIS. Episiotomi
                                                              bukan
    merupakan prosedur pembedahanbagi NNIS.

.   Laporkanluka bakar yang terinfeksisebagai
                                            SST-BURN.
                                  pasien mempunyaipalinEseciikit    satu daritanda-
                                  tanda atau geiala-geialaberikul: cjemarn (>389C),
                                                            biakaninsisinegatif.
                                  atau nyeri lokal,terkecuali

                              3). Diketemukan                    adanyainfeksi
                                              abses atau buKrilain
                                  yang mengenai insisrdalam pada pemeriksaan
                                  langsung, waktu pembedahan ulang, atau
                                  dengan pemeriksaan histopatologis atau
                                  radiologis-

                              4). Doktdr yanE rnenangani menyatakan terladi
                                  infeksi-

        Petunjuk Pelaporan :.

       .     h4asukkan                                    atau p;-oft
                               yang mengenaibaiksuperfisiai
                        infek-si                                    nca sebagai
                                 profunda.
             infeksi luka op'erasi

       .     Laporkan biaya spesimen dari insisi superfisialsebagai lD (incisional
             drainage).

     c- Organ / Rongga

           Letak lnfeksi :   ILO Organ/Rongga

           Kocie             SSt-(Letak       padacrganirongga)
                                      spesifi!<

           Definrsi         ILOorgan/ ronggamengenai      bagian badanmanapun,
                                              fascia,ataulapisan-lapisan yang
                            kecualiinsisikulit,                         otot.
                            dibukaataudimanipulasi   selama pembedahan.  Tempat-
                            tempat spesifik dinyatakan    pada ILO organ/rongga
                            untukmenentukan     lokasiinfeksi         Padadaftar
                                                           lebihlanjut.
                            dibawah terdapattempat-tempat     spesifikyang harus
                         -. digunaka;r untukmembedakan orgar/rongga.
                                                            ILO
                            Sebagaicontoh : appendictomi      yang diikuti dengan
                                                     yang
                            absessubdiafragmatika, harusdilaporkan        sebagai
                            ILO organ/ rongga    padatempat        intraabdominal
                                                            spes'dik
                             (ssr-rAB).

4l
-l
     Bilair.leksi
                incisional
                        mengenaiatau meluas sampai        fasciadan
                                                 l.elapisan
     otot. laporkansebagailnfeksi         profunda.
                                lukaoperasi

     Masukkan infeksiyang
                        mengenaikedua letak,        dan profunda,
                                           supedisial
     sebagaiInfeksi         profunda-
                  lukaoperasi

     Laporkanspesimen      did    slperfisialsebagailD (incisionaldrain-
                     biakan irrcisi
     age)

b.   Operasi Profunda/ DeepIncisional.

      Letak lnfeksi                        profunda
                        Infeksiluka.'rperasi

      Kode              ssr-(sr)
                       SSI-ST(softtissue)diluarprosedurpembedahan
                       NNIS berikut,CBGB (coronaryanery bypass gr2ft
                       termasukirisandada dan kaki)

      Definisi          Infeksiluka operasiprofundaharus memenuhi pal-
                        ing sedikit
                                  satukriteriaberikutini :

     Kriteria          Infeksiyang      padadaerahi;rsisi
                                  teriadi               dalam waktu
                       3Oharipascabedahatau sampaisatu tahun pasca
                       bedah(bilaada rnplantberupancn human derived
                       implantyangdpasangpermanen)

                       dan
                       metiputiiaringanlunakyangdalam(mis, lapisanfas-
                       cia dan otot)dari insisi

                       dan
                       terdapatpalir4tsedikitsatu keadaanberikut :

                        1). Pus keluar-_dari insisi dalam tetapi bukan
                                          luka
                            berasal komponen
                                  dad          organ/rongga dari daerah
                            pembedahan-

                        2).. Insisidalamsecaraspontanmengalamidehisens
                             atau dengansengajadibuka oleh ahli bedah bila
                                                                       40
                  suatu ILO organ/ rong3a harus memer
                  berikut:

Kriteria          Infeksitimbuldalamwaktu 30 hari setsla----:s::iii
                  pembedahan, tidak dipasangimplani:--:* ::a:i
                               bila
                  waktu satu iahun bia dipasangimplantli.- ;-'irSi
                  tampaknyaada h u b u n g a n n y a e n g a n: -: s : : u r
                                                    d
                  pembedahan-

                  dan
                  lnfeksimengenai    bagiantubuh manapun. =::-e.i
                                                              :;-
                  insisi kulit,fascia,atau lapisan- lapisan:::'. .?a--c
                  dibuka atau d ima n ip u la s i s e la rn a : ' --: : : -: i
                  pembedahan.

                  dan
                  p a s i e n p a l :n gs e d i ki tmempunyai sal ah safu:= " -= -' ' -i

                  1). Drainage purulentdari drain yang dipa::- I - -i : -:
                      luka tusuk ke dalam orgarVrcngga.

                  2)   Diisolasikuman dari biakan yang Cia,-: :=---:-:
                       aseptikdari cairan atau jaringandari c:.:- :-:::
                       atau ruangan.

                  3). Abses ataubuhi lainadanyainfaksi!,a.: -:-
                      organ/rongg a y a n g d ik e le mu r: -
                      pemeriksaan langsung waktupembec:-:-
                      atau denganpemeriksaan     histopai-- ::-
                                                            -'-::
                      radiologis.

                  4). Dokter        sebagaiILOorga^ 'l'-=-l:
                           menyatakan

Petunjuk Pelaporan:

a
    Kadang-kadang         organ/rongga
                    infeksi           mengalirmelalui : --:.-i:
                                                              ir.s
    semacam itu umumnyatidak berhubungan          denganPe-::--: --:--
    u la ng dan dianggapsebaga ip e n y a k it d a ri in s is i ^-:':-: '
                   sebagai profunda.
    diklasifikasikan        ILO
       .           biakan
           Laporka.l           dari            sebaga; (incisional
                        spesimen insisisuperfisial   lD
           drainage).


Berikut adalahtempatspesifikILO organ/ rongga:

      Kode      Letak

       Bone      Osteomyelitis
                'Breastabscesss atau mastitis
       BRST
      CARD                 atau pericarditis
                 myocarditis
       DISC     Discspace
   ' EAR        Ear.mastoid
       MET      Endometritis     -
       ENDO     endocarditis
       EYE      Eye,diluarconjunctivitis
       G IT     Gitract
       IAB                      yang
                lntraabdominal, tidakdisebutkan             lain
                                                    diternoat
       lC       Inlracranial,
                            bra-inabscess ataudurarneter
      JNT       Jointataubursa
       LUNG           lai;rditractusrespiratorius
                inteksi                         bawah
      MED       Med:astinltis
     . MEN      Meningitisatauventriculitis
      ORAL      Oralcavity (mulut,lidah, gusi)
                                        atau
      OREP      OtherMaleatau Femalereproductive
      OUTI      Otherinfections the urinarytract
                                 of
       SA       Spinalabscess   tanpameningitis
      SINU      Sinusitis
       UR   -   Upperrespiratory  tract,pharyngitis
       VASC     Arterialatauvencusinfection
       VCUF     Vaginalcuff
             FaWorrisiko Infeksi Luka Operasi
             a.     Tingkatkontarninasiluka
             b.    Faktorpejamu:
                   . Usia extrim(sangatmrrdaltua)
                   . Obesitas
                   . Adanyainfeksiperioperatif
                   . Penggunaankortikosteroid
                   . Dlabetesmellitus
                   . Malnutrisiberat

-            c. .Fakturpada lokasiluka :
                   '    Pencukuran daerahoperasi(cara dan vraktupencukuran,
                   .    DeVitalisasijaringan
                   .    Bendaasing
                   .    Suplai
                             darahyangburukke daerah   operasi
                   .    Lokasilukayang mudahtercernar (dekal.perineum).
         d.        Lamaperawatan
         e.        Lamacperasi

         PetunjukPengembanEan     Surueirans tnfeksiLuka operasi*)
         a. Semua faktor risikoharusdic.atat
                                           denganlengkappadacatatanpasienoleh
    '       dokter, perawat atau anggotatim kesehatantain yang menanganipasien
            (kategoril).
         b'       Kfasifiakasi
                             operasi harus dicaiat pada laporanoperasiatau pada cataian
          .       pasienoleh ahlibedahsegerasetelahpasiendioperasi   (Kategoril).
        c'        Pelaksanaah  surveilans
                                        harusmenghitung menurut
                                                         rare      klasifikasi operasi
                                                                            luka
                  minimalsetiap6 (enam)bulansekalidan melaporkannya    pada.panitLprrrr
                  dan pada bagianbedah (Kategoril)
        d'        Pelaksana surveilans
                                     menghitungrale menurut
                                                          prosedurspesifik
                                                                         setiapenam
                  bulansekalidan melaporkannya                 plN
                                             pada KomitePanitia dan paraahlibedah
                  (Kategori
                          ll).
        c'        Pelaksana  suerveilans
                                       menghitung   rafekasusILO padabuletinrumahsakit
                  setiaptiga bulansekali(Kategori
                                                l).
        ')        Petudiuk surrenarc lrmg dnaksud adatah %rbble 5p€s1k wnuk
                                                                                    hasi.g-rusiog lckasi D-eksi.
                  variable iiah. eperti umur, i)nis kelamh mit /bagian ctanhio,tain
                                                                                    *-"-u.tut   rJ-r"       i.ilu_
                                                                                                      'oa.i

                                                                                                                     AA
oencegahan lnfeksi Luka OPerasi.

                             dalam:
                 dikelompokkan
        pencegahan
llnrJakan

I                masukrumahsakit:
    Kala seb'elurn

    1 ) . Sem u a p e meriksaan  dan pengobat a nu n t u k p e rs ia p a no p e ra s i
                     dilakukan sebelumrawatinapagarwaktuprabedah          meniadi
          hendaknya
                                     lli'
          pendek( < t hari ) (Kategori

    2 ) . P er b a ika n keadaanya|lgmemperbes a rk e n lu n g k in a n t e rja d in y a |L o
        ' antaralain :

        .       diibetes melitus
        .       malnutrisi
        .       cbesitas
        .       infeksi
        .                             (Kategorill)
                pemakaiankortikosteroici

                   :
    Kala Pra'OPerasi
                                                                    Apabila
    1). Perawatanpra operasisatu hari untuk operasiberencana.
        keadaanyang memperbesar      terjadinyalLo tidakdapatdilakukan luar
                                                                     di
                          :          beratya:rgmemerlukan
        rumahsakit (rr,isal malnutrisi                    oal atauparenteral
        hiperalimentasi) makapasiendapai dirawatlebihawal (Kategori   ll).

                                                            (Kategori
     2)- Mandi dengan antiseptikdilakukanmalamsebelumoperasi
         lll).
                                                                 perlu,
     3 ) . Pencukuranrambutdaerah operasi dilakukanhanya bilamana
           misalnyadaerahoperasidengan rambutyanglebat'

            Cara pencukuranadalahsebagaiberikut:

            .    Bila menggunakan                   dilakukanenam jam
                                 pisau biasa maksimal
                 sebelumoperasi-

            .                    pisaucukur listrik
                 Bila rnenggunakan                              lebihlama
                                                   dapatdilakukan
                   sebelumoperasi
                                daripadapisaucukurbiasa.
                 . Setelahdicukurdiolesiantiseptik
                                                  (kategorilil)-

      4). Daerahoperasi
                      harusdicucidengan
                                      pemakaian             antiseptik dengan
                                                                     kurit
              teknikdari sentralke arahtuar.
              Antiseptikkutit yang dipakai dianjurkankhrorheksidin,
                                                                 rarutanyodium,
              atau iodofor(kategoril).

      5). Di kamaroperasipasiendih,tupdenganduk sterirsehingga
                                                             hanyadaerah
          operasiyangterbuka(kategori t)-

      6). Antibiotikaprofilaksis
                               diberikansecara :_.

              Sistemikharusrnemenuhi
                                   syarat:
             .     tepatCosis

          '       tepatindikasi
                              (hahya untukoperasi
                                                bersihtertontaminasi,
                                                                    pemakaian
                  implantdan protesis.
                                     atauoperasidengan risikotinggiseperti
                                                                        bedah
                  vaskuler.atau bedahjantung).

          '       tepai cara pemberian
                                     (harusdiberikansecarar.v.duajam seberum
                  operasidirakukan,
                                  dan diranjutkan
                                                tidak rebihdar!4s jam).

         '        tepat jenis (sesuaidengan mikroorganisme
                                                         yang sering menjadi
                  penyebab  ILO (Kategori
                                        t).

              r hanfa digunakanuntuk operasi kotcrektar,
                                                       dan diberikantidak
         9fJ
         lebih dari 24 iam (Kategorit)-

         Catatan:
         Antimikrobayang diberikanpada rukaoperasikotor
                                                       dirnasukkan
                                                                 daram
         kelompokterapeutik.

c.           Tm pembedahan
     Persiapan

     1). Setiaporangyangmasukkamaroperasi
                                        harus:

                                                                           ,1K
        .   memakat    yang efisien,
                  masker                       dan mulut-
                                          hidung
                                   menutupi

        .                                       rambut.
                        kepalayang menutupisernua
            rnemakaitutup

        .                                            pembungkus
            memakaisandalkhususkamaroperasiaiaumemakai
            (kategoril).

    2). Anggota bedahsebelum
                 tim             setiapoperasiharusmencucitangan   dengan
        antiseptikselama5 menil atau lebih, denganposisiiari-iari
                                                                lebihtingqi
                          l).
        dari siku (Kategori

    3). Antiseptikyang dianjurkan                                     atau
                                   untukcuci tangankhlorheksidin,lodofo(
        heksaklorofen(kategori ll)-

                         keringkan
    4)- Setelahcucitangan,       denganhanduksteril(Kategori
                                                           l).

                                                   l)
                                            (kaiegori
                                       steril
    5). Setiapanggota harusmernakaiiubah
                    tim

                      tim
    6). Setiapanggota hai'us    memakaisarung             apabila
                                                    steril,
                                               tangan            sartrng
        tersebutkotor,harus digantiyang b,aru.

                 sarungtanganmemakaimetode
    7). Penrakaian                               (Kategori
                                          tertutup       l).

    B). Untukoperasitulangatau pemasangan                    ciuala-
                                                  harusmemakai
                                            implant
        pis sarungtangansteril (l<ategori
                                       ll).

.   IntraOperasi

    1). TeknikOperasi

         Harusdilakukan
                      dengansempumauntukmenghindari kerusakan  jaringan
         lunakyangberlebihan,
                            menghilangkanrongga,mengurangi perdarahan
         dan menghindaritertinggalnyabenda asing yang tidak diperlukan
         (Kategoril).

    2). Lama Operasi
           Operasidilakukan
                          secepat-cepatnya
                                         dalam batirs yang aman (kategori
           t')



     3). Gunakan  peralatan
                          sepertisarung       kainpenutupduk, kainkasa
                                        tangan,
         cian antiseptik              hanya untuk satu kali pemasangan
                       untukdisirrfeksi
         (Kategorilt).

     4). Kategoriyang sudah terpasangharus difiksasi secara baik untuk
                        pada
         mencegah',aril<an uretra(kategodl)-

e.   SisiemAliran-Teriutup
                       Ir




     1)- lrigasi hanya dikerjakan apabila diperkirakan ada surnbatan aliran-
       ' misalnya karenabekuandarah pada operasi prostat atau kandung kemih.
         Untuk mencegahhal inidigunakanirigasikontinusecara tertutup. Untuk
-        menghilangkarr sumbatanakibat bekuan darah dan sebab lain dapat
         digunakanirigasiselangseling.lrigasidengananiibiotiksebagai tindakan
         rutin pencegahaninfeksitidak dianjurkan(Kategori li).

     '2'). Sumbangan kateterharus didisinfeksisebelumdilepas (kategori ll)-

     3).   Gunakan sempritbesar steril untuk irigasi dan sei.elah irigasi seiesai
           semprit dibuangsecara aseptik (Kategori l).

     4). Jika kateter              dan
                          tersurnbat harusseringdiirigasifiika kateleritrr
                     sering
         sendirimenimbulkan sumbatan),maka kateterharus diganti(Kategori
         il).
                    :
f.   Pengambilan  BahanUrin

     1 ) . Bahan pemeriksaan segar dalam jumlah kecil dapat diambil dari
                               urin
           bagiandistal kateter, jika lebihbaikdariternpat
                              atau                        pengambilan bahan
           yang tersedia, sebelumurin diaspirasidengan
                         dan                               jarum dan semprit
           yang steriltempatpengam!:lan baha;iha,-us            (kategoril).
                                                     didisinfeksi

     2). Bila diperlukan
                       bahandalamjumlahbesarmakaurin harusdiambildari
         kantongpenampung  secaraaseptik(Kategori
                                                l).


                                                                              ,4Q
g"    Kelancaran
               AliranUrin

                              sampaike kantongpenampung.
      1). Aliranurinharuslancar

              Pe n g h e n tianaliran secara semen t a ra h a n y a d e n g a n ma k s u c J
              m e n g u m p ulkan bahan pemeriksaa n u n t u k p e me rik s a a ny a n g
       .      direncanakan,   (Kategorill)

      21. Untur menjaga         aliran perhatikan:
                       kelancaran

              .. Pipajangantertekuk
                                  iKinking).
              .    Kantong penampungharus dikosongkan secara teratur ke wadah
                   penampungurinyang terpisah bagi tiap-tiappasien. Saluran urin dari
                   kantong pe:tampungtidak boleh menyentuh wadair penampung,

              '    Kateteryang kuranglancar / lersumbal harus diirigasiteknik No. 5
                   bila perludigantidengan
                                         yang baru.
           .. .,

             '     Kantongpenampungharus selalu terletak lebih mudah dari kanclung
                   kemlh (Kategoril).

'r.   PeravyatanMeatus

      Dianjur$ianrnembersihkan  dan pelawatan meatus (selama kateter dipasang))
      dengan larutan povidorte lodine, walaupun tidak mencegah kejadian infeksi
      saluran kemih (Kategoriil).

      Penggantian Kateter

      Kateter urin menetap tidak harus diganti menurul waktu tertentu / secara rutin
      (Kategorill).

      'Ruang Perawatan

      Untuk mencegahterjadinya
                             infeksisilangantara pasien yang memakaikateter
      menetap ma[<apasienyangterinfeksiharus dipisahkandengan tidakterinfeksi


 l
         (Kategori
                lll).

    k.   Pemantauan
                  Bakteriologik

         Pemantauan   bakeriologiksecararutin pada pasien yang memakaikateter
                        (Kaiegorilll)-
         tidak dianjurkan


    3.   PNEUMONIA

,                adalah
         Pneumonia                  nafasbagianbavrah(ISPB),
                       infeksisaluran

         Letak infeksi       Pneumonb

         Kode                PNEU-PNzu

         Definisi            Pneumonia            paling
                                      harusmemenuhi                   kriteria
                                                              saludai'i
                                                        sedikit
                             berikut:

         Kriteria 1          Pada perneriksaan fisik terdapatronki basah atau pekak
                             (dullness)pada perkusi,

                             dan
                             salah satudantara keadaarrberikut:

                             1). lrmtxJ perubahan baru berupasputumpurulenatau
                                 terjad perubahansifat sputum
                         :
                             2)- lsolasikuman positifpada biakan darah '

                             3). tsolasikuman patogen positif dari aspirasi trakea,
                                 sikatan/cuci bronkus atau biopsi.

         Kriteria2           Foto torak menunjukkan adanya infiltraf, konsolidasi,
                                     eftrsipleura baru atau progresif.
                             kavitasi,

                             dan
                             salahsafudantarakeadaan
                                                   berikut:

                                                                                50
             1). Timbui perubahan                  purulen
                                 baru berupaspr-1.um      atau
                                sifatsPutum.
                 terjadiperubahan

                                   padabiakandarah,
             2\. lsolasikumanpositif

             3). lsolasi kuman patogenpositif dari aspirasitrakea,
                                     alau bioPsi,
                 sikatan/ cuci bronkus

                                   atauterdapatantigenvirusdalam
             4)- Mrus dapatdiisolasi
                 sekresi salurannafas,

             5)- TiterlgM ataulgGspesilikmeningkat x lipatdalam2
                                                 4
                 kali pemeriksaan,

             6)- Terdapattanda'tanda        padapemeriksaan
                                    penumonia
                 histopatologi,

Kriteria3   : Pasien berumur < 1 tahun didapatkan dua diantara
                      berikut :
             "keadaan

             -   apnea
             -   takipnea
             -   bradikardia
             -   mengi (wheezing)
             -   rcnki basah
             -   atau batuk

              dan
              paling sedikit satudianiarakeadaan berikut :

              1): Produksi dan sekresisaluran nafas meningkat,

              2). f imbul perubahanbaru berupa sputurn purulenatau
                  terjadi perubahan sifat sputum,

              3). lsolasi kuman positif pada biakan darah,

              4). lsolasi kuman patogen positif dari aspirasi trakea,
                  sikatan / cuci bronkusalau bioosi.
               5). Vi;usdapatdijsolasiatau terdapat antigen virus dalam
                   sekrasi saluran nafas,

               6). terdapattanda-tanda pneumonia pada pemeriksaan
                   histopatologi.

Kriteria4    . Gambaranradiologitorak serialpatJa penderita umur > 1
               tahun meriuniukkaninfiltrat baru atau progresif, konsolidasi,
               kavitasi,atau efusi pleura,
                            ''
               dan
               paling sedikit satu diantara keadaan berikut :

              .,1). Produksidansekresisallrrannafas meningkat,
       _
               2), Timbulperubahanbaru berupa sputum purulen atau
                   terladiperubahan sifat sputum,

               3). lsolasikuman positif pada biakan darah,

               4). lsolasi kurnan patogen positif dari aspirasi trakea,
                   s:katan/ cuci bronkus atau biopsi,

               5). Virus dapat diisolasi atau terdapa.tantigen virus dalam
                   sekresisaluran nafas,

                                           pada
                                    pneumonia pemeriksaan
            I 6). ffJ,1il?:,ffoa-tanda

Catatan:

. Sputumyangdibatukkan  tidakbergunadalamdiagnosis  pneumonia
                                                            tetapi
  mungkinmembantu  mengidentifikasi
                                 kun,o;;etioiogi< memberikan
                                                cizrh         data
  suseptabilitas
               antimikrobial.

. Penemuan pemeriksaan
           dari              dadaserialmungkin
                       sinar-x               lebihmembantu
  daripadapemeriksaan
                   tunggal.
Faktor Risiko Pnemoni-

a.   lnstrumentasisalura.nnafas misalnyapada pemasangan pipa enCotrakea,
     ventilasimekanis,ciantrakeostomi-

b.   Tindakan operasi terutama operasi torak dan abcjcnren.

c-   Kondisiyang mudah rnenyebabkanaspirasi misalnya pada pemasangan pipa
 .   lambrrng (nasogastric tube), penurunan kesadaran, dan disfagia.

d.   Usia iua.                I

e.   Obesitas.

t- ." Penyakil obstr-uksi
                        paru me;rahun-

g-   Tes funosiparu abnorrnal(terutamadengan pcnurunan kecepataneskpirasi).

h.   lntubasidalamrval<tu
                        lama-

i.   Gangguanfungsi iniunologi-

Petunjuk Pengemban'gan Surueilans pnemonia :

a.    Semua faktor risiko harus cjicatat
                                       denqan lengkap pada catatan pasien oleh
     'dokter, perawat atau anggota tim kesehatan lain yang menangani pasien
      (Kategoril).

b.   Pelaksanaansurveilansmenghitungrate menurut faktor resiko spesifikmini-
     maljenis operasilorak dan abdomen, dan.ventilalorserta melaporkan pada
     Panitia PIN rumah sakit minimal 6 bulan sekari dan sekaligus
     menyebarluaskannyamelalui buletin rumah sakit (Kategori ll)


4.                        pRlMER (tADp)
     INFEKS|AL|RAN D,A,RA,H

     Letak lnfeksi   : InfeksiAliran Darah primer (lADp) atau Laboratorycon-
                       firmed Bioodstream Infeciion(LCBI)

ii
Koce        BSI-LCBI

Definisi    Infeksi
                  alirandarahprimeracialahinfeksialirandarahyang
            timbultanpaadaorganatau   jaringan la.inyang dicurigai
            sebagai sumber infeksi.

Kriteria1   Terdapat kuman pathogenyang dikenal dari satu kali atau
            lebih biakan darah

            dan
            biakan dai darah                         dengan
                             tersebuttidak-berhubungan
            infeksidi tempat
                           hin-

Kriteria2   Ditemukan                   gejala berikut lanpa
                     salah'safu.'diintara
            penyebab
                   lain:

             dema.m(r 38" C)
             menggigil
             hipotensi

            dan
            paling sedikitsatudari berikui :

            1)-   Kontaminanlqiiit biasa (mis., Drpthe roids, Eacillus sp.,
                  porionibaderium sp, coagulase negative staphy
                  loacci ataumicrococcy'ditemukan dari dua kali atau
                  lebih biakandarah yang diambil dari waktu yang
                  berbeda

            2). Kontaminan biasa(mis-,Dpth eroids,Bacillus sp-,
                            kulit
                prorionibacleriufr sp, coagulase negative staphy
                lococci,atauni crococcr)d itemukan dari paIing sedikit
                satubiakandarah pasiendengansaluranintravas
                                  dari
                kuler,dan doktermemberikanterapi antimikrobial
                yang sesuai-

                          positifpada darah (mis.,H. influenza,S.
            3). Testantigen
                Pneumoniae, meningitrdis
                            N.            atau group B Strepto-
                coccus)
                                                               54
            dan
            Tanda{anda, gejala-gejaladan hasil laboratorium yang
            positif tidak berhubungandengan suatu infeksi ditempat
            lain.

Kriteria3   pasien berumur>1 tahun dengan paling sedikitsatutanda-
            tanda dan gejala-gejalaberikut:

            -   demam (t 38'C)
            -   hipotermi < 37'C)
            -   apnea
            -   atau bradikardia

            dan
            1). Kontarninan                               Baciltussp.,
                             kulitbiasa (mis., Drptheroids,
             '' prorionibacterium sp,, coagulase negative siaphy
                lococci, alau micrococcy' ditemukan dari dua kali atau
                lebih biakan Carah yang diambil dari waktu yang
                berbeda-

            2). Kontaminan kulit biasa (mi-, DiptheroiCs, Bacillus sp.'
                prorionibacterium sp., coagulase negative staphy
                locccci, alau m;crococci) ditemukan dari paling sedikit
                satu biakan darah dari pasien dengan saluran inh"avas
                kuler,dan doktermemberikanterapi anti-mikrobialyang
                sesuai.

            3). Test antigen positifpada darah (mis., H- inflttenzae,S'
                 Pneumoniae, N- meningitidis atau group B Streptococ'
                 cus).

            dan
            Tanda-tanda,   gejala-gejala
                                       dan hasil laboratorium yang
            positif tidak berhubungandengan satu infeksi di tempat
            lain-
PetunjukPelaporan

" Laporkan phlebitispurulent
                           dengankonfi;rnasibiakan          yang
                                                semikuantitaiif
  positifdari ujungkateter,
                          tetapi
                               cenganbiakandarahnegatifatau tidak
  dilakukanbiakan  sebagaiBSI-LCBI.

'   Laporkankumandari biakandarahsebagaiBSI-LCB|bila tidak terdapat
    buktiadanyainfeksidi
                       tempatlain
.   Pseucjc.\acteriemia
                     bukanmerupakan
                                  infeksin6sokomial_

Laboratorium.                                  '

Untukorangdewasadananakumur> 12 tahun

Diiemukan
        satudiarrtar:r-2
                       krit'eria
                              berikut
                                    :'

a - Kum a n p a togendari biakancJarah n k u ma n re rs e b u tt id a k a d a
                                      da
    hubungannya   den-oan
                        i;rfeksi tempatlain.
                               di

b. Ditemukan          gejala
           satudiantara     klinisberikut:

    -    de r r r a r n ( >S B 'C)
    -    rnenggigi!
    -    hipotensi
    -'   oliguri

    dan satudi ahtaratandaberikut
                                :

    1)- Terdapat  kontaminankutitdan 2 biakan berturut- turut dan kuman
        tersebuttidak ada hubungannya  dengan infeksicii tempat organ /
        jaringan lain.

    2).Terdapat kontaminan daribiakan
                          kulit         darahpasi:.:-yangmc-ngEunakan
       alal intravaskuler
                        (kateterinlravena)dan dokter telah memberikan
       antimikroba yangsesuai degansepsis.

    Untukba yi< 12 bulan,
                        ditemukan cian t a ra e ia ra e rik u :
                                safu        o       b         t

                                                                          .s6
         -   demarn{t 38" C)
         -   hipotermi( < 37" C)
         -   apnea
         -            <10O/menii.
             bradikardi

         dan salu diantaratanda berikut :

         1). Terdapat kontaminan kulit dari 2 biakan berturu-turut dan kuman
             tersebut tidak ada hubungannya dengari infeksi di tempat I organ I
             jariangan)lain-

         2). Terdapatkontaminankulitdari biatjn darah pasien yang menggunakan
                              (kaleter intravena)dan kateter telah memberikan
             aiat intravaskuler
             antimikroba yang sesuaidengan infeksi.
     -Catatan
             :

     Untuk neonatus         infeksinosokomial
                  drgolongkan              apabila :

     '   Pada partusnormaldi rumahsakit infeksilerjadisetelah lebih dari 3 hari.
     '   Terjadi3 hari setelah partus patolcgik,tanpa didapatkan pintu masrlk
         kuman
     .   Pintu'masukkuman jelas, misalnyaluka infus-

     Faktor Resiko lnfeksi Aliran Darah Primer

     a. Pemasangankaleter intravena(l.V) yang berkaitan dengan :

         . jenis kanula
         . metode pemasangan
         . larna pemasangankanula

     b. Kerentananpasien terhadap infeksi.

     Petunjuk Pengembangan Surveilans lnfeksi AliranDarah Primer

                 kateterintravena
     a. Pemasangan               (l.V)yang berkaiiandengan


57
   .   Jeniskanula
   .          pemasangan
       l'4etode
   .   Lama  pernasangan
                       kanula

            pasien
b. Kerentanan    terhadapinfeksi

Pencegahan lnfeksiAliran Darah Primen

PencegahanIADPteruiama                     dan perawatanlV.
                             padapernassngan
                     ditujukan

a. indikasi pemasanganl.V. hanyadilakukanuntuktindakan pengobatan
   dan atau untukkepentingan         (Kategori
                            diagnostik       l).    !

b. Pemilihan
           kanula   infusprimer
                untuk

  .    Kanulaplastik
                   bolehdigunakanuntukl.V.secararutin,per.nasangan
       tidakboleh
                lebihdari48-72jam(Kategorlll).

c. CuciTangan

  1). Cucitangan    dilakukan
                harus       sebelum        pemasangan
                                   melakukan        kanula
      (Ka'tegoril).

   2). Pada urnumnya  cuci tangancukup menggunakan sabun dan air
       mengalirtetapiuntuk pemasangankanulavena sentral dan untuk
       pemasangan        insisi, tangan
                   melalui     cuci    harusrnenggunakan antiseptik
 .     (Kategori
               l).

d- PemilihanLokasi        l.V.
                 Pemasangan

  Pada orangdewasa         kanulalebihbaik pada tungkaiatasdari
                    pemasang
  pada tungkaibawah, perlupemasangan
                    bila                     di
                                     dilakukan daerahsubklavia
  aiau jugular(Kategori
                     l).

e. Persiapan         l.V.
            Pemasangan

  1). Tempatyangditusuk/dipasangkanulaharusterlebihdahuludisinfeksi
                     (Kategori
      denganantiseptik      l).

                                                                5B
       2). Gunakan YodiumTinctur1-2"/"atau dapat juga menggunakan
                        lodoforataualkoholTA%
           klorheksidine,                    Antisepiikharussecukupnya
           dan ditunggu sampaikeringminimal detik sebelumdilakukan
                                            30
           pemasangan  kanula(Kategoril).

       3). Jangan menggunakan  heksaklorofen atau carnpuransemacam
                      dalamair untukdisinfeksitempat
           benzalkonium                            tusukan(Kategoril).

     t" Prosedursetelahpemasangan
                                f.V

                              padatempat
       1). Beri salepantiseptik        perrrasangan      pada teknik
                                                 teruianra
           insisi'(Kategori
                         l).

       2) . Kanuladifiksasi           (Kategori
                          sebaik-baiknya     !)-

       3)- Tutuolahdengankasa steril(Kategori
                                            l)-

       4). Cantumkan tanggal pemasangandi tempat yang mudafr dibaca
           (nrisalnyapada plasterpenutuppipa infus).Serta pada catatan pasien
           yang bersangkuian tuliskantanggaldan lokasi pemasangan(Kategori
           r).
     g. PerawatantempatPemasangan
                                l.V-

       i). Tempat tusukandiperiksa
                                 setiap hari untuk melihatkerrrungkinan
           timbulnyakomplikasi
                            lanpamembuka  kasapenuiup  yaitudengancara
           meraba daerahvenatersebut.

          Bila ada demamyangtidakbisadijetaskan ada nyeritekanpada
                                                  dan
          tem p at tusukan,barulahkasa p e n u t u p d ib u k a u n t u k me lih a t
          kemungkinan          (Kategoril).
                       komplikasi

       2). Bilakanulaharusdipertahankan untukwaktulama,makasetiap48-72
           jarn kasapenutupharusdigantidenganyang barudan steril (Kategori
           It) .

       3 ) . Bila a da waktu pemasangan u lat e mp a tp e ma s a n g a n ib e ri
                                       kan                              d
             antiseptik         penggantian penutup,
                       makasetiap        kasa         tempat  pemasangan
59
     diberiantiseptik     (Kategori
                    kembali       il).

h. Perrggantian
              Kanula

     1). Jika pengcbatan melalui
                        l.V.     infusperifer(baikmenggunakan heparirr
         atau yang dipasangmelaluiinsisiT, tidak ada komplikasi
                                         bila                    yang
         mengharuskan mencabutkanulamakakanula   harus            48-
                                                      digantisetiap
         72iam secaraasepsis(Kategoril).

     2). Jika penggantian                        yangbaik, maka harus
                                           aseptik
                        tidakmengikutiteknik
         digantisecepatnya (Kategori
                                   l).

i. Ka.nulaSentral

     1)- Kanuiasentral           denganteknik
                     harusdipasang                 (Kategori
                                             aseptik       l).

                     harussegeradilepasbila tidakdiperlukan atau
     2)- Kanulasentral                                    lagi
         diCugamenyebabkansepsis        l).
                                (Kategori

     3)- Kanulasentraldipasang  melaluivena jugulardan subkiaviakecuali
         digunakanuntukpemantauan  tekananvenasentral,tidaxha:usdiganti
         secararutin(Kategori
                            l).

     4)- Kanulasenlrat yang dipasangmelaluiu""" p"rif"r harusdiperlukan
         seperti kanulaperifertersebutdiatas (Kategori
                                                     l).

     5). Bila kanula sentraldipertahankan lebih lama,kasa penutupharus
 '       diperiksadan.digantisetiap48-72jam (Kategorill).

j. Pemeliharaan
              Peralatan

     1). Pipa l.V. termasukkanulapiggy -back harusdigantisetiap48 jam
         ( Kateg o r il).

     2). Pipayang digunakan
                          untuk hiperalimentasi         setiapZ,+i'-qa
                                             harusdiganti
         jam (Kategori
                     l).

     3 ). Pi pa yan g harusdigantisesudahmema n ip u la p ie mb e ria n a ra h ,
                                                        s             d
          produk-produk  darah,
                              atauemulsi     (Kategori
                                        lernak          lll).
                                                                           60
     4). Pada setiap penggantiankompbnensistem lV. harus dipertahankan
                                                          melalui pipa, ha;us
         tetap tertutup.Setiap kali hendak memasukkao']!Jat
         dilakukan Cisinteksisesaat sebe.lurn   memasukkan obat tersebut
         (Kategorill).

     5). Pengambilah bahan pemeriksaan darah melalui pipa l.V. tidak boleh
         dilakukan kecualidalamkeadaandaruratat"rupipa akan segara dilepas
         (Kategori ll).

k.       PenggantianKomponenSistemIntravenadalamKeadaanInfeksiatau
                                                  ' ,
         Flebitis.

         Jika dari tempat tusukan keluar pus atau terjadi selulitisatau flebitis
         tanpa gejalagejala infeksi pada tempat l.V. atau diciugabakleremia
         yang berasal-dari kanula,maka semuasistemharus dicabut (Kategori
         r)
l.       PemeriksaanUntuk Infeksiyang dicurigaikarena Inlravena.

         Bila dicurigai terjadi infeksi karena Pemasangan l.V- seperti
                      purulen,
         trombofiebitis       bateriemi.            pemeriksaan
                                        makadilakukan           biakan
         ujung kanula.

         Cara oengambilanbahan sebagaiberikut:

     .                                            dan disinfeksidengan
         1). Kutit tempat tusukan harus dibersihkan
             alkohol. biarkansampai kering.

         2).' Kanula dilepas,ujung kanuladipotong 1 cm secara aseptikuntuk
                                                 t
                                                    (kategorill).
              dibiakkan dengan teknik semikuanlitatif

         3). Jika sistem l.V. dihentikan oleh karena kecurigaan kontaminasi
             cairan, maka cairan haris dibiakkan dan sisa botol diarrtankan-.
             (kategoril).

         4). Jika sistem l.V.dihentikanoleh karenakecurigaanbakterimiakibat
             !.V. cairan harus dibiakkan (Kateqorill)
           5). Jikaterbukli
                         bahwa       terkkontam.nasi, si.a Uott danisinya
                                cairan            maka
               dengan nomorlot yangsamadengan            (KateEori
                                               yAngdicatat        l).

           6) Jikakontanrinasi                                   contami-
                                    berasaldari pabrik (instrinsic
                            dicurigai
              nation),maka secepatnyaharus dilaporkan kepaCaDinas
                       (
              KesehatanKategori l).

     m-    KendaliMutu
                     Selamadan Sesudah
                                     Pencampuran
                                               Cairanparenteral.

           1)- Cairanparanteral                               di
                                                 harus dicampur bagian
                               dan hiperalimentasi
              farmasikecualikarenakepentinganklinis,pencampuran
                                                              dilakukan
               diruarganpasien(Kategorill).

           2\. Tenagapelaksana harus mencuci tangan sebelum mencampur
                  cairanparenteral(Kategoril)-

           rr- Selrelum           menequnakan
                      mencarnDUrdan                         semua
                                             cairanDarenleral,
                  wadahha:'usdiperiksa untuk*iii ut adanya kekeruhan,  kebocoran,
                  keretakandan   partikel tertentu dan tanggal kedaluarsa.Bila
                  didapatkankeadaan tersebt.tt  cairan tidak boleh digunakan dan
                  lrarusdikembalikan bagianfarmasi dan dari bagianfarmasitidak
                                    ke
                  bolehdikeluarkan (Kategoril).

           4 ).    Ruangandi bagian farmasi tempat mencarrrpurcairan parenteral
                  lersebutharus memiliki pengatur udara laminer (laminarflowhocd.l
                  (Kategorill).

           5). Sebaiknya dipakaiwadah yang berisi cairan dengan dosis tunggal
               (sekalipakai)- Bila dipakai bahan parenteral dengan dosis ganda
                     beberapa kali pakai) dan sisanya untuk wadah harus diberi
               (untult
               tandatanggal dan jam dikerjakan.

           6). Label wadah harus diperiksa untuk mengetahui apakah perlu
               dimasukkanke dalam lemari es atau tidak.

5.   SEPSIS KLINIS ( Glinical Sepsis)

     Letak Infeksi : Sepsis Klinis
Kode          BSI-CSEP

Definisi     Sepsis klinisharusmemenuhipaling
                                            sedikitsatu dari
                    berikut
             kriteria      :

Kriteria i   Ditemukansalah satu diantara'gejalaberikut tanpa
             penyebab :
                    lain

             - Suhu >3BqC,
                         beftahanminimal 24 iam denganatau
               tanpapembarianantipiretika.

                               >
                       (sistolik 90 mm Hg)
             - Hipotensi

             - Oliguridenga,r jumlah
                                   urin(< 2Oml/ jam afau< 0.5cc /
               kg BB / jam ).

             dan
             Semua gejala / tanda yang disebut dibawah ini :

             1). Biakan darah tidak ditakukanatau tidak diketemukan
                 kuman atau antigendalam darah.

             2). f idak terdapattanda-tandainfeksiditempat lain.

             3). Teiahdiberikananiimikrobasesuai dengan sepsis.

Kiiteria 2   Ditemukanpada pasieri berumur 1 tahun paling sedikit satu
             gejala/tanda berikut tanpa diketahui ada penyebab yang
             lain :

             -   demam (> 38" C)
             -   hipotermia (< 37" C)
             -   apnea
             -   atau bradikardia < 100 x/menit-

             dan
             semua gejalaltandadibawah ini :

             1). biakandarah tidakdilakukanatau tidak diketemukan
                              kumanatauantigendalamdarah,

                           2). tidakterdapat
                                           ianda_tanCa
                                                     infeksiditempat
                                                                   lain.

                           3)- diberikan
                                       terapiantimikrobr
                                                       sesuai
                                                            crenqan
                                                                  sepsis.
      Petunjuk Pelaporan

      Laporkaninfeksialirandarahdengankufturyang positifsebagai
                                                               BSI-l_cBl

6.   OSTEOMYELIT|S

     Letak lnfeksi     : Osteomyelitis

     Kode               BJ.BONE

     Deiinisi           Osteomyelitisharus memenuhi syarai paling sedikit satr,r
                        kriteria berikut ini :

     Kriteria 1         TeiCapat
                               kumandari hasilbiakantuianc.

     Kriteria 2       : Terdapat bukli adanya osteomyeiitisyang ciiketemukan
                        pada pemeriksaan tangsung (direk) tulang pada waktu
                        pembedahanatau pemeriksaanhistopatologis

'    Kriteria 3       : pada pasien terdapatparingsedikit dua dari randa-tanda
                  I     dan gejala-gejalaberikuttanpa ada penyebab fainnya:

                       -    demam (> 38. C)
                       -    bengkak setempal
                       -    nyeri tekan
                       -    hangal, alau
                       -    terdapat drainase pada lempat yang dicuiigai infeksi
                            tulano.

                      dan
                      palingsedikitsafu dari berikut.


                                                                             64
                                                                                       j:sr
                                                                                       J;J
                                                                                       I -ij




                          1). Terdapat kurnan dari biakan darah.

                          2t. Test antigen darah posiiif (mi., H. lnfluenzae, S.
                                Pneuminae)

                          3). Bukti radiologis adanya infeksi, mis., tanda ab;ronnal
                                p?da x-rar,,CT-scan,MRl, radio label scan. (gallium,
                                technetirtrn,
                                            dll).


7.        SEl.lD!atau BURSA

          Letak infeksi     Sendiatau bursa

          Kode              BJ - JNT

          De fi nisi        Infeksisendi atau bursaharus paiing sedikitmentenuhi
                            satu kriteriaberikut:

          Krileria1         Terdapat
                                   kumandaribiakan
                                                 cairansendiatau biopsisyn-
      .
                            ovial-

          Kriteria2         Terdapat bukti adanya infeksi sendi atau bursa yang
                            terlihat pada waktu pembedaharratau pemeriksaan
                            histopatologis.

          Kriteria3         Pada pasien terdapatpaling seclikit duadari tanda-tanda
                            cian gejalagejala berikuttanpa ada penyebab lainnya :

                            -    nyeri sendi
                            -    bengkak
                            -    nyeritekan
                            -    hangat
                            -    terdapat effusiatau pembatasanger.X

                                dan
                                palingsedikilsatudariberikut
                                                           :


f,)
                       1). Terdapat kuman dan sel - sel darah putih pada
                           pengecatangram daricairansendi.

                       2). Testantigendarah, urine atau cairansendipositlf.

                       3)- Buktiradiologis
                                         adanyainfcksi,mis,tandaabnormal
                           pada X-ray, CT scan, MRl, radio label scan, (gal-
                           lium,technetium,dll-)


8.   RUANG DISCUS
                                                        ,
            a

     Letak infeksi   Ruangdiscus

     Kode            BJ-DISC                  :1

     Definisi        lnfeksidiscus vertebralisharus memenuhipalingsedikitsafu
                     kriteriaberikui :

     Kriteria 1      Terdapatkuman dari hasil biakan jaringan discus vertebralis
                     yang didapatpada waktu pembedahan aiau aspirasijarum.

     Kriteria2              bukli infeksidiscus vertebralisyang dilihatselama
                     Terdapat
                     pembedahanatau pemeriksaan histopatologis.

     Kriteria3       Pasien menderita demam (> 38. C) tanpa diketahui ada
                     penyebabatau nyeri pada ruang discus vertebraiis yang
                     terkena

                     dan
                     Tanda infeksi pada pemeriksaan radiologis X-ray, CT-scan,
                     MFll,radiolabelscan dengan gallium atau technetium.

     Krtiteria
             4       Pasien menderita demam (t 38o C) tanpa diketahui ada
                     penyebabatau nyeri pada ruang discus veftebralis yang
                     terkena



                                                                             66
                      dan
                      Testantigendarahatau urinepositif(mis. H lnfluenzae,
                                                                         S.
                      Pneumoniae, lvleningilidis,
                                  N.            atau grup B Strepiococcusl,


9.   INFEKSIINTRAKRANIAL

     Letak infeksi:   Infeksi           (abses
                             intrakranial     otak.infeksisubduralatauepidu-
                      ral, ensefalitis)

     {ode             cNS-tc

     Definisi         Infeksiintrakranialharus memenuhipaling sedikitsatu kriteria
                      berikut:
                                                                                     I
                                                                                     f
     Kriteria 1       Terdapatkurr,andari biakanjaringan otak atau durameter.             )
                                                                                         a

     Kriteria 2       Terdapatabses atau buktiadanya infeksi intrakranial
                                                                        yang
                                                                                     t
                      terlihat pada waktu pembedahan atau pemeriksaan                3
                                                                                     3
                      histopatologis.                                                3

                                                                                     =
     Kritei'ia 3      Pada pasien terciapat paling sedikit dua dari tanda{anda           -t
                                                                                         J
                      dan gejala-gejala berikut tanpa ada penyebab lainnya :         :=
                                                                                         -
                                                                                         {
                      -   nyeri / sakit kepala
                      -   pusing                                                         =
                                                                                         E
                                                                                         ta
                      -   demam (> 38" C)                                                .1
                                                                                         {
                                                                                         :
                      -   tanda-tanda neurologisyang terlokalisasi                       a
                      -   atau perubahan derajatkesadaranatau kebingungan                i
                                                                                          I


                                                                                         =
                                                                                         2
                      dan                                                                E
                                                                                         .E
                      bila diagnosis dibuat anternortem,dokter mulai memberikan          a
                                                                                         I
                      terapi antimikrobial yang sesuai                                   I

                                                                                         3
                                                                                         5
                      dan                                                                E
                                                                                         g
                      paling sedikit salu dari berikut :                                 *
                                                                                         a

                                                                                         E
                                                                                         q

                      1). Terdapatkuman pada pemeriksaanmikroskopisdari                  E
                                                                                         :l


                                                                                         F
67                                                                                       ii
                jaringano'.akatau abses yang diambildenganaspirasi
                jarumataubiopsipada waktupembedahan    atau auton.i

            2). Testaniigendarahatau urinepositif.
                              adanya infeksi,mis, tanda abnormal
            3). Buktiradiologis
                padaultrasound, scan, MRl.radionuclide
                               CT                     brainscan,
                atauarteriogram

            4). Diagnosticsingle antibody titer (lgM) atau kenaikan
                pairedsera(lgG)untuk pathogensebanyak    empat ka!i.

Kriteria4   Pasienberumur> 1 tatrun mendaoatpalingsedikit dua
            tanda-tanda gejala-gejala
                      dan            berikuttanpa ada penyebab
            lainnya:

            -          (>
                demam 38'C)
            -    hipbtermia (< 37'C)
            -   apnea
            -   bradikardia
            -   tanda-tandaneurologis yang tedokalisasi
            -   atauberubahan  derajat kesadaran

            dan
                          dibuatanten:ortern,dckter mulai memberikan
            Eiia ciiagnosis
            terapi antimikrobialyang sesuai

            dan
            pralingsedikit satu tJari berikut :

            1). Terdapatkuman pada pemeriksaan mikros kopis dari
                jaringanotak atau abses yang diambil dengan aspirasi
                iarum atau biopsipada waktu pembedahan atau autopsi

            2)" Test antigen darah atau urine positif

            3). Bukti radiologis adanya infeksi, mis, landa abnormal
                                                       brain scan,
                 padaultrasound, scan, MRl, radionuclide
                                 CT
                 atau arteriogram.

                                                                 6S
                       4)- Diagnostic singleantibodytiter (lgM) atau kenaikar.
                           p'::ed sera(lgG)untukpathogen  sebanyak ernpat
                                                                        kali.
      Pe tun ju kPelaporan:

     Sila terdapatmeningtis absesotakbersamaan,
                          clan                laporkan
                                                     infeksisebagai
     lc-

 10. MENINGITISatau VEt\tTRtKULtTtS.

     Letak infeksi :    Meningitis
                                 atau ventrikulitis

     Kode               CNS-MEN

     Definisi           Meningitis atauventrikulit!s
                                                  harusmernenuhi
                                                               palingsedikit
                        safu kriteriaberikui :

     Kriteria 1    :   lerdapat kuman cari biakan cairan serebrospinar
                                                                     (csF).

     Kriteria 2    :   Pada pesien terdapatparingsecikit satu daritanda-tanda
                       dan gejala-gejaiaberikuttanpa ada penyebab tainnya:    i

                           demam(>.39"     C)
                       -   nyed/ sakitkepala
                       -   kakukuduk
                       -   meningealsigns
                       -   cranialnervesigns
                       -   atau irritabilitas

                       dan
                       bila diagnosis dibuat anternortem, dokter mulai
                       memberikanterapi antimikrobial
                                                    yang sesuai

                       dan
                       paling sedikit satu dari berikut :

                       1). Sel-sellekositmeningkat,
                                                  peningkatan
                                                            proteindan /
o9
                              glukosadi CSF
                 irtaupenurunan

             2). Kurnanterlihatpada pengecatanGranrdari CSF

                        kurnandari biakandarah
             3). Terdapat

             4). TestantigenCSF,darah atau urine positif

             5). Diagnosticsingle aniibody titer (lgM) atau kenaikan
                 pairedsera(lgG)untukpathogen    sebanya.kempat kali.
                                                                  a


Kriteria.3   Pasien'berumur< 1 tahun mendapat paling sedikit salu
             tanda{anda dan gejalagejala berikut tanpa ada penyebab
             lainnya:

             -   demam (> 38" C)
             -   hipotermia(> 37" C)
             -   3pnea
             -   bradikardia
             -   meningealsigns
             -   cranialnerve signs
             -   atau iritabiiilas

             dan
             bila diagnosisdibuat antemortem, dokter rnulaimen:berikar:
             terapi antimikrobialyang sesuai

             idan
             lpaling sedikit satu dari berikut :

             1). PemeriksaanCSF positif dengan peningkatansel-sel
                 lekosit, peningkatan protein dan atau penurunan
                   glukosadi CSF.

             2). Kumanterlihatpada pengecatan
                                            Gramdari CSF.

                        kumandari biakanciarah.
             3). Terdapat


                                                                      10
                        4). TestantigenCSF darahatau urinepositif.

                        5). Diagnostic
                                     singiearrtibody
                                                   iitei (tgtvr;
                                                               atau kenaikan
                            paired
                                 sera(lgG)
                                         untuk pathogen  sebanyak empatkali"

      PetunjgkPelaporan:

        Laporkan meningitis  pada neonatussebagainosokomialterkecualibila
        terdapat bukti kuat yang menunjukkanbahwa meningitistelah dicapat
        secara transplacental.

        Laporkaninr,jruicsF shunt(v-Pshunr)
                                          sebagai
                                                sst-MEN uilater;aoinya
                                                                     t
        tahunpemasangan, lebihtama.laporkan
                          bila                sebaga.i
                                                     CNS-MEN.

        Laporkanmeningoensefalitis   MEN
                               sebagrai

        Laporkan
               absesspinal
                         denganmeningitis
                                       sebagai
                                             MEN,


,t.   ABSES SPINAL tanpa MEN|NG|T|S.

      l-etak infeksi   Absesspinaitanpanreningilis

      KoCe             CT{S-SA

      Definisi         Abses spinal paciaruangepiduralatau subdural,tanpa
                       melibatkancairan serebrospinal
                                                   atau strukturtulanqyang
                       berdekatan,harus memenuhi  paling sedikitsatu kriteria
                       berikut:

      Kriteria1        Terdapatkuman dari biakanabses pada ruang spinalepi-
                       duralatausubdural-

      Kriteria2        Terdapatabses pada ruangspinalepiduralatau subdtna!
                       yangterlihat
                                  padawaktupembedahan autoosi
                                                      atau       ataubukti
                       adanyaabsesyangtedihatpadapemeriksaan histopatologis.



tl
   Kriteria3        : Padapasienterdapat  paringsedikitsatu dari tanda-tanda
                      dan gejala-gejala     tanpa a.dapenyebablainnya:
                                      berikut

                      -   demam( t 3B.C)
                      -   nyeri/sakitbagianbelakang(back pain)
                      -   nyedtekanfocat
                      -   radiculitis
                      -   paraparesis
                      -   atauparaplegia

                      dan
                      biladiagnosisdibuat
                                        antemortem,doktermulaimemberikan
                                       yang sesua:
                      terapiantimikrobial

                      dan
                      palingsedikitsaludari berikut:

                      1). Teidaparkumandaribiakan darah

                      21. Bukti radiologisadan;ra abses spinal, mis, tanda ab-
                          normalpada mvelografi,ultrasound,CT-scan,N4Rl,   atau
                          scanning-scanning yang iain (mis, gallium,technetiunr)-

   Peiunjuk Pelaporan:

   Laporkan abses spinaldengan meningitissebagai MEN.

                i

12. INFEKSIARTERIAL
                  atauVENOUS

   Letak inveksi Arterialatau
                            venous

   Kode               CV.S.VASC

   Definisi                 aderialatauvenousharus memenuhipalingsedikit
                      Infeksi
                      satukriteriaberlkut:

   Kriteria1          Terdapat                 dari arleriatauvenayang
                              kumanyangdibiakkan
                           padawaktu
                      diambil        pembedahan                     .,.,
                dan
                biakan ciarah irdak dilakukan atau tidak diaaoalkan kumarr
                dari biakan darah.
 Kriteria 2   : Terbuktiadanya irf;ps1 arteriatau vena yang tertihatpaca
                 waktupembedahanataupemeriksaanhistopatologis.

 Kriteria3    : Pasien menderitapalingsedikitsatu dari tanda-tanda
                                                                 dan          :
                gejala-gejala berikut tanpa ada penyebab lainnya :

                    demam (> 3BeC)


                - iliH"sar pada   yang
                              daerah rerkena
                 dan
                .lebihdari r 5 kolonikumanyang dibiakkan
                                                       dari ujungkanrrla
                 intravaskulerdengan menggunakanmelode pembiakan
                  emikuantitatif

   '            dan
                biakan darah tidak dilakukan atau tidak dioaoatkan kuman
                dari biakan darah.

Kriteria 4    : pasien menderitadrainase purulent pada daerah vaskuler
                yang terkena.
       '
                dan
                biakan (arah tidak dilakukan atau tidax didapatkan kuman
                daribiakan darah.


Kriteria 5    : Pasien berurnur > 1 tahun menderita paling sedikit satudari
                tanda-tandadan gejala-gejalaberikuttanpa ada oenyebab
                lainnya-:

                -   demam (> 38'C)
                -   hipotermia(< 37" C)
                -   apnea
                     bradi.<ardia
                     lethargi
                     atau nyeri pada daerah vaskuler yang terkena

                   dan
                   lebihdari15 koloni
                                    kumanyang dibiakkandari uiungkanula
                   intravaskulerdenganmenggunakanmetode pembiakan
                   semikuantitatif

                   dan
                                            atau trdakdidapatkan
                   biakandarah tidakdilakukan                   kuman
                   dari biakandarin.

   PetunjukPelaporan

   . Laoorkan  infeksipada                shuntatau fistulaataukanulasi
                          graftarteriwenous,
    ' intravaskulertanpa ketemukankuman biakandarahsebagai
                       di                dari                    CVS-
      VASC.

   . Laporkaninfeksiintravaskuler
                               dengan          kuman cjaribiakan
                                     diketemukan
     darahsebagaiBSI-LCBI.


13. ENDOCARDITIS

   Letak infeksi              padakatupiantungalamiah atau prosthetik.
                   Endocarditis

   Kode                       pada katupiantung alamiah atau prosthetik
                   Endocarditis
                   harusmemenuhi palingsedikitsatu kriteriaberikut:

   Kriteria               kumanyangdibiakkan
                   Terdapat                 dari katup atau vegetasi.

   Kriteria        Padapasien         duadantanda-tanda gejala-gejala
                               terdapat               dan
                   b:;ikut tanpaada penyebab
                                           lainnya :

                   - demam(>38'C)
                   - bising(murmur)
                                 baruatau berubah
                   - fenomena embolik
                                                                     '1 .i
                        manifeslasikulit (yaitu, peieuhiae,splinterhemorrhage,
                        nodul subkutan yang nyeri)
                        payah jantung kongestif
                   -    atau kelainankonduksijantung

                   dan
                   bila diagnosis dibuat antemortem, dokter mulai memberikan
                   terapi antimikrobiatyanE sesuai

                  dan
                  paling secjikitsatu dari berikut :

                   1). TerdapatHuman dari duaafaulebih biakan darah.
                      .
                  2). Terdapatkumanyana terrihat   dengan pengecatanGram
                      dari katup,bila hasilbiakannegatifatau tidakdiker;akan.

                  3)- Vegetasivarvurer
                                     yang terrihat
                                                 pada waktu pembedahan
                      atau atrtopsi.

      .           4). Test antigenpositif dari darah atau urine (misarnya,H.
                      influenzae, S- pneumoniae, N- meningitlCis.afau grcup
                      B. S.treptococcus).

                  5). Buktiadanya vegetasi baru pada echocardiogram.

    Kriteria3   : pada pasien berumur > 1 tahun terdapat dua dari tanda-
                  tanda dan gejaragejata berikut tanpa ada penyebab rainnya:

                       demam (> 38. C)
                       hipotermia(< 37e C)
                       apnea

                  - 3fi:5?fJ?mur) arau
                              baru berubah
                       fenomena embolik
                       nianifestasikulit (yaitu, petechae, splinter hemorrhage,
                       nodul subkutan yang nyeri)


)
                 . :ff lJilH'_:"*X?:ll"n,,n
                                   g
                      dan
                      biladiagnosis
                                  dibuatantemortem, doktermulairnen:5*-i<=-
                                        yang sesuai
                      terapiantemikrobia!

                      dan
                      paiingsedikitsatudari berikut:.

                      1). Te,dapatkumandan dua atau lebih biakandarah.

                      2). Terdapat kumanyangterlihat  ciengan pengecatan  G=-
                          dari katupbila hasilbiakannegatifatau tidakdikeriaer.

                      3). Vegetasivalwler yangterlihatp^U. w"Ltu pemberJai-:-
                          atau autopsi.

                      4). Testantigen positif                            --
                                            daridarahatau urine(misalni,=,
                          influenzae,S. pneumoniae,N. meningitidis,
                                                                  atauo*=-:
                          B. Streptocrccus)-

                      5). Buktiadanyavegetasibaru pada echocardiogram.


14. MYOCARDITISatauPERICARDmS

  Letak infeksi       Myocarditisatau pericarditis

  Kode                CVS-CARD
                  I


  Definisi            Myocarditis                 harus memenuhipalingse:\-t
                                   ataupericarditis
                      satu kriteriaberikut:

  Kriteria 1          Terdapat kumanyang dibiakkandari jaringan pericard:'>
                      cairanyang diambildenganaspirasijarumataupadanac-
                      pembedahan.

  Kriteria2           Padapasienterdapatduahrttanda-tanda dan gejala€+ja€
                            tanpaada penyebab
                      berikut                 lainnya:
            - nyeridada
            - pulsusparadoksus
            - ataupembesaraniantung

            dan
            palingsedikitsatudari berikut:

            1). EKG abnormalyang sesuai dengan myooarditisatau
                pericarditis-

                                                                 S.
            2). Testantigenpositifpada darah (mis., H. lnfluenzae,
                pneumonia)-

            3)- Bukti adanya myocarditisatau pericarditis pada
                pemeriksaan         jaringaniantung.
                           histologis

            4). Kenaik,en      Vpe - specificsebanyakempatkali
                        antibodi
                denganatau tanpa isolasivirus dari pharynxatau fe-
                ces.

                              padaechocardiogra:ir, scan,MFil,
            5). Efusipericardial                CT
                atau angiography.

Kriteria3   Pada paslen berumur> 1 tahun te:'dapatdua dari tanda-
                                      tanpaada penyebab
            tandadangejalagejalaberikut                  iainnya:

                demam (t 38oC)
                hipotermia(< 37oC)
                apnea
                bradikardia
                pulsusparadokus
                atau pembesaranjantung

            dan
            paling sedikit satu dari berikut

            1)'EKG
                 abnorl"'
                      runn;;;""?,ifftr#,n*'t'satau
                        pericarditis.

                    2). Testantigenpositifpada da.rah  (mis..H. lnfluenzae,S-
                        pneumonia).
                    3). B ukti adanyamyo c a rd it isa t a u p e ric a rd it isp a d a
                        pemeriksaan          jaringanjantung.
                                    histologis

                    4)- Kenaikan       type - specificsebanyakempat kali
                                antibodi
                        denganaiautanpa'lsolasivirus pharynxatau feces-
                                                   dari

                    5). Efusipericardialpad:i             CT
                                            echocardiogram, scan, MRI
                        atau angiography.     '

   Catatan
   Kebanyakan           pascabedahjantungatau pasca infark miokard
              kasus-kasus
   bukaninfeksius.


15. MEDIASTINITIS

   Letak infeksi    Mediastinitis

   Kode             CVS.MED

   Definisi                     harus memenuhipalingsedikit salu kriteria
                    Mediastinitis
                    berikut:

   Kriteria,        Terdapatkumanyang dibiakkandari iaringan mediastinal
               .,   atau cairanyangdiambildenganaspirasijarum atau pada
                    waktupembedahan.

   Kriteria2         Terdapat bukti media s t in it is y a n g t e rlih a t s e la ma
                                 atau pemeriksaan    histopatologis.
                    -Rembedahln
   Kriteria3         Pada pasienterdapatpalingsedikitsafudari tanda-tanda
                     dan gejala-gejala    tanpaada penyebab
                                    berikut                            lainnya:

                    - demam(> 38"C)
                    -   n y e ri d a d a
                                                                                    ra
                                              l.etidakstabilansternum

                    dan
                    paling sedikit satu dari berikut :

                     1). Dischargepuiulentdari daerah mediastinal.

                    2). Terdapat kuman dari biakan darah aiau cairan yang.
                        keiuar dari daerah mediastinal"

                                                   x-ray.
                    3). Pelebaran nretliastinum,p?da

     Kriteria4    '. Pada pasien berumur1 tahunterdapat dua daritanda{anda
                     dan gejala-gejalaberikuttanpa ada penyebab lainnya:

                         demam(>38"C)
                         hipotermia(<371C)
                         apFea
                         bradikardia
                         ketidakstabilan mum
                                       ste

                     qart
                     paling sedikit safu dari berikut:

                     -   Dischargepurulentdari daerah mediastinal
                     -   Terdapatkumandari biakandarah alau cairan yang keluar
                         dari daerah mediastinal
                     -   Pelebaran mediastinumpada x-ray.

Petunjuk Pelaporan

                     setelah bedahjantungyang disertaiosteomyelitis
Laporkan mediastinitis                                             sebagai
SSI-MED dan bukan SSI-BONE-


16. CONJUNCTIVITIS

     Letak infeksi : Coniunctivitis

19
    Kode             EENT-CCINJ

    Definisi         Conjunctivitis
                                  harus memenuhi
                                               paling sedikit satu kriteria
                     berikut
                           :

    Kfiteria 1       Terdapat kumanpathogen   yangCibiakkan     dari eksudatpu-
                     rulent yang diambil dari coniunctivaatau jaringan yang
                     berdekatan,seperti p e lu p u kma t a , c o rn e a , k e le n ja r
                     meibomian, ataulacdmalis.

    Kriteria2        Terdapatkemerahanpada conjunctivaatau sekitar rnata
                     pasien

                     dan                               ..                       .
                     paling sedikit safu dari berikut :

                     1). Lekositdan kumantamoakpaCapengecatanGiam ciari
                         eksudat-

                     2). Eksudat purulent-

                     3). Tesi antigen positif (mis-,ELISA aiau iF untuk Ctamydia
                         trachomatis, virus herpes simpiex, a<Jenovirus) pada
                         eksudat atau conjunctivalscrapoing.

                     4). Tampak multinucleated
                                             giant cells pada perneriksaan
                                                 conjuctiva scrappins'
                                                         atau
                 i   s). ;:""     ;t-H"
                     6). Kenaikan diagnostic
                                titer         single
                                                   antibody
                                                          (lgM)sebanyak
                         empatkali padapairedsera(lgG)untuk kumanpatho.
                         gen.

Petunjuk Pelaporan

.   Laporkaninfeksimata
                      yanglainsebagaiEyE.


                                                                                    80
 '   Ja.rgan melaporkan conjuctivitiskimiawi (che mic.tl conjunctivitislakibat nitrat
     perak (AgNO.)sebagai infeksi nosokomia!

 '   Jangan melaporkan conjunctivitis
                                    yang timbul sebagai bagian ciaripenyakit
     virus yang meluas (seperticampak,cacar air. atau Upi). ,


 17. M ATA       (Selain conjunctivitis)

     Letak               Mata, selainconjunctivitis
                              t

     Kode                EENT-EYE

     Definisi            lnfreksipada mata, selain conjunctivitis,harus memenuhi
                         paling sedikit satu kriteria berikui :

     Kriteria1          Terdapatkuman pathogenyang dibiakkandari cairanvitre_
                        ous pada kameraanteriordan posterior.

     Kriteria2        : Pacrapasien terdapat paring sedikit due dari tanda-tanda
                        dan gejala-gejalaberikuttanpa ada pen;.ebablainnya:

                        -   nyeri pada mata
                        -   gangguan penglihatan
                        -   atau hlpopion

                        dan
                        pafing sedikit satudari berikut:

                        1). Dokter mendiagnosasebagai infeksi mata,

                        2'). Test antigen positif dalam darah (mis., H. lnftuenzae,S.
                             Pneumoniae).

                        3). Diketemukankuman daribiakari darah.




8l
;8. TELINGA,MAgTOID.

  Letak ini-ksi   : Telinga,
                           mastoid

  Kode            : EENT-EAR

  Definisi             Infeksipada telingadan rnastc*J
                                                     harus memenuhikriteria
                       berikut:

                       Otitis eksterna harus mernenuhi
                                                     paling sedikit safu dari
                       kriteriaberikui:
                                                               .
                                                                 ,
                       Kriteria1 : Terdapaikunranpathogen  yangdibiakkan dari
                                            purubntdari salurantelinga-
                                     drainage

                       Kriteria2   : TerdapatpalinEsedikit
                                                        safu dari landa.tanda
                                     dangejala-gejata
                                                   berikut tanpaaCapenyebab
                                     yanglainnya:

                                     -   demam (> 38eC)
                                     -   nyeri
                                     -   kemeraha't
                                     -   atau dralnasedad saluran telinqa

                   '                 dan
                                     terdapat kuman yang terlihat dengan
                                     pengecatanGram pada drainage purulent

                   Otitis media harus memenuhipalingsedikit satudari kriteria
                   berikut :

                   Kriteria
                          1        : Terdapatkunnn yang dibiakkan dari drainage
                                     purulentdatitefrrqa tengah (middle ear)yang
                                     diambil denoan cara tympanocentesis atau
                                     pada waktu penbedahan-

                   Kriteria
                          2        : terdapatpalirg sedikit satu dari tanda-tanda
                                     dan gejalageph berikuttanpa ada penyebab

                                                                              S]
                                                                             i


                                                              E
                                                              sl
                                                              a
                                                              ir
                                                              -i
                                                               't
                                                               i


               yang lainnya :                                  ri
                                                                   '|'
                                                               .l



               - demam( > 38" C)
               -  nyeripada gendang teiinga                        f

                                                              j
               -  inflamasi
                                                              g
               -         atau penurunan mobilitasgendang
                  retraksi                                     I
                                                               ;l
                 telinga                                           {
                                                                   Y
               - atau cairan dibelakanE gendang telinga
                                                                   ]
               - atau drainasedarisaluran                          '_!
                                                                        a
                                                                    .1
Otitis interna harusmemenuhipalingsedikit saiudari kriteria        .1

berikut :
                                                                   =
                                                                   I
                                                                   1
Ktieria I    : Terdapatkr:rnan yang dibiakkan dari cairan
                                                                   -
               bagiandalamtelingayang dianrbilpada waktu
               pembedahan-                                         =
                                                                   =g


                                                                        i
Kriteria2    : DoKer mendiagnosasebagai infeksi bagian                  !
               dalamtelinqa.                                           +
                                                                       :
                                                                       ..1


                                                                       :
tulastoiditisharusmemenuhipaiingsedikit-salucjarikriteria               i
                                                                       .l

berlkut :                                                              3

Kriteria 1   : 'lerdapatkuman yang dibiakkan dari drainage
               purulentdari mastoid.

Kriteria 2   : Terdapatpaling sedikit satu dari tanda-tanda
               dan gejala-gejalaberikut tanpa ada penyebab
               yang lainnya:

              .- demam(>3BoC)
               - nyeri
               - nyeri tekan
               - erilema
               - sakit kepala
               - atau paralisisfacialis
                      dan
                      puii"g sedikitsatu dari berikut :

                                 kuman pada pengecatanGram dari bahan-
                      1). Terdapat
                          bahanPur-rlent mastoid'
                                       dari

                      2). Testantigenpada darahpositif'


                                              gusi)
19. RONGGA MULUT (mulut'lidah'atau

   Letak infitsi    : Ronggamulut(mulut'liUah'atau gusi)
                                                                    -
   Kode              : EENT-OML
                                                           palingsedikit
   oefinisi          : lnfeksipada ronggamulutharus memenuhi
                       salu dari kriteriaberikut:

    K r i te r ia l:Terdapatkumanpathogen y a n g d ib ia k k a n d a rib a h a n p u ru -
                         lent dariiaringanatau ronggamulut'

                                     absesatauterdapat  buKi adanyainfeksi
    Kriteria2        : Pasienmenderita                          langsung'
                       ronggarnulutyang terlihatpada pemeriksaan
                                           atau selama pemeriksaanhistopa
                       setamapemoeoalian,
                       tologis-

    Kr i te r ia 3 :T erdapatpa|ingsedikitsat u d a rit a n d a . t a n d a d a n g e ja la .
                                       tanpa ada penyebabyang lainnya:
                          gejalaberit<ut
                       l
                           - abses
                                                        padamukosa
                           . :[TXllrcak putihvansrnenonjol       vans
                             mengalamiinflamasi
                           - atauPlaquePadamukosamulut

                           dan
                           paling sedikit satu dari berikut :


                                                                                            Lr --
                                                                                        q
                                                                                        x
                                                                                        a


                                 kuman padapengecatan
                      1). Terdapat                  Gram.
                                                                                        {
                                                                                        i
                      2i. PengecatanKOH (poiassium         positif.
                                                  hydroxide)

                      3). Multinucleated gian t c e lls y a n g t e r! ih a l p a d a
                          pemeriksaanmikroskopik kerokanmukosa.

                      4). Testantigenpada sekresioral positif.

                      5). Kenaikan diagnostic
                                  titer          single       (lgM)sebanyak
                                                       antibody
                          empat kali pada ppiredsera(lgG)untukkumanpathc-
                          gen.

                      6). Dokter mendiagnos a in f e k s i d a n me mb e rik a n
                          pengobatan
                                   denganantijamur    topikal  atauoral.

  F e t u n ju k Pela p oran

  Laporkaninfeksi nosokomial
                           herpesvirusprimersebagaiOPAL;
                                                      infeksi
                                                            herpes                      I



  virUsrecurrerlt
                bukaninfeksinosckomial                                                      I
                                                                                            'l

                                                                                        5
                                                                                            I
                                                                                            a

O. SI N USITIS                                                                              I
                                                                                            f
                                                                                                 I
                                                                                                I
                                                                                                I
  Letak infeksi       Sinusitis                                                                 a




  Kode                EENT-SINU

  Definisi            Sinusitis harus memenuhipraling
                                                    sedikit safu dari kriteria
                      berikut:

  Kriteria1           Terdapat   kumanpathogen
                                             yangdibiakkan       puru-
                                                         daribahan
                      lent dari ronggasinus.

  Kriteria2           Terdapat paling sedikit safu dari tanda-tandadan gejala-
                      gejala berikOt
                                   tanpa ada penyebab    yang lainnya:

                      -    demam( t 38'C )
                          nyeriataurryeri
                                        tekanpadadaerahsinusyanglei-kena
                      -   sakit kepala
                      -   eksudatpurulent
                      -   atau penbuntuanlubanghidurrg

                      dan
                      palingsedikitsatudari berikut:

                      1). Transilluminasi
                                        positif
                      2I- Pemeriksaan           positif
                                      radiografis


21. INFEKSISALURANNAPASATAS.
    Pharyngitis, !_a
                   ryngitis,€pigtoflitis.

    Letak infeksi : -'lnfeksisaluran
                                   napas atas.pharyngrtis,
                                                         laryngitis,
                                                                   epiglotti:is

    KoCe           : EENT-UR

    Definis          Infeksi saluran napas atas harus memenuhi paling sedikil
                     salu dari kriteriaberikut :

    Kriteria 1     : Terdapat paling sedikit dua dari tanda-tanda dan gejala-
                     gejala berilorttanpa ada penyebabyang lainnya :

                     -    demam(r38.C)
                     -    eritema
                     -    nyeripharynx,tenggorok
                     -    batuk
                     -    suara serak

                     cian
                     paling sedkit satu dari berikut :

                     Terdapatktrnan pada pembiakandaritempat yang spesifik

                     1). Terdapatkuman dari biakan darah.


                                                                           E6
                                                                               {
                                                                               ;
                                                                               il

                2). Test antigenpada darahatau sekrusiinfeksisaluran
                    napas atas Positif-                                        I
                3)l;;1ii:,ll'ji:Tff
                              ::"":::l:il'??1Jl;ilI::'il,I"j
                                                                               1   J
                                                                                    t
                                                                                    I
                                                                                   t
                                                                                   1
                     gen-                                                      g.
                                                                               {
                                                                               :l
                4). Dokter mendiagnosa infeksi dan memberikan                  iI
                    pengobatan dengan antibiotika.                                 {
                                                                               -l
                                                                               ',il
                                                                                   -i
Kriteria 2    : Terdapat abses yang terlihat pada perneriksaan langsurig..         g
                                                                                   3
                selama pernbedahan,atau pemeriksaanhistopatologis.         '       t
                                                                                   3
                                                                                   aa
                                                                                   .I

Kriteria 3    : Pada pasien berumur 1 tahun terdapat dua dari tanda{anda           ?

                 dan gejala-gejataberikuttanpa ada penyebab iainrya :              I
                                                                                   =
                                                                                   =
                                                  :
                             (
                     ,Jemarn t 38" C;                                               g


                                                                                   -t
                     iripotermia(<37'C)
                                                                                   =
                                                                                   =
                :--. apnga
                                                                                   t
                                                                                   e

                 - il:ili?iliroi."n",s"1                                           =
                                                                                   :
                                                                                   a
                    atau eksudatpurulenditenEgorok                                  a
                                                                                    J
                                                                                    g

                 dan                                                                   5
                                                                                       i
         .       paiing sedikit saru dari berikui :                                     i
                                                                                        :t
                                                                                           :l

     .           1). Terdapat kuman pada pembiakan dari tempat yang                        t

                     spesifik-

                 2). Terdapat kuman daribiakan darah.

                 3). Test antigen pada darah alau sekresi saluran napas
                     positif.

             ' -
                 4). Kenarkantiterdiagnosticsingleantibody(lgM) sebanyak
                     empat kali pada pairedsera (lgG) untuk kuman patho-
                     gen-
                 5). Doktermendiagnosa
                                     infeksisalurirnna:e.: :--


22. GASTROENTERITTS

  Letak Infeksi : Gastroenteritis

  Kode         : GI-GE

  Definis!        Gastroenteritis  harus memenuhipaling s::,:'.: -..::-.
                                                                       dari
                  kriteriaberikut:
                                                     ,
  Kriteria1      Pasienmendapat   seranganakutdiarrhea (b=re<
                                                            =-r
                 lebihdan 12 jam) denganatautanpa munta: :-=- :€rnam
                                                                -iama
                 (>38o danta,npal'.rya
                       C)              penyebab bukanncir::gs- .nis..
                 test diagnostik,
                                regimen terapeutik,eksase:l=, :.--: dari
                 keadaankronis,atau stres psikologis).

  Kriterla2      Terdapatpaling sedikit duadari tanda-tai:a     _::jala-
                             tanpaada penyebab
                 gejalaberikut                              ---
                                                  yangla:--..:

                  -   nausea(mual)
                  -   muntah
                  -   nyeriperut
                  -   atau sakii kepala

                  dan
                  palingsedikitsafu dari berikut:

                  1). Terdapat kumanpatogen        pada:.a.=- .:tcran
                                             enterik
                      (stool)atau hapusanrektum.

                  2)- Kumanpatogenenterik           ce:: -'.-skop
                                          diketemukan
                      rutinatau elektron.

                  3). Kuman patogen enterikdideteksideng: -;--=', :nti-
                                          darahataufeces
                      oen atau antibodidari


                                                                        88
                        4). Terdapat bukti adanya kuman enterik patogen ya;.g
                            dideteksi dari perubahansitopatik pada biakaniar,,tgan
                            (toxin assay).
                        5). Kenaikan titer diagnosticsingle antibody (lgM) sebanyak
                            emoat kalipada paired.sera   (lgG) untuk kuman patho-
                            gen.

                        UntukNeonatus
                        dikatakanmenderitagastroenteritis
                                                       apabila:

                        1)- Hiperterrni,
                                       suhu > 38oC, rekta-l,atau       suhu<
                                                               hipotermi
                             37'C, rektal-

                        2). Kembung-

                        3). Bising usus meningkatatau menurun-

                        1). Muntah-

                        s). Pemei-iksaantinja mikroskopisditemukan > 5 per lapang
                             pandang, eritrosit> 2 per lapang panciangbesar

        Catatan:
 .
        Gastroenteritispada neonatus yang lahir di rumah sakit sel'aludianggap
        sebagai gastroenteritisnosokomial.

Faktor Risi ko Gastroenteritis

a.   Bayi dan anak usia6 sld 24 bulan
b.   Geriatrik
c.   Pasienanak denganpbnggantiASl(PASI)                                              ,
d.   Gangguanfungsiimunologi
e.   _Debilitas                                                                       a

                                                                                      i
Pen c eg ah an Gas t roente riti s                                                    tE


a. C ucitan g a n .

89
b. Penanganan    makanal,yangbaikdanaman di rumah'sakit-
c. Tindakan               padase@ pasiendiareakutd€oednpen\':"-ab
                   tertentu
             isolasi                                                 vang
   diciuga infeksius.
d. Personilyang menderita             dengan penyebab
                            diarealo.il              yang didug:' nfeksius
   tidak diperbolehkan untukmemberi   asuhanlangsung-


23. INFEKSITRAKTUSDIGESN\NS
              gaster,ususkecil,usrrsbesar dan rektun';
    (esophagus,

    Letak infeksi   Infeksitraktus@estivus (esophagus,gastei. usus kecil'
                    ususbesardanre(1um)                              dan
                                         tidaktermasukgastro-errteritis
                    appendicitis

    Kode            G!-GIT

    Definisi,                    @estivus,tidakiermasuk
                    lnfeksitraktus                     gastrcenle dan
                                                                 ritis
                                    memenuhi
                                harus
                    appendicitis,             paling      saluderikriteria
                                                    sedikit
                    berikut:

    Kriteria1       Pasien menderitaabsesataubuktilainadanyainteksiyang
                    terlihat pada waktu p e mb e d a h a na t a u p e n le rlK s a a n
                    histopatologis-

    Kriteria2       Terdapatpatirg sedikit dua dari tanda-ianda can geiala-
                    geialaberikuttarpa ada penyebab  yang lainnyaclansesuat
                    denganorganalau laringanyang terkena:

                     -   demam(> 38P ) C
                     -   nausea (mual)
                     -   muntah
                     -   nyeriperut
                     -   atau nyeri tekan

                     dan
                     palingsedikitsatudari berikut:

                     't). Terdapat     pada biakandrainaseatau iaringan
                                 larrnan
                                                                                  > \_:
                         yangdiambilpadawaktu     pembedahan a.au endoskopi,
                         atau dari drain yang dipasangsecara bedah-

                     2). Kuman teriihat pada pemeriksaan mikroskopikpada
                         pengecatan Gram atau KCH atau terlihat multinucle-
                                                  ataujaringanyang diambil
                         atedgiantcellsdaridrainase
                         pada waktu pembedahan   atau endoskopiatau drain
                         yang dipasangsecarabedah.

                                kumandaribiakandarah.
                     3). Terdapat

                                              padapemeriksaan
                     4r- Buktikelainanpatologis             radiologis.

                     5). Buktikelainanpatologispadapemeriksaan  endoskopik
                         (mis., Candrdaesofagitis   proctifis).
                                                ata_ir


2 4 . F iEPATITIS        .=
                     :
     Letak infeksi   Hepatitis

     Kode            GE-HEP

     Definlsi        Hepatitisharus memanuhipalingsedikit satu dari kriteria
                     berikut:

     Kriteria        Terdapatpaling sedikit dua dan tanda-tanda clan gejala-
                     gejalaberikuttanpaada penyebab   yang lainnya:

                     -   demam(t 3BoC )
                     -   anorexia
                     -   nausea(mual)
                     -   muntah
                     -   nyeri perut
                     -   jaundice
                     -   atau riwayattransfusidalamwaklu 3 bulan sebelumnya

                     dan
                     palingsedikit
                                 satudariberikut
                                               :
9t
                   I ). Testantigen atauantibodipos;tii             A,
                                                       untukhepatitis hepa-
                        titisB. hepatitis atau delra hspatiiis.
                                        C,

                   2). Tesifungsiliver            peningkatan
                                     abnormal(mis.,         ALTIAST,
                       bilirubin).

                                     (CMV) terdeteksidiurine
                   3). Cytomegalovirus                     atau sakresi
                                   .
                       orofaringeal.

   PetuniukPelaporan.       .                                            ,
 ' o Jangan melapcrkan  hepatitis alau jaunciice                (mis.,
                                                yang nonirfeksius
     defisiensi
              alpha-1antitrypsin).

   .- Janganmelaporkanhepatiiis jaundice
                              atau     yangdisebabkan
                                                    terpaparoleh
      hepaiotoxin
                (alcoholic acetamincphen-induced
                         alau                 hepatitis,
                                                      dll)-

   . Janganmelaporkan   hepatitis joundiceyangdiserabkan
                                atau                   olehobstruksi
     bilier(cholecystitis).


25. INTRAABDOMII.IAL

   Letak Infeksi   Inlraabdcminal, termasuk, kandr:r_: empedu, ductus
                   choledochus,liver (tidak termasuk :*-:patiiisvirus), limpa,
                   pankreas, peritoneum, ruang sub:irrenic atau subdia
                   phragmatika,atau jaringan intraabc::i'rinal yang lain atau
                   daerah yang tidak dijelaskan diternp:: lain)

   Kode            GI-IAB

   Definisi        lnfeksiinlraaMominal harus memen 'ri paling sedikit satu
                   dari kriteriaberikut :

   Kriteria1       Ditemukankuman pada biakan caira:.:urulent dari rongga
                                                          pembedahanatau
                                yang diambil pada \.,,ai:'J
                   intraabdominal
                   denganaspirasijarum.

                                                                             92
     Kriteria 2       -.erdapatabses atau bukti lain adanya infeksiirrtra-abCcmi-
                      nal yang terlihat pada waku pembedaha,r ?tau oemeriksaan
                      histopatoiogis-

     Kriteria3         Pasien mengalamipaiingsediki'.Jua dari tanda{anda atau
                       gejala-gejalaberikuttanpa diketahuiada penyebabyanglain:

                       -    jaundice demarn (t 38o C )
                       -    nausea (mual)
                       -    muntah
                      '-,   nyeri perut

                       dan
                       paling sedikit salu dari keadaanberikut :

                       1). .Ditemukan  kuman dari biakan cairan yang kelua,-
                                                                           dari
                           'd;ain
                                  yang dipasangsecarabedah (r'.ris.,
                                                                   redondraic,
                            Crainterbuka.T-tubedrain)-

                       2). Ditemukankumandari biakancairan drairrataujaringan
                           yang ciiambilrvahu pembecaharratau aspirasijarui'n.

                       3). Ditemukan kuman dari biakan darah dan bukti radio
                            grafis adanya i;rfeksi,rnis.,garnbaran abnormal pada
                          . ultra sound, CT scan, MRl, atau radiolabel     (mis ,
                                                                      -"can
                            galium, lechnetium)atau pada pen-reriksaan sinar-x.

     Petuniuk Pelaporan

     Jangan melaporkan pancreatitis (sindromakeradangan yang khas ditandai
     dengan nyeri abdomen, mual dan muntah yang disertai dengan kadar enzim
     pankreatik yang tinggi) terkecualidapat ditentukanitu berasal dari infeksi.


26. NECROTIZING ENTEROCOLITIS

     Letak tnfeksi : Necrotizing
                               enterocolitis

     Kode           : GI-NE C
93
   Definisi       : Necrotizing           pada anak harusrnern:nuhikriteria
                              enterocolitis
                    berikut :

   Kriteria       : Anak mcngalamipaling sedikii dua tanda-tandadan gejala-
                    gejalaberikuttanpa diketahuiada penyebabyang lain :

                    - muntah
                    - distensiabdomina'
                    - atauprefeedino
                                   residual

                    dan
                    terdapat                 atau grcss) dalamtinja yang
                            darah (mikroskopis
                    persistens

                    dan
                    paling
                         sedikit
                               safudari                      berikul:
                                                     abdcminal
                                             radilcgis
                                      kelainan

                    1). pneumoperitoneum
                    2). pneumatosis intestinalis
                    3). 'rigid'loopususkecilyangtidakberubat.


27. BRONCHITIS

  Letak Infeksi     Bronchitis,               bronchiol t z :n eitis,tanpa
                              tracheobronchitis.      itis.
                    buktiadanya pneumonia

  Kode              LRI.BRON
                     i
  Definsi           lnieksitracheobronchial   harus memenuhi:aling palirig
                    sedikitsafudari kriteriaberikut :

  Kriteria 1        Tidak terdapatpneumoniabaik sacara s;ris maupun
                    radiografis

                    dan
                    pasienmengalami palingsedikitdua danta-':a-tanda dan
                    gejala-gejala    tanpaada penyebab
                               berikut                 l3in,"rlQdiketahui:

                                                                         94
                     dernam(>38'C)
                     batuk
                     produksisputum baruataumeningkat
                     rhonchi
                     wheezing

                dan
                paling sedikit sat!, dari keadaanberikut:

                1)- B iakan positif dari a s p ira t t ra c h e a d a la m a t a u
                    bronchoscopy-

                2). Testantigenpositifdarisekresi
                                                salurannapas.

     Kriteria
            2   Pas:enberumur> 1 tahuntidakterdapal
                                                  pneunioniabaik
                secaraklinismaupunradiografis

                aan
                pasien mengalami paling sedikitdua dari tanda-tanda dan
                gejaia-gejala
                            berikuttanpaada penyebab lainyang diketahui:

                -   demarni>33"C )
                -   batuk
                -   poduksi sputum baru atau meningkat
                -   rhonchi
                -   wheezing
                -   respiratory distress
                -   apnea
                -   atau bradikardia
                                                                                     :
                dan
                paling sedikit satu dari keadaan berikut :
                                                                                     I
                                                                                     a


                1). Biakan positif {ari aspirat trachea cialam atau                  i
                                                                                     !
                    bronchoscopy-                                                        {

                2). Test antigen positif dari sekresisaluran napas.


95
                   3). Kenaikantiter antibodytunggal(lg!.!re=,.;<enaikan
                       kadarserum(igG)empatkalidari 2kzi; =e<:.=dksaan.

      Petunjukpelaporan

   Jangan melaporkanbronchitiskronis pada pasien denga.n           paru
                                                          cen'.-akit
   menahunsebagaiinfeksiterkecualiterdapat              s:kurder akut,
                                         buktidariinfeksi
   dalambentukperubahanjenis kuman


26. INFEKSILAIN PADASALURANNAPASE}AWAH

                                                     traa .
   Letak infeksi : Otherinfection the lowerrespiratory
                                of

   Kode            LRI-LUNG

   Definis!        Infeksi padasaluran
                         lain              napasbawahharuscairc sedikit
                    memenuhi  satukriteriaberikut:

   Krite:'ia 1     Ditemukankumanpada hapusan                iaringan
                                              atau biakanca:-;
                   paruataucairan            cairanpleu= ?=-ien.
                                 paru,termasuk

   Kriteria 2      Terdapatabses paru atau empiemayang ieiiai    waklu
                   pernbedahanataupemeriksaan histcpatclog:s.

   Kriteria3       Terdapatronggaabses yang terlihatpacia::-:r-iksaan
                   radiografis

  Petunjuk Pelaporan

   .   Laporkaninfeksisaluran
                            napasbawahdan pneumonia
                                                  yai-g::,:maan
       dengankumanyangsamasebagai  PNEU.
  .    Laporkanabsesparuatauempiema
                                  tanpapneumonia
                                               sebaga.-iNG.


29. ENDOMETRITIS.


                                                                    96
                                                                                               :

       Letak Infeksl       Endometritis

       Kode                REPR.EMET

       Definisi                                    paling sedikitsalu kriteria
                                      harusnnemetruhi
                           Enciometritis
                           berikut:

       Kriterial           Ditemukankumandari biakan cairan atau iaringan en-
                           dometrium  yangdiambilpada  waktupembedahan,   dengan
                           aspirasijarum,dtau biopsisikat (brush biopsy)-

       Kriteria2           Pada pasienterdhpat palingsedikit dua dan tanda-tanda
                           dan gejalagejala     tanpadi ketahuipetryebab
                                          berikut                        lainnya:

                           -   demam(> 38" C )
                           -   nyeriaMominal
                           -   nyeritekanuterus
                           -   ataucairanpurulent    dari ulerus
                                                keluar

       Petunjuk Pelaporan

       Lap o rkan e n donretritispost parturr sebagaiinfeksinosokorrrial erk ec ua Ii cairan
                                                                       t
       amnion teiah terinfeksi pada waktu masuk rumah sakii atau pasien telah
       dimasukkan 48 jam setelah pecahnya ketuban.


3 0 . EPTStO TO          MI

       Letak Infeksi       Episiotomi

       Kode                REPR-EPIS

       Definisi                             harusmemenuhipaling sedikit safu dari
                           Infeksi episiotomi
                           kriteriaberikul:

       Kriteria1           Pasienpascapartus vaginam
                                               per          drainasepu-
                                                    mengalami
                           rulentdari episiotomi


J "7
  Kriteria2     - : Pasienpasca partus pur vaginam menderitaabsz''.^=.2
                    episiotomi-

  Petunjuk Pelaporan

   Episiotomibukan      pembedahan
                 prosedur                            sebaTi SSl.
                                 N1'lll,ianganlaporkan


           CUFF
31. VAGIT{AL

   Lel.akInfeksi        Vaginalcuff
                    ,
   Kode                 REPR-VCUF

   Definisi             lnfeksi vaginal cuff harus memenuhi paling sedikit sz'-; czi
                        kriteria berikut :           '

           1
   Kritei-ia            Pasien pasca hysterectornymengalami drainase 3 )'-'.2''-
                        dari vaginalcuff.

   Kriteria2            Pasien pasca hysterctomy mendapat abses pada .'aci:a
                        cuff.

   Kriteria3            Ditemukan ktrman pathogen pada biakan yang diarn:ii :'--'
                        cairan atau jadngan dari vagina.l cuff)

   Petunjuk Pelaporan

   .                   umumnya
       Infeksivaginalcuff        adalahSS|-VCUF
   .   VCUF lambat:( 30 hari setelahhysterectomysebagaiREPR.VCU=-
                    t                          )


                  OF               TRACT
32. OTHER INFECTION THE REPRODUCTIVE

   Letak lnfeksi : lnfeksi lain pada tractus reproduktiflaki-lakidan ,*'anie
                   (epididymitis,testis,prostat,vagina. ovarium,uterus-           a:a:
                   iaringan   pelvis profun d a y a n g la in , t id a k t e rn ' s -<
                      endometritis         vaginalcuff)
                                 atauinfeksi

     Kode             REPR.OREP

     Definisi         Infeksi padatractus
                            lain           repioduktif  laki-laki vvanita
                                                                dan       harus
                      memenuhi   palingsedikitsalu dari kriteriaberikut :

     Kriteria1        Ditemukan kuman dari biakan jaringan atau cairan dari
                      bagian yang terkena.

     Kritaria2    ,   D;temukan abses atau buictilain adar.ya infeksi pacia daerah
                      yang terkena yang terlihat pada waktu pembedahan atau
                      pemeriksaan histopatologis-

     Kriteria 3       Pasien mempunyaidua daritanda-tandaaiau gejala-gejala_
                      berikut tanpa diketahuiada sebab lainnya :

                      -   demam(>3BoC)
                      -   mual
                      -   muntah
                      -   nyeri
                      -   nyeritekan, atau disu:'ia

                      dan
                      paling sedikit saiu dari berikut

                      1). Kuman dari biakandarah-
                      2)- Diagnosis dari dokter.

     Petunjuk Pelaporan

     .   LaporkanendometritissebagaiEMET
     .   Laporkaninfeksivaginalcuffsebagai
                                         VCUF.

rumahsakit.Infeksiinsisisetelah
                              pembedahan
                                       diidentifikasikan
                                                      terpisahsebagai




99
33. KULIT

   Letak lnfeksi   Kulit

   Kode            SST-SKIN

   Definisi        lnleksi harus
                         kulit       paling
                               memenuhi    sedikit          berikut:
                                                 safukriteria
   Kriteria1       Pasienmempunyai     purulent,
                                drainase       pustula.
                                                      vesicula,atau
                   furunkel.

   Kriteria 2      Pasierrmempunyai  paling seclikitdua dut tanda-ianda dan
                   gejaia-gejala
                              baikuttanpa diketahui penyebab
                                                   dda.         yanglainnya:

                   -      nyeriataunyeritekan
                   -      bengkak lokal
                   -      kemerahan
                   -      atauhangat:

                   dan
                   palingsedikit
                               safudariberikut:

                   1). Diternukan
                                kumandaribiakan
                                              aspirat
                                                    aiaudrainasedari
                          daerahyang terkena;bila kuman adalah normal flora
                          kulit(mis.,cnagulas negative sta
                                            e             phylccocci,micrococci,
                          diphtheroids) harusmerupakan
                                        itu                 biakanmurni.
                          Kumandari biakandarah.

                   r/. Test     positif,
                          antigen      Cilakukan jaringan
                                               dari     yang terinfeksi
                          atau darah (mis-, herpes simplex, varicella zosten H.
                          influenzae,N- meningitidis).
                   A\
                   1r .   Ditemukan             giant ceil pada pemeriksaan
                                   multinucleated
                                    jaringanyang terkena.
                          mikroskopis
                   tr\    Diagnostic            titer (lgM) atau kenaikan
                                   singleantibody
                          empatkalidalam kalipemeriksaan
                                       dua                pairedsera (lgG)
                          untukkumanpathogen
  Catatan :

  lnfeksi kulit nosokomialmungkindiakibatkanoleh berbagai prosedur yang
  dilakukandi rumah sakit.
                                                                    100
                                                              ssl-sKlN
                                                        sebagai
                                                 terpisah
              setetah
  lnfeksiinsisi       pembedahan diidentifikasikan
                                      insisidada selelahcBGb terinfeksi'
  terkecuatiuil, ="i"ian ceee. Apabila
                                  bilatempatdortor kakiyang terinfeksi'
                                                    di
  iempatspesifikuoJ"n SKNCdan                                   dengan
                                            Iainyang berhubungan
                                       tcutii
  letak spesifiknyauo"t"t SKNL-tnfeksi
   pemaparanpentingdiicjentifikasidengantetaknyaiendirijarrtertuiisdibawah
   petuniukPelaPoran'

   Petuniuk PelaPoran

   .    Laporkanomphalitis padaanaksebagaiUMts-
                                                   sebagaiCIRC'
                                  sirkumiisineonatus
   .    Laporkanint"f.rip"O'aOaeran
                                        PUST'
   .    Laporkanpustulapadaanaksebagai             DECU-
                                            sebagai
                               yangterinfeksi
   .    Laporkanutcusdecubitus
    .   Laporkan                       sebagaiFURN-'-
                luka bakaryangierinfeksi
                                          sebagai
                               ataumasiitis      BRST'
    .   Laporkan abses tnamma


                 L
3 4 . J AR ING AN UNA K
                                                             infectious gangrene'
    Letak Infeksi        Sott tissue (necrorlzingfasceitis'                   atau
                         necrotizing          inteitiousmyositis'lymphadenitis'
                                    cellulitis.
                         lymphangitis)

        Kode             SST.ST
                                                                pating sedikit satu
        Definisi         Infeksiiaringanlunak harus memenuhi
                         kriteria berikut:
                                                                          dari
        Kriteia 1        Diketemukan  kumandaribiakanjaringanatau drainage
                         daerah Yang terkena-
                                                                        yang
        Kriteria2         Pasien mendapat drainage purulent dari daerah
                          terkena-

        Kriteria3         Terdapat abses atau bukti lain adanya infeksi-yang lllp^*
                                                                      histopatologts-
                          paOawaftu pembedahanatau pemeriksaan

                                                                    dan gejala-
         Kriteria4   :     Terdapatpaling sedikitdua daritanda-tanda

  r0l
                     gejalttpada daerahyang tedrenaberikuttanpa diketahui
                     ada penyebablainnya

                    - nyed atau nyeritekantokal
                    - kemerahan
                    - bengkak
                    - atau hangat

                    dan
                    palingsedikitsatudaribenkut:

                    1)- Kumandari biakandarah.
             -
                    ,).                 positif,diiakukandari jaringan yang
                         I:_-r._,.1irjgen
                         rorrnteksiatau darah(mis.,herpessimplex,variceili
                   ...^. zoster, 11-
                                   influenzae, meningitidis)
                                               N-
                    3). Diagnostic   slngleantibody  fitar (lgM) atau kenaikan
                         ernpat kalidalam kalipemeriksaan
                                         ctua                  pairedsera(lgG)
                         untukkumanpathogen.

  Petunjuk petaporan

  . Laporkan ulkusyang
                       terinfeksi
                                (decubitus)
                                          sebagaiDECU.
  . Laporkan infeksidarijaringan
                                peMs profunda
                                            sebaga!OREP-.
  ' Laporkaninfeksi tempatpembedahar
                     di                     yangmengenai   baikkuritrnaupun
   ' jaringan
               lunakyang.daram(dadaatau di bawahfascia
                                                          atau lapisan otot)
     sebagai ssr-sr, terkecuariprosedur  pembedahan   daramcBGB..Bita kurit
     dan jaringan runakyangdarampadainsisi
                                              dadamenjaditerinfeksi, tempat
     spesifik menjadi STc dan jika kuritdan jaringan
                                                    tunakdaramdari tempat
     donor pada kaki menjaditerinfeksi,  tempatipesifik adarahsrL (specific
     site leg).


5. ULCUS DECUBITUS

 Letak Infeksi : Decubitus
                         urcer,
                              termasuksuperficiardan
                                                 profunda
                                                        (daram)

                                                                         l0:
        Definisi          lnfeksiulcusdecubitus
                                              harusmemenuhi
                                                          kiiteria berikut:
        Kriteria          Terdapatpalingsedikit dua dari tanda-tandadan gejala-
                          gejalaberikut
                                      tanpadiketahui penyebabiainnya:
                                                    ada

                          - kemerahan
                          - nyerilekan
                          - ataubengkakpadapinggir
                                                 iukadecubitus

                          dan   r
                          paling sedikitsafu dari berikut :

                          1). Kuman dari biakan cairaa atau jaringan yang diambil
                              secarabenar(lihatdibawah).

                         2). Kuman dari biakan darah

       Catatan :

  ' ' Drainase purulent saja tidak cukupkuat membuktikan
                                                       adanya infeksi.

       ' Kuman dari biakan permukaanulcusdecubitustidak cukup kuat membuktikan
         hahwa ulcus lerinfeksi.Spesimenyang Ciambilsecara benar
                                                                    adalah dengan
         aspirasi iarum daricalran atar-r
                                        biopsijaringanpada daerah perbatasan ulcus.


36. r.ltssEMt NATED INI:ECTTON

       Letak Infeksi   : Infeksiyang menyebar (disseminatedinfection)

       Kode            : SyS-Dl

       D efi nisi      : Disseminated infection
                                              adalah infeksiying mengenaiorgan
                         atau sistimyangmultipel,tanpaada infeksiditempatyang
                         jelas,biasanyapenyebabnya darrdengaqtanda{anda
                                                    viral
                         dan gejala-gejalayangtidakdiketahui ada penyebabdan
                         menjadicokfat gelapatauhitam atauperubahan  wama(dis_
r0 3
kompatibel                 yang infeksius
          denganketerlibatan            dari organ-organ
                                                       atau sistinr
multipel.

Petunjuk Pelaporan

. Kode harus digunakan   primeruntukinfeksi  viralyangmengenai   sistimcr-
  gan yang multipel(mis. Measles,mumps, rubella,varicella,erythema
  infectiousum).Infeksi-infeksidapatdiidentifikasi
                                                 dengan kiteria ktinik saja.
  Jangan menggunakan     kode ini untuk infeksinosokomial  dengan temoat-
  tempat metastatik, seperti baclerial endocarditis,hanya letak primer ciari
  infeksitersebutharusdilaporkan.

. Fever of unknownorigen(FUO)sebaiknya tidakdilaporkan-sebagail-dVS.
                                                            O

. Neonatal'sepsi* harusdilaporkan
                                sebagaiBSI-CSEP.

. Viralexanthema
               alaurashillnes
                            sebaikrrya        sebagai
                                     dilaporkan     DI-SYS.


LUKA BAKAR

Letak lnfeksi   : Luka bakar (bum)

Kode            : SST-BURN

Definisi        : fnfeksiluka bakar harus rnemenuhipaling sedikit saiu dari
                  kriteria berikui :

'Kriteria 1       Terdapatperubahanpada penampakanatau karaki:' ,uka
                  bakaq seperti p'emisahan eschar yang cepat, atau :::har
                  menjadicoklat gelap atau hitam atau perubahan warna idis-
                  coloration) yang hebat atau edema pada perbatasan -ka.

                  dan
                  Pemeriksaanhistologis dari biopsi luka bakar menunjr<<an
                  invasi kuman kedalam jaringan berdekatan yang sehz:

Kriteria2         Terdapat perubahan pada penampakan atau karaki:i ;uka
                  bakar,seperti pemisahaneschar yang cepat, aiau e3-: zr

                                                                         i q4
                meniadicoklat gelap atau hitantatau p,rrubahan warna (drs-
                coloration) yang hebat atau edema pada perbatasan luka.
                dan
                paling sedikitsafu dari berikui:

                1). Terdapat kuman dari biakan darah dan tidak terdapat
                    infeksilain-

                2)- Oapat diisolasi virus herpes simplex, identifikasi
                    histologisdari inclusionsdengancara mikroskopicahaya
                    (light microscopy) atau tempat partikel-partikel virus
                    dengan mikroskop eleklron daribiopsi kerokan lesi.

  Kriteria3     Terdapat paling sedikit dua dari tanda-tanda dan gejala-
                gej+ berikuttanpa diketahuiada    penyebablainnya:

                - demam (> 38" C)
                              (<
                - hipotermia se'C)
                - hipotensi
                  oliguria (< 2O mldam)
                - hiperglikemiadengan diet karbohidrat pada level yang
                  sebelurrrnya                dengan mental confusion.
                                dapat ditolelir

                dan
                paling sedikit satu ciariberik.tt:

                 1)- terdapat kuman dari biakan darah cian tidak terdapat
                    .infeksilain-

                2). Kuman dari biakandarah.

                3)- Dapatdiisolasivirusherpessimplex,          histologis
                                                     identifikasi
                    dari inclusionsdengancara mikroskopicahaya (light
                    micros py) :.iautampakpartikel-partikel rus dengan
                           co                               vi
                    mikroskop  eleklrondaribiopsikerokanlesi.

  Catatan :
  . Purulentsajapadatempat
                         lukabakarlrdakcukup untukdiagnosis
                                           kuat           infeksi

t0s
lukabarar,purr-rlent
                   sepe{iitumungkin menunjukkan  perawatan yang kurang
                                                           luka
      baik.
    ' Demamsajapadapasien    lukabakartidakcukupkuat untukdiagnosis infeksi
      luka bakar karenadernam mungkin  merupakan akibatiraumajaringanatau
      mungkinpasienmendapat    infeksiditempatlain-

       ' Ahfi bedah pada Regional
                                BumCenteryang eksklusif   merawatpasien luka
         bakar,mungkinmemerlukan  kriteria1 untuftdiagnosis
                                                          infeksiluka bakar-

       ' Rumah sakit denganRegionalBum Center mungkinmembedakaninfeksi
         luka baka,-
                   lebihtanjut
                             sebagaiberikut:
  r
        '   burn wcund site
        '   burn graft site
        '   burn donorsite
        '   burn donorsite-cadaver
        -   tetapisistimNNIShanyamemberi
                                       kode semuanva
                                                   sebaqaiBURl.l.


38. ABSES BUAH DAD.Aatau MAST|T|S

      Letak Infeksi             abscessatau mastitis
                          Brearst

      Kode                SST-BRST

      Definisi            Abses buah dada atau masiitis harus memenuhi paling
                          sedikit saludari kriteria berikut :

      Kriteria r      i   Biakan positil dari jaringan buah dada yang terkena atau
                          cairan yang diambil dengan cara insisi dan drainase atau
                          aspirasi jarum.

      Kriteria2           Pasien menderitaabses buah dada atau buktt lain adanya
                          infeksi vang tampak pada waktu pembedahan atau
                          pemeriksaan
                                    histopatologis.

      Kriteria3       : Pasienmengarami
                                      demam (t 3gnc) dan keradangan
                                                                  rokal
                        padabuahdada.

                                                                              r 06
                            Pururentsaja padatentpatluka.bakar
                                                             tidakcukupkuat
                            untukdiagnosisinfeksi

                      dan
                      dokternrendiagnosa     absesbuah dada.
                                       sebagai
      Cautan :

      Abses buah dada yang timbuldalam waktu7 hari setelahmelahirkanharus
      die..rggap
               sebagai nosokomiai.


I9..,OMPHALIT         ts                            '
      Letak Infeksi   Omphalitis

      Kode            SST.UMB

      Definisi        Omphalitis pada neonaius(umur30 hari) harus memenuhi
,                     paling sedikit safu kriteriaberikut:

      Kriieria 1      Pasien mengalami eritema dan/ataudrainaqe serous dari
                      umbilicus

                      cian
                      paling seclikitdari sata berikut :

                      1). Kuman ditemukan dari biakan drainage atau aspirasi
                          jarum

                      2)-   Kuman ditemukan daribiakan darah

      Kriteria2       Pasien mengalamibaik eritemamaupun drainage purulent
                      pada umbilicus.

      PetunjukPelaporan

      . Laporkan infeksidariartena
                                 umbilicalis venayangberhubungan
                                          atau                  dengan
        kaleterisasisebagai cvs-vAsc bila biakandarah negatifatau tidak
        dikerjakan.

)'7
    dalam waktt: 7 hari setelah keluar dari rumahsakit.

40. PUSTULOSIS ANAK

   Letak Infeksi                   (pustulosis
                    Infantpustulosis         anak)

   Kode             SST-PUST

   Definisi         Pustulosis pada anak (umur 12 bulan) harus memenuhi
                    paling sedikit satu kriteria berikut :

   Kriteria1        Anak menderitasalu atau lebihpustule

                    dan
                                       sebagai infeksi kulit.
                    dokter rnendiagnosis

          2
   Orrntema                        Satu atau lebih pustule-
                    Ar:ak menderit-a

                    dan
                                                    yang sesuai.
                    dokter memberiterapiantimikrobial

   Petunjuk Peiaporan

   . Jangan melaporkan eritema toxicum dan penyebab noninfeksius dari
     pustulosis.

 . . Laporkan sebagai nosokomialapabilapustulosistimbul dalam waktu 7 hari
     setelah keluar dari rumah sak'tt


41. CIRCUMCITIONNEONATUS

   Letak lnfeksl : Newbom circumcision

   .Kode           : SST-CIRC

   Definisi        : lnfeksi sirkumsisipada neonatus (umur < 30 hari) harus
                     memenuhipalingsedikitsatu dari kriteriaberikut:

                                                                       10"\
      Kriteria 1   : Pasien mengalamid,ainage
                                            purul:nt dari tempatsirkumsisi.

      Kriteria 2   : Pasien neonatus mendapatpaling sedikit saru dari tanda-
                     ianda dan geiala-gej alaberikut lanpa diketahui ada
                     penyebab lainnyapada temparsirkumsisi:

                     -    eritema
                     -    bengkak
                          atau nyeri tekan

                     dan
                     ditemukan kuman da;i tempatsirkumsisi.

     Kriteria 3    : Pasien neonatus mendapatparingsedikit satu dari tanda-
                     tanda dan gerari-gejata berikut tanpa ciiketahuiada
                     penyebab lainnyapadatempatsirkumsisi :

                          eritema

                     - :,"ltffilrireran
                    gan
                    ditemukan kontaminankurit(coagurase    negatif streptococci,
                    di.chtfieroici,
                                  Baciilus sp,atau micrococci)dari biakan tempat
                    si:-kumsisi-

                    dan
                    Doktermendiagnosa infeksiatau dokter memuraiterapiyang
                    sesuai-

     Petunjuk Pelaporan

     Newbom circumcisionbukan merupakanprosedur
                                              pembedahanNt,ilS,
                                                              jangan ..
     melaporkan sebagai SSl.




r9
LAMPI
          2
   LAMPIRAN
PENGAMBILAN                DAN
             PENYI]VIPANAN PENGIRIMAN
           N
   B A H A P E M E R IK SAAN
                         MI KRCBI O LO G I




                                      ir0
                                                          L A MP I RA N

            PENGAMBILAN,
                       FENYIMPANANDAN PENGIRIMAN
               BAHAN PEMERIKSAANMIKROBIOLOGI

Seperti halnya pemeriksaan mikrobilogik pada umumnya, nraka dalam hal
pengambilan, penyimpanandan pengiriman bahan pemeriksaan yan? berkaitan
                        harus mernenuhibeberapapersyaratantertentu.
dengan infeksi nosokomial

Syarat yang berlaku umum untuk semua bahan pemeriksaandikernukakan dalam
petunjuk umum. Syarat-syaratyangberlaku khusus bahan terlentu dibahas daldm
petunjuk khusus-Petunjuk umum dan khusus yang akan dikemukakanlebih lanjut
adalah persyaratan untuk bahan perneriksaan bakterologik. .

Pada bagian akhir dari petunjukini, disajikansebuah label untuk mempermudalr
pada pemakai secaracepa!memilihcara tepat untuk menanganibahan tertentu-
Bilapara pemal<aijasalaboratorium mikrobiologimengalami kesukaran,diharapkan
berhubungan langsungdenganpetugaslaboratorium-

A.   PETUNJUKUMUM

     Di dalam petunjukumum pemeriksaanbal<terlologik,
                                                    yang clapat diterapkan
     secara umum ialah tahap oengambilan bahan pemeriksaan.Penyimpanan
                             clalampetunjuk khusus.
     serla pengirimandiperinci

     Pengambiian bahan pemeriksaanbakteriologikuntuk infeksi nosokomial
     hendaknya beberapasyarat yaitu :
                   .
     1.   Bahan diambilsebelumpemberian antibiotikaatau khemotherapeutika-
          Dalam keadaanterlanjurdiberi, maka sebaiknyacitampirkan jenis dan
          lakaran serta lama pemberianobat-

                        diambilpada saat dan tempa:yang iepat. Saat dan
     2. Bahan pemeriksaan
          tempat dipilih dengan mempertimbangkan kenungkinan terbesar
          me ndapatkankuman-kuman.

          Pengambilandilakukan dengancara dan alatsei:rikian rupa, sehingga
          cemarantidaklerjadi(caraaseptik)
                                                                          lll
                                                             pemeriksaan
      4.    Bahan pemeriksaan     cialam
                            Ciambil     iumlahyang cukupuntuk
            yarrg diminia.

             Formulirpemeriksaan         diisi dengan lengkap'
                                hendal<nya

3. PETUNJUKKHUSUS

      Petunjuk bahan pemeriksaan yang sering diminta untuk diperiksa, akan
      dibahas sendiri. untuk bahan pemeriksaan yang relatifagak iarang diminta,
      hanya dicantumkan ddlam tabel pada akhir petunjuk ini'                '

      1. Air seni

             waktu penampungan air seni sebaiknya pagi hari ("early morning spec!-
             men")alau4 jam setelahkencingterakhir.  Terh-palpenampung    ialahtabung
                            Tempaipengambilandapat
             steril bertutup.                           dengancara penampurlg3n
             porsi tengah yang bersih ("clean voided mid stream), pungsi suprapubik
             atau dengan kateter. Jumlah airseniyang dibutuhkan     antara 1-2 ml bila
             diambil dengan   pungsi suprapublicatau 1Ornl, bila diainbilCenganporsi
           . tengah yang bersihatau kateter-Bahan yang diperolehsegera dikirimke
             labcratorium-Bila tertunda dapat oisimpan daiam lemari es suhu 4"C
             selarna 24iam, atau diiambah pengawet asam borat.

      2. Darah

            Waktu pengambilan darah untuk biakankumandipilihsesuaidengan
            perialananpenyakit-Tempatpenampung     bahandisediakan sepasang
            media yang berisi media cair, Tryptic PhosphateBroth (TPB) atau
            'Trypticase
                      Soy Broth'(TSB)atau.CookedMeatMedium     "(Ct'/M)untuk
            kumananaerob. Masing-masing   mediadiisidengan 5ml - '10ml darah
                                                          +
            untukt 10%volumemedia.

             Pcngislandarah dlakukan dengan cara aseptik-pengirimanbahan ke
             laboraloriumsegera mungkin.Bila tertundadapat diietakkandalam
             inkubator37 C semahm.



t')
     3. Nanah
        Pengambilan nanah (pus)dapatdikelornpokkanmenjadi dua cara, yaitu :

           a.   Pengambilannanah daritempat yang tertutup misalnya cjariabses.
                rofrgga tubuh (kavum pleura, rongga sendi dan lain sebagainya)-
                Bahan diambil dengan cara pungsi aspirasi, dengan semprit steril.

           b.   Pengambilan nanah dari tempat yang terbuka atau yang berhubungan
                ciengan uCara, misalnya dari luka terbuka Bahan diambil dengan ca:a
       ,        hapusan dengan lidikapas steril.

           Sahan yang cliambil dengan cara a), segera dikirim ke laboratorium-
           Diusahakan sedikit mungkinbahan kontak dengan udara yaitu dengar:
           cara,-neniadakan udaraCidalamsarnpritdan meuutup jarum pada ujung
           semprit dengan tutup'kareibekas tutup botol obat sur:tik.

           Bahan yang diambildengan     cara b), dimasukkanke dalam media trans-
           port stuart dan segera dikirimke laboratorium.

           Bila pengirimantertunda,supaya disimpandalam suhu kamar.

4.   Tinja

     Pengambilan bahan pada pagi hari dan atau pada linja yang baru ketuar
     ("Freshly passed stool"). Bila tinja sulit diperoleh maka pengambilan ciengan
     hapusan rektum dianjurkan.   Tinjayang diperolehditampung di dalam labung
     atau botol qelas setrildan segeradikirimke laboratorium.   Bila diambil dengan
     hapusan rektum, oikirin dalam media transport Carry Blair. Jumlah bahan
     yang diperlukansebanyak 10 gram atau sebesar ibu jari kakiorang.dewasa.

5.   Dahak

     Daiiak (sputum) diperolehdari penderitadengan cara batuk spontan,dengan
     ekspek torans. aspirasicairanlambung atau aspirasi transtrakeal.Penderita
     diberi petunjuk agar yang ditampung adalah benar-benar dahak dan bukan
     air liurnya. Pengambilandilakukanpada pagi han ("earty morning sputum")


                                                                                ili
     dan ditampungda.tam!:awanpetristeril.
     Bahansegeradikirimke laboratorium.
                                     penundaan
                                             tidakdianjurkan karena
                                                           oleh
     penambahan pengawet   tidakada-

).   Liquor ce-rebrospinatis

     Pengambilandengan pungsi,dilakukan   swaktu-waktu   sebanyak 2-4 rrt-
     Penampurigdapat berupa tabung/ botol gelas steril bertutupalur (screw
     capped") atau tabung berisi media pemupuk "Dextrose   Ascitic' (DAF).
     Pengiriman ke laboratoriumsegera mungkin (seragimasih irangat)
     Penyimpanan tidak dianjurkan.




l4
LAMPIRAN
LAIVI
   PIRAN
       3

  I$OLASI




            iti
Tabel pemilihancararara pengambiian,penyimpanan
                                              pengirimanbahan
pemeriksaanbakteriologi.



 1    AirSeni       Biakan sediaan
                         dan           . pagihad                    4"c     Segera
                    langsung
                           kuman-kuman                                      40C
                                       . tabungstedl                asam
                    pyogenik
                                                                    borat
 2.   Dahak         Biakan sediaan
                          dan           . pagihari .                        SeEera
                    langsungkuman-kuman              ,
                    bukantahanasam      . cawanpetdsteril                   Suhu
                                                                            kamar
 c    Oareh         Biakankumanaerob                     media 37"c
                                                . sepasang                  Segera
                    dan anaerob-:t-

 4.   Cairan        Biakan sediaan
                          dan         . pungsi
                                             aspirasi 37. C                 Segera
      pleura               kuman-kuman semprit
                    langsung                   steril
                    aerob anaerob
                         dan
                                      . media
                                            pemupuk
 5.   Uquor    Biakan sediaan
                    dan           . tabung
                                         ster!!  37" C                      Segera
      Cerebros langsung
                      kuman-kuman                                           (seJagi
      pinalis  pyogenik           " mediapemupuk                            hangat
                                    DAF                                     37. C)
 b-   Hapusan Biakan sediaan
                     rian           .lidikapas
                                             steril                 Suhu    Segera
      tenggoroklangsung kuman-kuman dalammedia                      kamar
      arvhidung pyogenik
                i                   . bansport
                                             stuart                 Suhu    Segera
                                                                    kamar
 7.   Nanah         Biakan sediaan
                          dan          . lidikapassteril            37"C    Segera
                    langsung
                           kuman-kuman dlmmedia
                    aerobdananaerob    transportstuart
                                                . pungsi
                                                       aspirasi
                                                dlmsempritsteril.           Segera

                                       .1.*{'

                                                                                  l l t'
                                                                         l--t-aMPIRANlll
                                                      ISOLASI
                              ''\ - - - . . . - , *
                                                          u - '- " " '

A. PERKEft{BANGAN
                KONSEPISOLASI

    Konsep isolasi penderita penyakit menular sudah ada sejak zaman kuno,
    dengan adanya pengasingan terhadap penderitakusta. Sebelum tahun 1850,
    konstruksi rumah sakit terdiri dari bangsal-bangsal yartg terbuka dengan
    penderita yang penuh sesak - Akibatnyainfeksisilang sangat tinggi dan angka
    kematian sangat tinggi. Florence Nightingale,berdaSarkan pengamatannya
    pacfawaktu perang Krim mencatatdalam lrlofeson Hospitals,     tentang perlunya
    ruang perawatan berbentuk paviliun-paviliun   kecil yang dihubungkan dengan
    koridor terbuka.Ajarannya mengenai'perawatan demam' ('fever nursing')
    menekankaapentingnyaasepsis dan kebersihan            lingkunganberdasarkan
    konsep yangL'erkembang      saat itu bahwaperawaian  demarndapatmenularkan
    penyakit kare:rakontak Cengantubuh,dan bukan karena lingkungan-           A.khir
    abad 'i 9. tebri infeksi diterima di rumah sakit Amerika Serikat dan dimulai
    dengan dihindarinya   bangsal yang perruh  sesakcianditerapkanpraklekasep-
    siS. Rumah Sakii penyakit menular memulaiisolasi             rnaupunkelompok
                                                      individr-:ai
    paciaiahun 1889.Pada pergantianabad,rumahsakitumurn r,'rulai        mengisolasi
    pasien denganpenyakit menular pada ruangindividual,       alai-alatterpisahdan
    penggunaan desinfektans- Sejak terjadinya wabah (outbreak) infeksi
    nosol<omial  pada tahun 1960-an, Centersfor DiseaseConiroland Pi-evention
    (CDC) mulai menyusun kebijakan isolasipasien penyakit menular di rumah
    sakit. Rekomendasi CDC yang pertama berjudul Isolation techniques for
    use in hospitals tedrit pada tahun 1970,yang membagi cara isolasi dalarn7
    ketegori, berdasarkan -carapenularan epidemilogik.Penggunaan 7 kategori
  ' dipantau mengakibatkanterjadinya pengisolasian       yang tidak diperlukan atau
    berlebihan,sehingga lerjadi beberapa kaliperkembanganPada tahun 1985
    diperkenalkan universal precautions, kewaspadaan [precaution] terhadap
    darah dan cairan tubuh, yang tidak membedakanperlakuan terhadap setiap
    pasien, dan tidak tergantung pada diagnosis   penyakitnya.pada tahun '1987,
    diperkenalkan   -6ody Substance- lsolation, usaha untuk menghindari kontak
    dengan semla jenis cairan tubuh-

     Pedoman Contres for Disease Controland Prevention (CDC,Ailanta,USA)
     Pedomanisolasiterbaru dari CDC diterbitkan
                                              pada tahun i9g4, dan direvisi

n7
kembalipadatahun1997,terdiridari 2'lapis' kewaspadaan-        Lapisanperiama,
    dinamakanStandarci   Precautions  yang merupakan   kombinasiantara lJnter
     sal precautions(UP)dengan Bcdy Substancetsolations(BSl). Kewaspadaan
    lapis pertamaini bertujuanuntuk nnenurunkan    risiko penularandari infeksi
   yang sudahataubelum    diketahuidan dipedakukan  untuksemuapasienapapun
   diagnosanya.   Yang sudahdiketahui, termasuk  penyakitinfeksi,ataupunStan-
    dard precautionini dtujukan pada darah,semua cairan tubuh, sekresidan
   ekskresi(keaiali keringat),baik yang nyatatercampurdarah maupuntidak. .
   kulit yang terlukadan membran mukosa.
   Lapisan kedua kewaspadaanini disebut Ttansmission-EasedPrecautions.
   ditujukanuntukpasienyang reybukti     atau diduga berpenyaKi menularirtau
   yang secaraepidemiologis   mengidap  kuinanpatogen,yang rhemerlukan    lebih
   dari standard  preautions untuk mencegahtrans:'nisisilangnya.
    Transmission'Based   Precautionsyang didasarkan atas cara penularan /
   transmisi  penyakit      dari tigajenis:
                      terdiri
   .   airborneprecautions(kewaspadaan  penularan lewat udara)
   .   droplet pre';aution(kewadpadaanpenuiaranlewatdroplet)
   .   contact precautions  (kewaspadaanpenularanlewat kontak)

   Jenis-jenis  kewaspadaan dapatjuga berupakombinasi,bila ada suaru
                              ini
   penvakiimempunyai     beberapa   cara penularan,   dan setiaptipe merupakan
   tambahan terhadapstandanLprecautions.cara isolasi sebelumnyayang
   berdasarkancategory    specific isotations(Strict isolations,
                                                               contact isolations.
   respiratory isolations,
                         tuberculosis,entericprecautions, ciandrainage/ secre-
   tions isolation).serta yang berdasardrseasespeciiic semua sudah ciifebur
   habis ke dalamti;a jeniskewaspadaan      berdasar   cara penularantersebut-
   Ciri lain dari pedoman  terbaru ini adalah adanya daftar pasien dewasa dan
   pasien anaki-anak  yang dianggapinfeksiusberdasardiagnosa kerja empiris
   yang dikaitkan  dengan  cara penularan  yang ada.

B. AIRBORNEPRECAUTIONS

   Kewaspadaan bertujuan
                 ini          untuk menurunkan   penularanpenyakitmelalui
   udara, baik yang berupa bintik percikandi udara (airbome droplet nuclei,
   ukuran 5 pm atau lebih kecil) atau partikeldebu yang berisi agen infeksi-
   organisme yang ditularkan dengancara ini dapat menyebarsecara luas
   bersamadengan   aliranudara-

                                                                             ilE
 Penyakityang masuk kategoriini antaralain tuberkulosis, varisela,campak.
Diperlukanventilasi seperti pada isolasi BTA (Basil TahanAsam); pasien
ditempatkan dalam ruangtersendiri  de4ganafiranudaranegatif(negative  air-
flow) denganminimal6 kali pei'gantian  udara per ja:-n,
                                                      yang dipantautcrus
menerus.Udara langsungdibuangke luar atau dilewatkan      penyanng(filter)
partikularudara dengan efisiensitinggi bila akan disirkulasikembali. Pintu
ruangan harus selalu dilutup.Pasienhanyaboleh meninggalkan      kamar bila
ada kepentingan mendesdk.  Bila paslenal6n diangkutkeluarharusdipakaikan
maskerchirurgis.Alat pelindung  respirasiharus dikenakanuntukpasienyang
didiagnosaatau diduga tuberkolosissesuaidengan pedomanyang telah ada
untuk tuberkulosis. Orang termpsuk petugas ifurnah Sakit. yanE tentan
terhadap penya'rcit
                 campak(measles)     dan cacarair (varisela)
                                                           dilarangmasuk
ke ruanganpasiendenganpenyaklttersebut-      .
                PRECAUTION
Tabell : AIRBORNE

Sebagai tambahan dari Standard Precautions, Airborne Precautions
digunakanuntukpasienyang diketahui                 penyakit
                                 ataudidugamenderita      serii.is
denganpenularan melaluipercikanhalusdi udara.

Contoh penyakit:
  . Campak
    Vadsela(termasukherpeszosteryang menyebar diseminated)
                                            I
    Tuberkulosis

Penempatan pasien:                                               .
Tempatkan pasien pada'tempat yang :
. lekanan negatif termonitor,
. rninimalpergantianudara enam kali setnp jarn
. pembuangan (exhaust) udara keluar yang memadai aiau penggunaan
  filter tingkat tinggi termonitor sebelum udara bereclar. seluruh rumah
                                                          ke
  sakit.
. Jagalah agar pintu tetap tertutupdan pasien tetap dalam ruangan.
. Bila t'xJakada ternpat tersendiri, tempatkan pasien dalam ruai-rgan
                                                                    derrgan
  pasien lain yang terinfeksi mikroorganismeyang sama, dan tidak ada
  infeksilain-

Proteksi respirasi:
Gunakan  pelindungpernapasan
                           waktu masukke ruangpasien  yangdiketahui
atau didugamengidap              Jangan masuk ruanganpasienyang
                     tuberkulosis,
        ataudidugarnenderita
diketahui                  campak  atauvariselabagiorangyangrentan
terhadapinfeksitersebut.

Pengangkutan   pasien :
Batasi pemindahan  atau pengangkutanpasienhanya untukhal-halyang
pentingsaja.Bilapemindahan pengangkutan
                          atau            pasienmemangdiperlukan.
      penyebaran
hindari           droplet
                        nukleusdenganmemberipasienmaskerchirurgis.




                                                                          t20
C. DROPLETPRECAUTIONS

       . Kategoriiniditujukan untukmenurunkan    penularan  dropletdarikumanpatogen
         yang infeksius. Penularan  dropletteriadibila partikelpercikan  yangbesar(di-
         ameter >5 rnikrometer)  dari orangyang terinfeksi   mengenailapisanmukosa
         hidung, mulut atau konjungtiva   matadari orangyang rentan.
         Droplet(percikan  besar)dapatterjadipadawaktuseseorang       berbicara. batuk,
         bersin, ataupun pada waktu pemeriksaan      jalan napas sepertiintubasiatau
         bronkoskopi.
         Penuf  aran melaluidroplet/ percikanbesarberbeda    dengan iransmisi  airbome
         karena  pada fransmisidropielrnemerlukan    kontak  yang dekatantarasumber
         dan penerimapenularan,    karenapercikan   besartidakdapatbertahan     iamadi
        udara dah hanya dapat berpindahdari dan ke ten':pat      yang dekat.
        Ccntoh penyakit   yang ditularkan  melaluidrolet adalahmeningococcal    menin-
         gitis, meningitisatau pneumonia     pneumckokal      yang multidrug  reslster:,
        pedusis,pharyngitis  ataupn€urnonia   streptokal,jnfluenza, parpovirus
                                                                    dan            819.
                                      cii
         Pasien harus ditenrpalkan kamartersendiri.          Bila tidak tersediakama.-
        tersendiri, pasien tJengan rnikroorganisme  penyebab    infeksiyang samadapat
        dirawatdi ruangyang sama alau cohort (bangsal         umum)
         Maskerharusdipakai, seseorang
                               bila            berada  dalam  jaraktigakakidari pasier.
        Akan lebihpraktisjika memakaimaskerdiharuskan        sejakseseorang  memasuki
         ruanganpasien-Pasienhanyadiperbolehkan          meninggalkan    ruangarrhanya
        jika sangai perlu,dan harusmemakai      masker-




| /:
Tabel2: DROPLETPRECAUTTONS

se bagaitambahandari standard p recautions, Dropet p recatrtrbns
                                                               digunakan
untuk pasienyang diketahr-ii
                          atau diduga menderitapeyakitserius dengan
pe.:ularan      percikan
          melalui        pratikelbesar_

 Con'roh  penyakit.
. fnvasiveH. influenzaetipeB. termasukmeningitis,pneumonia
                                                            dan sepsis
- invasive N. nrcningitidis,
                           termasukmeningitis, pneumeniadan sepsis
..
   .fvasives. penumomae  multidrugrepisten,
                                          tenfrasukmeningiiis, pneumo-
   'nia,sinusitis, otitismedia.
                 dan
. bakteriinfeksisaluran nafaslainciengan transmisidroplet :
    (a)' Diphteria(pharyngeat)
    (b) Mycop,iasma  pneumoniae
    (c) Pertusis'
    (d) Pneumoniae   ptague
    (e) Streptococcalpharyngitis,pneumonia, atau scarleifever pada bayi
         dan anak-anak
. Infeksivirus  seriusdengan trasmisidroplet,
                                            termasuk:
    (a) Adenovirus
    (b) Influenzae
    (c) Mumps
   (d) Parvovirus  819
    (e) Rubella

Penempatan    pasien:
Tempatkan   pada uuangtersendiri
                               atau bersama pasien lain dengan infeksi
aktif organismeyang sama,tetapi tidak ada infeksitain. Bila ada karnar
tersendiri,tempatkandalam ruangansecara kohort,dan bila ruang untuk
kohorttidak memungkinkan,  buatlahjarak pemisahminimal3 kaki.antara
pasienterinfeksidengan pasienlain dan pengunjung-

Pem a ka ia n asker:
            m
Pemakaian  rnasker berada bekerla
                 bila   /        denganjarakkurangdari 3 kakidari
pasien.


                                                                      122
 Transport pasien :
 Batasi per.rindahandan transpod pasienhanyauntuk keperluanmendesak.
 Bila terpaksamemindahkan  pasien,gunakanmaskerchirurgisuntukpasien-

D. CONTACT PRECAUTIONS

   Kewaspadaan     iniditujukanuntukpasien  yangdketahuiatau     diduga  menderita
   .oenyakit  yang secara epidemiologis  pentingdan ditularkan      melaluikontak
   langsung (misalnyakontak tangan atau kulit ke kulit)yang terjadiselama
   perawatanrutin,atau kontak tak langsung       ipersinggungan)    denganbenda
   di lingkungan   pasien-
   Pasien harus ditempatkandi ruangtersendiri.         Bila tidak tersedia,  dapat
   dengankohort(bangsal       umttm).
   Sarung tangan harus dipakai sebagaipencegahan,             sebagaimana      pada
   slandar   precautions  terhadapkontak  dengan   darahdanbafran      tubuh-Pada
   contactprecaution    inisarungtanganharus   Oigantisetelah    menyentuh   bahan
   yarlgmengandung      mikroorganisme  dengan   konsentrasi  tinggi (misalnya  tinia
   atau cairanluka).Sarung tanganharusdibukasebelurn                meninggalkan
    ruangandan kemudian      haruscucitangan   dengan   bahanpencuciantiseptik-
   .Jubah   yangbeisihdan nonsteril  harus dipakaibila diduga   teriadi kontak yang
    cukuprapatdenganpasien, pasien
                                biia        iidakdapat  menahari    buang besar
                                                                           air
    (inkotinensia) atau bita ada luka basahyangtidak dapatdiiahandengan
    pembalut.   Jubahharusdilepassebelum      meninggalkan     ruangan
    Contoh   penyalii / keadaan yang rnemerlukan      contactprecautions     adalah
    infeksi atau kolonisasibakteri  yang multidrug   resistens,  colitis Clostridium
    difficile,respiratorysyncytialvirus padaanak,infeksikulitdenganscabies,
    impetigo,zoster{diseminata)   dan viralhemorrhagic    fever(Lassafeveratau
    virus Marburg).
    Varisela  yangdiseminaled   merupakan   contoh  infeksiyang    memerlukan    dua
    macarnprecautions     berdasarkan                      yaitu
                                      carapenularannya, airborne con-      dan
    tact.
    Kebijaksanaan   mengenAispecialorganism     isolatrbnmencakup     kewaspadaan
    terhadap   semuabentukkontakdengan       pasien, peralatan  sekitartempat   tidur
    dan lingkungan   dekatpasien.Penekanan     khusus  padapemakaiari      peralatan
    tersendiri  untukmasing-masing   pasien  dantidakmembenarkan         pemakaian
    alat bersama.  Kebersihan  sekitarpasien  iuga  harusdiperhatikan,    karena  hal
    ini sangatpentinguntuk organisme      seperti                -
                                                   vancomycin resistant     Entero-
    cocci dan Clostridiumdifficile.

123
 Tabel3 : CONTACTPRECAUTIONS
                            rd
Sebagaitambahandari Slanda Precaution,Conta Preca utionsdigunakan
                                               ct
untuk pasien yang diketahuiaiau dicurigai menderitapenyakit serius yang
mudah  menularmelalui     pasien
                     kontak      ataukontakdengan         di
                                                   sesuatu lingkurrgan
pasien.

Contohnya:
- Infeksigastrointestinal,
                         respirasi,                            bakteriyang
                                   kulilatau lukaatau kolonisasi
  multidrugresistant sesuaikeputusan    programpemt erantasan.
. lnteksienterikdangandosisinfeksirendahatau berkepanjangan      temasuk:
  (a) Clostridiumdiftidle
  (b) Enterohemorrhage. Coli, Shigella, hepatitisA. atau rotavirus pada
                           E.
       pasienincontinenta
- RSV,parainfluenza   virus.atau infeksienterovitalpada bayi dan anak-anak
- lnfeksikulityang sangatmenu.lar    atau yang bisa timbulpada kulil kering,
  termasuk:
  (a) Diphtheria (kulit)
  (b) herpezsimplex   virus(neonatus   atau mucocutaneus)
  (c) lmpetigo
  (d) Abses tresar,selulitis atau dekubitus '
  (e) Pediculosisi
  (D Scabies
  (g) Stapylococcal  furu;rcolosis pada bayi dan anak-anak
  (h) Stapylococcal  scaldedskin syndrome
  (D Zcster(disemianta    atauimmunocompiomised       host)
. Viral/hemorrhagicconjuntivitis
. Viralhomorrhagic  fever(lassafeveratau Marburg     virus)

               p
Pe n e m p a tan asien:
Tempatkan    pada kamarsendiriataubersamapasienlain denganinfeksiaktif
organisme                                                           tidak
             yang sama tetapitanpa infeksilain. Bila kamar tersendiri
tersedia,tempatkan   dalamruangan secarakohort.

Sarungtangan dan cuci tangan :
       sarung
Pakailah          waktumasuk
             tangan            dan selamadalamruangpasien,lepaskan
waktuakanmeninggalkan  ruangan,kemudian cucidan gosoktangandengan

                                                                          ta 4
                                                                          lz+
 anti kuman. letelah membuka sardng tangandan cuci tangan,usahakanagar
 tangan tidak menyentuh grermukaanaiau barang apapun yang berpontesi
 terkontaminasi-

Pemakaian lauo I
Pakailah gaun waktu masuk kamar pasien, bila diperkirakan (pakaian)
seseorang yang masuktersebut akan bersentuhandengan pasien atau dengan
alat-alat ir sek-itarpasiefi, bila pasi'enyang dirarvatdiare, inkontinensia atau
pasien iliostomy dan bila pasien yang dirawat luka basah tanpa pembalut.
Lepaslah gaun saat akan meninggalkarl ruangan. Seielalr membuka gaun.
usahakan agar pakaian tidak lagi menyentuhpermukaan yang berpotensi
tcrkontaminasi.

 Tiansport pasien :
 Batasi pemindahandan transpcri pasienhanya untuk hal yang penling.Bila
 terpaksa harus memindahkan keirlarkamar,usahakantetap melaksanakan
.precautions.

Perawatan lingkungan :
Usahakan agar alat perawatan pasien,peralatan sekitartempat tidur pasien
                                              di
dan permukaan lain yang sering tersentuhciibersihkan
                                                   setiap hari.

Peralatan perawatan pa.sien :
Bila mungkin, gunakan oeralatan pasien non-kr-itis dan peralatan seperti
stetoskop, tensimeter,rektal termometerrnasing-masing satu untuk satu atau
sekelompok pasien kohort untuk menghindaripemakaian bersama. Bila
pemakaian bersama tidgk dapat dihindari,peralatan tersebut harus selalu
dibersihkandan didisinfeksi
                          sebelumdipakaiuntuk satu atau sekelompokpasien
lain.




t25
E.             DENGAN
     KEWASPADAAN     PENDEKATANSINDROMIKDAN
               TERHADAP
     KEWASPANAAN       ORGANISME USUS.
                                Tfi

     Beberapa  penyakit
                      denganetiologivirusmaupunbakteri  denganketerbatasan
             penunjang
     fasilitas        trntukmenegakkan           cukupseringdiagnosispasti
                                        diagnosis,
     belum ata; tidak Capatditegakkan.Pada masa tersebut,penularantetap
     teriadi.Dalamkeadaanseperti ini perlu digunakan pendekatansindromik
     dalammene'rtukan   jenis kewaspadaan  yang palingsesuai(tabel4), selain
     StandardPrecautions.   Kemungkinankuman.penyebabperlu disesuaikan
     denganepidemiologi   penyakitmasinE-rnasingdaerah.
                .t

     Di beberapa tempat diAmerika Serikattelahtimbulse.ienis enterokckus    yang
     resistenterhadapVancomisin (Vanomycin resistantenterococci)yang harus
     ditangani sebaikmungkindengancontact precautions      yang memerlukan
     pendekatan             Sebelumpedomantersedia,
                  multifaktor.                            beberapalembaga
     menggunakan'special   organismisolation'   yang dilaporkan    efektifuntuk
     organisme  multidrug-resistant
                                 termasukEnterococcus    resistant,  Enterococ-
     cus faucium, Acinetobacteraniteatus
                                       darr Clostridium difficile(tabel 5).




                                                                           126
    Tabel 4. Sindrom atau kondisi klinik yang secara empirik met.rerlukan
    kewaspadaantarnbahan

    Sindrom / Kondisi klinik:                            Penyebabpotensial :      Precaution
                                                                                  emprns:
    Diare:
    (1) Diareakut dengan kemungkinan   infeksipada        Entericpathogen         Kontak
         pasien inkontinensia
    (2') Diare pada dewasa dengan riwayat                 Clostridiumd!ffrcile    Kontak
         pemakaian antibioiika broad spectrumatau
         langka.lama
                    a
    Me ningit is :
    Rash atau exanthemaumum denganetiologitak
    diketahui
            :
    (1) Petechihe/ echyrroticdengandemam                  Neisseriameningitidis   Droplet
    (2) Vesiculer                                         Varisela                Airbome/kontak
    (3) Makulcpapular denganpilekdan demam                Rubeola (measles)       Airborne
j   Infeksi respirasi :
    ('l) BatuUdernamlnfiftrat     lobus atas paru pada    M. tuberculosis         Airborne
          pasienHIV negatitalaupasiendenganrisiko
        . HIV yang kecil
    (2) Batuk/demam/infittrat   paruciilokasimanapun      M. iubercuiosis         Airborne
          pada pasien HIV positifatau pasiendengan
          risikotinggi terinfeksi
                                HIV
    (3) Batukparok-sisrnal ya!19
                             at:u      rrrenetapselama    Bordetellapenusis       Droplet
          periode pertusis
    (4) lnfeksi respirasi terutarnabronkitisdan croup     RSV atau
          pada bayi dan anak-anak                         paraintluenza
                                                                      virus       Kontak
      .
    Risiko mikroorganisme yang multidrug resis-
    ta nt :

    (1) Riwayatinfeksi atau kolonisasi dengankuman        Eakteriresisten         Kontak
        yang multidrugresistant
    (2) lnfeksi kuliL luka atau infeksi saluran kemih     BaKeriresisten          Kontak
        pada penderita yang baru masuk rumahsakit
        atau lempat perawatan di mana organisme
        rnultidrug resistanttinggi

    Infeksipada kulit atau luka :
    Absesatau luka basah yang tidakbisa ditutup           StaphylococcusaLtreus   Kontak
                                                          GroupA Slreplococcus


    127
    TabCIs.ISOLATION
                   PRECAUTIONS
                             UNTUKORGANISMEKHUSUS

    Suatu perlakuan      precautions
                   isolasi         khususuntuk mikroorganisme  yang secara
    surveilansterbuktimengakibatkan masalah tertentu berkaitandengan obat
    antimikrobaataupenularannosokornial.

    1. Precautions

    Precauticns berkaitandenganorganisme khusus dibarlakukan dengan melihat
,   kasusper kasuspadakeadaan  sebagaiberikut:

    a. Bilapasienmengalamiinteksiatau kolonisasidenganorganismeyangmultidrug
       resistenyanglidakdapatciiobati
                                    denganantibiotka biasa,dan atau :
    b- Bilaorganisme tertentu
                            diketahui
                                    mernilikipotensimerusakoranglaindan atau
       ekologisekitar
                    rumah sakit            dari
                               karakieristik antibiogram, patogenitas,viru-lensi
       atausifatepidemiologisorganisme tersebut.

    2. Praldek yang dianjurkan

    Sebagaitambahan padatehnik
                             Universai              biasa,perlakuan
                                     PrecautionsyaLrg              berikut
    dianjurkanuniukmengurangikemungkinantransmisiorganisme ke  pasienlain,
    petugasatauiingkungan:

    a.   Tempatkan   pasienpadaruangtersendiri mungkin
                                              bila
    b.   Lakukanprecaution              secara ketat untuk semua kontakdengan
                             pertindungan
     .   pasienataudengan   lingkungandekatnya.
    c.   Keharusancuci tangandiberlakukan   secara ketat setelah melepassarung
         tangandansetdlah   melepas semuapakaianpelindung   oranglain.
    d.   Pakailahsarung  tangan untuksemuakontakdengan    pasien,peralatan pasien
         sekitartempattidurdanlingkungan dekat pasien.
    e.   Gantisarungtangan   sebelum menangani peralatan dan setiapkali kotor.
    f.   Pakailah jubahsekalipakai(disposabte)
                                             untukkontaklangsung  denganpasien,
         peralatan yangpotensialterkontaminasi permukaan
                                              dan            kamar.Bukalah  jubah
         sebelummeninggalkan   kamar.
    g.   Pakailahmaskerdan kacamata    pengamanwaktu melakukanproseduryang
         mengeluarkan   aerosolmisalnya        bronkoskopi,
                                       surction,            induksisputum,  terapi
         aerosol Masker
                 dll.       harus dbukawaktu keluardari ruanqan.

                                                                              128
h. Sediakanperlengkapan    satu set untukmasing-masing   pasien.Perlengkapan
                                                       secarabaik).Termasuk
   lidak boleh dipakarbers^.:ra(kecualikalaudidisinfeksi
   irri adaiah termometerelektronik,manonreter.stetoskop, kursirocia,
                                                                    slretcher
   dll. Setelahpasienpulangsernuaperlatan   harusdidisinfeksi,
i. Peiugas rumah langga ditugaskan     untukmembersihkan   semuapermukaan
   datarCekatpasiendengangermicide-     Minimalpembersihan meliputi
                                                            ini       palang
   tempat tidur, meie overbed,jemuran'malam,      lantai dan permukaan   alat
   eleklronik,alatterapirespirasidan barang-barang yangberkontak
                                                  lain              langsung
   dengan pasien.Kain lap''yang clipakai  untuksatu pasientidakbolehdipakai
   untuk ruang dan peralatan pasien lain. Kain lersebut hanrs dicuci sebelum
   dipakaikembaliatau dibuang.

Walaupun  tidakmungkinciapat           lingkungan
                            membersihkan                    patogen,
                                                dariorganisme
kewaspadaan   terhadaporganismekhususini dimaksudkanuntukmenurunkan
jumlah/ angka kolon!bakteripadapermukaan                dekatpasien.
                                       datard?nlingkungar




t29
LAMPIRAN
LAIVIPNRAN
        4
  SURVEILANS




               r 30
                                                         LAMPIRAN IV


                               INFEKSI
                      SURVEILANS     NOSOKOMIAL

A.   PENDAHULUAN

Kegiatansurveilans            nrerupakan
                  e;ridemiologi         komponenpenunjang   pentingdalan
setiap programpengendalian  infeksinosokomial.Informasiepidemiologiyang
dihasiikanolehkegiatanserveilansbergunaunluk mengarahkan strategiprog;am
baik padatahapperencanaan, pehksanaan pu,n
                                      mat     padatah-iap
                                                        evaluasi.Dengan
kegiatansurveilansyang baik dan benardapatdibuktikan'bahwa program dapat
berialanlebihefe.ktif efisien-
                   dan

StudidiAS menunjukkan   bahwa  programpengencJaiianlnfeksi nosokomial (PtN)
dengan kegiatan  surveilansman:pumenurunkan     l<ejadianinfeksi nosokomial
sebanyak327"sedangkan      program  pengendalian  infeksinosokomiaitanpa
surveilanskejaCian infeksinosokomial meningkat18%. Oleh karena itu selain
menerapkancara pencegahan           nosokcmialyang benar dan tersedianya
                             iru-eksi
sarana (alat dan bahan)yang memenuhi    standar rninimal kegiatan surveilans
epidemiologi muttakada pada stiap pragrampengendalianinfeksi nosokomial-
Cleh sebabitu kegiatan           infeksi
                       surveila;rs     nosokomial  selalumasukdalam tolok
ukur akreditasi
              rumahsakitdi negara-negara  maju.

  Sehubungan   dengan  pentingnya peranan         dalammenajamen
                                         surveilans               program
  pengendalian infeksinosokomial, makapedoman disiapkan
                                              ini       bagi petugasrumah
  sakit khususnya aftggotaPanitiaPIN untukmembuatprogramdan melaksanakan
' surveilansinfeksinosokomial.
                  I
Pedornanini memuatpedoman     umumkegiatansurveilansbeserla contoh-
contohnya sehinggamemudahkan     Panitia PIN melaksanakansurveilans-
Diharapkansetiap rumah sakit dapat meren€nakan dan menetapkan ienis
                             sesuaidengan misi dan visi serta situasi dan
surveilansyang akan diterapkan
kondisimasing-masing rumahsa}fl-

Disarankanpula agar setiaprumahsakitmembuat protap sendiri.Angka infeksi
nosokomialyang diperoleh        dimanfaatkan
                        khususnya            untukprogram   pengendalian
infeksi
      nosokomial masing-masingrumah sakil.Angkainfeksincsokomial masing-
masingrumahsakittidaksepenuha-rya dibandingkan
                                 dapat              dari satu rumah sakit
                                                                        llr
ke rumah sakit lainnyadisebabkankarakteristikrumahsakityang berbeda. Sebelum
melaksanakan kegiatan surveilans hendaknya rumah sakit sudah membeniuk
PanitiaPIN termasukmenunjr-ik pelaksanasunreilans denganuralantugas masing-
masir-lg.

Disarankanagar minirnaloenanggungiawab (ketua Panitia PIN) dan pelaksana
sudah mendapat pendidikar./pelatihan   tambahan tentang surveilans epidemiolcgi
infeksi nosokomial- Diharapkan pula Panitia PIN dilengkapi dengan bahan dan
alat yang memenuhi standarminimaluntukmemulaisuatuprogram pengencialian
inieksi ncsokomiai khususrryaprogrhm surveilarrs.Juga pedu direncanakan dana
untuk mendukung kegiatan serta bahan-bahan rulukan tentang surveilans
epidemioiogiinfeksinosokomial,   sertacarapencegaharrdana penanggulangannya.
Setiap staf rumah sakit yang terlibatdalampengendalian infeksinosokomialperlu
disosialisasikantentang kebijakan dan kegiatan prograrn pengendalian infeksi
n-osokcmial

                                                  yang sistematik,analisis
                                        pengumpulan
Definisisurveilansinfeksinosokomialadalah
dan interpretasi yang meneruskandari data kesehatan yang penting. untuk
digunakan daiam perei'canaan penerapan dan evaluasi suatu tindakan yang
berhubungan dengan kesehatanmasyarakat,yang didiseminasikansecara berkala
kepada pihak-oihakyang memedukannya.

B.   TUJUAN & KEGUNAAN SURVEILANSINFEKSINOSOKOMIAL

     0   Menurunnya risiko infeksi nosokomial.

         1.   Memperoleh data dasaryaitu tingkatendemisitasinfeksi nosokomial
              disuatu rumah sakit.

         2.   Sebagai  sistem          dini
                             kewaspadaan dalammengidentifikasi
                                                            kejadian
              luar biasa(KLB)
         a    Memenuhi standarmutuasuhan keperawatan pelayanan
                                                   dan           medis
              yang dapat dipakai sebagaisaranamengidentifikasi
                                                             terjadinya
              malpraktek

         4.   Mengukur  dan menilaikeberhasilan
                                              suatuprogrampengendalian
              infeksinosokomial-
                  paraklinisitentang
      5- Meyakinkan                adanya masalahyang memerlukan
         oenanggulanEan.

      6- Memenuhi        pela'yanan
                   standar        rumahsakit (sebagaisatu
                                                        tolok ukur
         akreditasii-

  Suatusurveilans             tujuan yang jelas dan ditinjausecara
                harusmenrpunyai
  berkalauntukmenyesuaikan
                         dengansituasi,kondisidankebutuhanyang
  berubah.

                   yang
  Perubahan-perubahan mungkinterjaditersebut meliputi:

  .  Adanyainfeksibaru.
  ' Perubahan   kekcmpok populasi
                                pasien,misalnya diperlukan penerapan
    rcara intervensi
                   riredis yang berisikotinggi.
                         lain
  . Perubahan kuman
                pola      penyakit,
                                  serta oerubahanpola:'esistensi
                                                              kuman
     terhadap antibiotikzr.

                dan
  Pengumpulan analisis     data surveilansharus dilakukandan terkait
  dengansuatupencegahan-   Oleh karena itu sebelummerailcangsistem
  dan melaksanakan           tersebutpentingsekaliuntukmenentukan
                    surveilans
  dan :'nerinci
             tujuandarisuryeilansterlebihdahulu-

           angkainfeksispesifik d! rumah sakit.
O Menurunkan

                   dari
  Tujuanlerpenting surveilans   infeksi nosokonrial
                                                  adalahmenurunkan
  risikolerjadinyainfeksinosokomial. Untuk mencapaitujuan ini, maka
  penentuantujuanspesifiksurveilansini harus didasarkanatas cara
  penggunaanidata,  sumber daya manusiadan dana yang tersediauntuk
  itu.

  Tujuanspesifiksurveilans dapatberorientasipada "outcome" ataupun
                         ini
  pada proses-

                          berorientasicoutcomeadalah kegiatan yang
  Tujuan spesifiksurveilans
  ditujukanpada pemantauan  angka infeksi nosokomial(insidens atau
  prevalens).

  Tujuanspesifiksurveilans         prosesadalahkegiatan
                         berorientasi                  surveilans

                                                                r 33
          yang dituiukanpada pemantauankegiatan upayapengendalian
                                              /                   (cara
          cuci tangan, pemasangan    pemas?:.:Jan
                                lnfus,                 keiersediaan
                                                kateter,           alat-
          dana dan sebagainya).

          Namundemikian,                     akanrtenurunapabilaticiak
                             artidarikegiar:.;t                       disertai
          peniefasan dari tujuan outcomeyang               ada banyakmacam
                                              rinci.Meskipun
          tujuan surveilansyang sahih,tujuanakhimyaadalah mencapaitujuan
          outcome.lraitumenurunkan inteksi.
                                      laiu                    angkamortalitas
                                                angkakesakitan,
          dan biaya..

      J   Menciapatl{an data dasar endemik

          Pada dasarnya data surveilans infeksi nosokomial digunakan untuk
          mengkuantifikasikanrate dasar infeksinosokomialyang endemis. Dapat
          diketahui seberapa besar risikoyang dihadapi oleh setiap grasienyang
          dirawat cii rumah sakit, Sebagianbesar(90-95%)da:i infeksi nosokomial
          adaiah endemik, dan ini di luar dari KLB infeksi nosot(omialyang telah
          dikenal- Oleh karena kegiiitan surveilansinfeksi nosokornial harus
          dimaksudkan uqtuk menurunkan     angka laju endemik.

          Meskipun 91 % dari ru:-nah             menggunak'on
                                   sakitdilapcrkan              data surveilans
          uniuk meneniukan angka laju endemik,namun pengumpulan daia saja
          tidak akan mempengaruhirisikoinfeksijika tidak disertai dengan upaya
          pencegahan infeksiyang memadai. Dengandemikian kegiatan surveilans
          akan sia-sia belaka bahkan selainmahalluga sangat tidak memuaskan
          semua pihak.

      o   Mengidentifikpsi Kejadian Luar Biasa (KLB)

          Bila angka endemik telah dapat diketahui,maka kita dapat mengenali
          bila terjadi suatu penyimpangan
                                        dari angka.clasar-tersebut,
                                                                 yang kadang
          me ncerminkansuatu                                               l.
                             tig9g]yg-_q,*il'outbreak) infeksi nosokomia
          Untuk mengenaliadanya penympangan   ;iOf"afaitri#eksisehinggadapat
          menetapkanbrahwa  kejadian tersebut merupakan                  luar
                                                           suatu ke_iadian
          biasa,sehinggasangatdiperlukanketerampilan khususdari padapetugas
          kesehatanyang bertanggung iawab.

          Keterampilan      harus
                     tersebut    mennadaisehingga
                                              seimbangdengan waktu
          yanghilanguntukmengerjakan
                                  pengumpulan surveilans. karena
                                            data        oleh
t34
    seringkali proporsi
                      .nfeksi        yangterjadipadaoutb ak tersebul
                            nosokomial                  re
    sangatlahkecil,mungkin  hanya5-1O"/".

    Tanpa adanya keterampilan tersebutmaka pengumpulan  data yang
    dilakukantidak ada gunanya                     luar biasa akan
                             samasekalidan kejaciian
    lewat demikiansaja.

    Dan lagi, sering laporantentangkecurigaanadanyasuatu KLB infeksi
    nosokomial lebih cepat datangdari secrairg Cokier atau teknisi
    laboratoriumyangjelidaripadahasilanalisis surveilans
                                            data          parapetugas
    pengendalian  infeksinosokomiai.Kelemahandalamkecepatan   waktu ini
    sering menjadiketerbatasan penggunaan
                               dari           data surveilaris.

A   Meyakinkan petugasmedis

    Salah saiu iantangandari salu programpengendalian          infeksiaclalah
    m e ya kin kanterraga                                   y
                           medisatautena g ak e s e h a t a n a n g la in u n t u k
    m e n e r a p kan pencegahaninfeksiyan g d ia n ju rk a n e p e rt i h a ln y a
                                                             s
    kewaspadaan universal alau universa! p recaution-

    Pengetahuan yangdidapat darikepustakaan          padaperilaku
                                          hanyaefektif
                                           yang
    meieka apabiladitunjang infcrmasispesifik nyatamerekahadapi
                          oleh
    dan mereka percaya-

    Sering kali informasi dari kepusiakaan,kurangberhasilmemaparkan
    permasalahanseperti   yangmereka hadapisehari-hari,
                                                     sementara     seiiap
    rumahsakititu sendirilahyangpaling      dapaldipakaisebagaiacuan
                                      efektif
    d a la m m engubah perilaku sumber d a y a ma n u s ia n y a k a re n a
    menggambarkhnpermasalahan      yang aktualdan dapatdipakaisebagai
    titik tolak penerapancarapencegahan infeksinosokomial-

    Data surveilansdipercaya dan dijadikansebagaipedomanbila diolah
    secara baik dan profesional  serta disaiikandan diumpan balik /
    i:rformasikan
                secararutindengan carayang menarik
                                                 kepadapihakterkait.

    Umpan balik mengenaiinformasi biasanyasangat efektif dalam
                                       itu
    menggiring     lenagakesehatan
                                 untuk        upayapencegahan
                                      melakukan              infeksi
    nosokomial     dengan menerapkan
                                   kewaspadaan       dalam
                                              universal   pekerjaan
    seh a r i- h a ri.
                                                                              r 35
D         Mengeval uasi sistem pengendalian

                                                     dangan adanya data surveilans
             Setelah permasalahandapat te;identifikasi
             dan upaya pencegahanatau pengendalian     telah dijalankan,maka masih
             diperlukansurve:lanssecara bexesinambunganguna meyakinkanbahwa
             permas alahan yang ada benar-benar telah terkendali. Dengan
             pemantauan yang terus menerus, maka suatu upaya pengendalian yang
             nampaknya rasional kadang akhimya dapat ciiketahuibahwa temyata tidak
             efektif sama sekali. Sebagaicontch, bahwa perav,ratan meatus setiap hari
             untuk mencegah infeksi nosokomia!salurankemih yang nampak ras:onal,
             namun data surveilans menunjukkan bahwa ticjak ada manfaatnya.

      O      Memenuhi persyaratan administrasi (seperti AKREDITASI)

             Dengaq adanya peratuian yang mengharuskanrurrt?hsakit melakukan
             sun,eilans infeksi nosokomialsebagai persyaratanunluk mendapatka;r
                       maka seringka!i
             akreditasi,              datasurveilanshanyadipakaiuntuk rremenuhi
             peraturan tersebut.

             Pengi;mpulan               yang semata-mata
                          daia surveilans                hanya untuk i-r,emuaskan
      '      surveyor yang datang secara berkala. mungkin setiap :3 iahun sekali,
             adaiahsuatu pemborosan  sumbe;dayayang luar biasa ianpa memberikan
             manfaat kepada rumah sakit ataupuntenagayang ada. Tuluan surveilans
             untuk menurunkan risikoterjadinyainfeksinosokomial.

      fl     Untuk mengantisipasi tuntutan mal-praktek

            Dahulu' dikhawatirkan bahwa pengumpulan data surveilans infeksi
            nosokomial dapat dipergunakansebagaibukti untuk menuntut rumah sakit
            sehubungan dengan terjadinyainfeksi nosokomial-Namun belakangan
            para ahli hukum dapat menyatakan bahwa dengan adanya surveilans
            yang baik membuktikan bahwa rumah sakit telah berusaha untuk
            mengendalikan masalah,bukannyamenyembunyikan- merupakan bukti
                                                               Ini
            penting untuk melawan-tuntutan yang tidakdiinginkan.Sebagaitambahan
            bahwa rekam medik -peroranganyang ada pada panitia ptN adalah
            merupakan rahasia jabatan yang tidak dapat dibeberkan di depan
            pengadilan. oleh karena itu, data surveilans menjadi penting dan lebih
            banyak membantu dalam melawanlunlutanmal prakiek.dan iarangsekaii
            akan memberatkan.

r36
  PENGERTIAN.PENGERTIAN

  1. Surveilans
              infeksinosokomial
                             :
     Pengamatan   terus rnenerus"
                                aktifdan sistematis
     penyebaranlN pada suatupoputasiserra            terhadapkejadiandan
                                            p"ri"ti*" vang;"njp"ngaruni
     terjadinyainfeksinosokomiat-'

 2- Populasi
           berisiko
                  :.

    Populasiy"ng              mendapatfan
                   Tl-"Tiar                   infeksi,   misarnya      barisiko
                                                                populasi
    untuk infeksisaturankemih adauir
               -' -J{s'qrr           aqalan Semua OaSien dengan katetef Ufln
    menetap-               '\errrrrl        "";;;;";'l:i

 3' l-im / PaniiiaPiN.terdiri
                            dari anggotamunidisiprin            yang
    bertanggung  jarvabpenuht"rnaiJf pengendariandi rumahsakit
                                                  i"f.k;; nosokomiar.
4' Perawat pengendaliinfeksinosokomiat'ihrection
   adalahpeiawatyang merupakan                     controtNurse = tcN)
                                  anggotapanitiaplN dan bertanggung
   j aw ab se b a gaipelaksana
                              harianpeng e n d a lia n f e k s in o s o k o mia l
                                                     in
   termasukkegiatan   surveirans
                               epidemiorogi
                                         infeksi   ncsokomiaf.
5. Kejadianluar biasa(KLB)= wabah=
                                    epidemik.
   Tmbutnya kejadianpenyalctter.tentu
                                       (mis ; insidensISK) pada area
   geografisiertentu(mis;rumah
                               sakit)secarabe,,makna dampakyang
                                                     dan
   nyata dari insidensnormal(enOemii) penyakitinfeksitersebut.
6. End e m ik:    ;

   Keadaandimanasualu penyakif   atau penyebab
   menerus tetap ada pada populasimanusia            secaraterus
                                              penyakit
                                         dalamsuatuarea gieografis
   tertentu(mis;rumahsakit).

   Rate, Ratio, proporsi

  Merupakan ukuran.
                  reratifyang digunakanuntuk mengukurbesarnya
  kemungkinankejadian          Jtau morralitas)
                     imoiUiOiias             suatumasalah
      kesehatan termasuk infe.isinosokomial:

      a- Rate nlengukurkemungkinanmunculnyasuatukeiadian pada popu!asi
         tertentu misainya infeksi nosokomialdi Ruang Bedah.

         Rate:

         .   Insidens Rate    :   Ukuranfrekuensikasusbaru pada pooulasidan
                                  pada kurun waklu tertent'u

         .   Prevalence Rate: Ukurah frekuensikasus baru dan lama oada
                              populasi dan kurun waktr.ttertentu

         .   Attack Rate      :   Sama dengan insidens rate tetapi digunakan
                                  pada kejadianluar biasa (wabah) biasanya
                                  dinyatakandengan persen ("/").

         .   Mortality Rate   :   Ukuranfrekuensikematian  pada suatu populasi
                                  dan kurunwaktu terlentu.

         .   CFR              :   Ukuran/propoi'sikasus yanj r.-:eninggalkarena
                                  kondisi tertentu (infeksi nosokomial) pacia
                                  populasi dan kurun waktu tedentu (case fatel-
                                  ity rete)

         .   Rumus:           Rate=K+
             X: Fembilang : kejadianyang akan dirrkur(morbiditasarau
                            mortalitas).
             Y : Penyebut : populasiberisiko
                                           terhadapkejadiantersebut.
             K: Konstanta : 1O0,1.OOO,       atau
                                       1O.0OO 100.OOO

      b. R ati o:

         Perbandingan suatufrekuensi
                                   kejadiandibandingkandengan kejadian
         yang lain, misalnyainsidensrate ILO di Ruang PerawatanBedah
         dibanding dengan insidensrate ILO di Ruang Kebidanan dan
         Kandungan.


138
R u m u s:              =
                    Ratio 1. +

        X: Pembiiartg       kejadianatau suatu kejadian (insidensILO)
                            patja.suatu kelompokatau populasitertentu
                            (insidens di ruangBedahl.
                                     ILO

        Y: Penyebut         Frekuensisuatu kejadian  yang sama(insidens
                            ILO)padasuatukelompok      aiau populasiyang
                            berbeda (ln s id e n slL O d i Ru a n g Ra wa l
                            Kebidanan Kandungan).
                                     &

        K : Konstanta       1


c. Proporsi

   Presentase
            suatukejadiandari selui'uhjumlah kejadiandari suatu seri
   data-

        Ru m u s:    Proporsi 100. X
                            =
                                     Y
        X: Pembiiang        Jumlah kejadian(mis:jumlahILO)yangtimbul
                            dariseluruhkejadian                oada
                                                     nosokorhial
                                               infeksi
                            populasiCankurunwaktutertentu

        Y : Penyebut        Jumlahkejadian  keseluruhan      pada populasi
                            dan kurunwaktuyangsama
                I
                            (mis : jumla h s e lu ru h p e n y e b a b in f e k s i
                            nosokomial).

        K : Konstanta       100




                                                                              r 39
O. METODE               NOSOKOMIAL
                  INFEKSI
         sURVE|LANS
                                                     beberapa
                                          dapatdikenal
                             makasurveilans
          Menurutmetofcloginya                              ienis'

                               Nosokomial-
                         lnfeksi
          Jenis Surveilans

          1.    SurYeilans Ko:'nPrehensif
          2.    Surveilans Selektif
          3.    SurueilansInfeksiNosokomialdengan   sasarankhusus
          4.    Surfeiians tnfekii Nosokomialterbatras periodik- -
                                                     dan
          5.    Surveilans Infeksi Nosokomialpascarawat'



                          Ketebihandan kelemahan masing-masing metode

        METOOE                             K EL ? B IH A N                                      KELSMAHAN

Surveilans
komprehensif
.       lnciderce            MeMapalk3ndata dari semua ienis inleksi dari      Mahat,padat karya. iidak munokin dip€rbandin,okan
                                                              Lhjster-
                             semuaparienidapalrnengoefltililasi                dengan njtnah sakil lzin-

 .' Prevalence                                              s€6lit stmb€r
                             Lebrhmrah danlrarryarnernedukatl                  Sering te4ad o'reregiinasi tentaog risiko paien
                             daya:dapatpldadlal(gPka.l dengLan berqilirao
                                                             ca.a              tntl,k c-.eridapatl.an
                                                                               u r {u n .:r sr u d ? c'.6 in(ek'i msokomial'- - :;da\ aku'a!
                                                                                                                          - -         - --     |

                             Oapatdigdnakan  uniuk tnendapatkan data awal      daiammengestifrasiPopulasiperoedaan anta( I
                             sebagaidasarpenerapansHem sineilats njiin         kdonrpo* pop.iasi pasim.
                                                                                                                            I
    . Surveilans             Ffeksbd dan Capat dl(omtir.asi dengBnmetode       Mrrj3ftint?Jak|r€nganb3(tan t-JiuanpeFcegahanI
      setektil rnecervl      lan-                                              ;rr4 phs: detEa$,-ralornFrxt!(i.t hutang ac€
      tempal intekd                                                            kuat Capalke6rudalamBrenenlukankJu<er.

    .   Surveilans           Menekankanpasren yang b€risiko lingqi. harrya     Untuk rnendapalkan   angka dasar diperlukan
'                            memedr.*an       SOM.
                                       sedl.u'l                                gJ^€ia s yatE b€rteinambur$an firurBkinteriadi
        selektil menrut
        unit                                                                   kekelituanlfide{.

    .   B€rgilir              Lebihmurahdantehl menyir€||(atwakludbandrE        Oapal salah lduger
                             'surveihrs bddencz. sediktt SDM: seraua unit di
                              rumahsakil pencegahan gifiran

        Surveilars inletsi    Memanlaatkan   srnber daya denganletrih elehil    Trdak mendapatkan ar€ka dasat
        nosokomial            denganluit an psrcegahan fang idas
        dengan sasararl
        ktxJsns

        Surveitans           Memberikanangka dasar dengan waktu lebih           Manrr6fi inkansalah kluslet
        periodk terbalas     singkat dibandrg dengan itrtence.

                             Meriogkafran crsefndng secara benmkna              Meruddafi rtasatah pada peoguMan waP'tudan
        Surveilans pasca
        p€rawat                                                                      yarB tiitakdapatditindaklaniuti.
                                                                                banyak




t40
c
    PENERAPAN              NOSOKOMIAL
                     INTEKSI
            SURVEILANS


    Jenis Surveilans
                   infeksi        :
                         nosokomiai

                                                    melalui
    1. ldentifikasiinfeksinosokornialyangdiarna.tirutin
                                     akan                  kegiatan
       sunreilans.
    2. Perencanaan  pengumpulan data
    3. Pengumpulan   data
    4. Pengolahan penyajian
                   &         data
    5. Analisis              data
               dan lnterpretasi
    6. Pembuatan   laporan& rekomendasi                             '
                                       tindaklanjutserta dir;eirii;,.-
    , informasi.




    Pada awal pelaksanaan surveilans hendaknya semua langkah diatas
    dikerjakan, jika surveilans sudah berialan rutin yang dikerjakan adalah
    langkah 4-6.:namunbila surveilanstidak berialansebagaimanadiharapkan
    perlu ditinjau kembalimetodesurveilans yang diterapkanmulai dari langkah
    pedama.

    Disarankan agar kegiatan surveilans didahului oleh pembentukan Panitia
    Pengendalian infeksinosokomial (Panitia PIN).
    1. ldentitas Masalah Infeksi nosokomial
       Penentuan masalah infeksi nosokomialyang akan diamati rutin melalui
       kegiatansurveilans
                        mernerlukan  waktu. Beberapa sumber yang dapat

                                                                         l/1   I
                                                                         l+l
                                     masalah infeksi nosokomialtcrsebut,
          digunakan untuk identifikasi
                                                                    :
          dapat dilakukanderrganbeberapacara antara lain berdasarkatt
          .     laporan personilrumah sakitbersangkutan
          .     pengalaman rumah sakit lain
          .     tinjauan literatur
          .     melakukan kajian atau pengumpulan data dasar.

          Pengumpulan data dasar (tingkat endemisitas) infeksi nosokomial
          dilakukarr derrgan studi retrospektif,prospektif selama kurang tis3
          bulan alau suruey pointprevelensdll.yang dilakukan oleh pelaksana
                               tirn
          surveilansdan anggota lain.

          Pengurrpulandala dasardapatdilakukan seluruhrumahsakit,tetapi
                                              di
          untuk praktisnyadian.iurkan
                                    untukmengumpulkan data dasardi rudng
          perawatan yang diangg3pmempunyairisiko tinggiinfeksinosokornial
          misalnya ruang Perawalan Bedah, Dalam, Kebidanan dan
          Kandungan, ICU dan ruang lain yang berisikoinfeksinosokcr,rial,
          baik disebabkan j-enispelayanarrmaupun disebabkankaral<teristik
          pasien sendiri.

          Langkah selanjritnvaadalah :

          /      fuienghitungangka infeksinosokomial    (insidensatau prevalens
                 rete). misalnya Insidensrate (lR) infeksinosokomial di Rumah
                 Sakit'XX" dalam kurun waktuJuni vdAgustus 1999,rata-rata=
                 1O%, dimana proporsi tLO 35%; ISK : 115 Flebitis2O "r" dan
                                                            %;
                 Pnemoni : 1O"/".

          ./     Menyusun rencana pendanaanprogram pengendalianinfeksi
                 nosokomial termasuk dana kegiatansurveilans(alatbahan,biaya
                 pertemuan dan insentifpelaksana)-

        2. Rencana Pengumpulan Data

          Proses pengumpulan data dapat menyitabanyak waktu kaiena itu
                                        agarwaktupengurnpulan
          perlu perencanaanyang hati-hati                   data lebih
          efektif

           a.                               vano akan dilaksanakan
                   MenentukanJenis Surveilans
I A')
laL
     Setelahmendapatgambaran  angkainfeksinosokomialpelaksana
     surveilansbersama-samadengan anggota Tim PIN la-irr
     merientukan               yang akan dilaksanakan
                ienis surveilans                       cienga:'t
     membandingkan   hasil survey dengan tinjauanliteraturdan
     pengalaman rumahsakitlainyangsudahberpengalaman.
               dari

     Dasarpertimbangan       jenis surveilans
                     pemilihan               :

     . waktu
     . Tenaga
     . Msidan misi rumahsakit-

b.   Dasarpertimbingan pemilihanjenisinfeksinosokomialyang akan
     diamatiberdasarkan  pengukuran                    l,
                                         (lihatlampiran hal 160)
                                   relatif
     rnenentukan       populasi
                difinisi       paslen-

                                          :
                                berdasarkan
            pasiendapatditentukan
     Populasi

                                      Dalamdll).
     . Jenispelayanan ruangrawat(Bedah,
                    /

     . Faktor risiko spesifik (pasie n d e n g a n o p e ra s i b e rs ; h ,
       pemasangan        meneta.p
                   kateter        dll).

     Contoh:

     surveilansrutinuntukseluruhjenis infeksinosokomialdilakukan
     di ruangperawatan tertentu                     Anak, Dalam,
                                saja misalnyaPenyakit
     bedah serta Kebidanandan Kandungan(Obsgyn)atau secara
            jenis surueilans
     selektif                dilakukan terhadapinfeksinosckomial
     lertentusaia misalnya ILO bersihdibeberaparuangperawatan
     yang berisikoILO bersih-

c.   Menetapkan         infeksi
                 difinisi                              lihat
                                      yangakandigunakan,
                              nosokomial
     difinisipada buku PedomanPengendalian InfeksiNosokomial
     lanrpiran (lnfeksiNosokomial)
              1

d.                        yang akan dikumpulkan
               dataspesifik
      Menetapkan

      salahsatutujuanpengumpulan adalah
                              data                 laju
                                       untukmengukur

                                                                        | +- )
                                              karenaitu dibutuhkan2 jenis
      infeksi (insidens rate) infeksinosokomial
      data yaitu data pembilang dan penyebut.

      .    Data pembilang:

           Data pembilang adalah semua pasien yang ierkena infeksi
           nosokomial. Biasanya informasiminimal yang diperlukansecara
           rutin adalah :

           ./   Data cienrografi : nama.umur,ieniskelamin, RS / no. reg-
                                                           no
                                                     ruangperawatan jenis
                                   ister(rekamrnedik),             /
                                   pelayanan tanggalmasukkeluarrumah
                                             &
                                   sakit-

           ./   Jenis i lokasianatcmiiniekslserta
                                                tanggal            gejala
                                                      mulaitimbulnya
                infeksi

           /    patogen penyebab

           Informasi tambahan varrqdibutuhkanditentukan
                                                      oleh :

           ./   Bagairnana 0"," ufu" dianalisis dan digunakan
           /    Data muciah diperoleh atau tidak
           ,/   Tenaga cukup atau tidak.

           Bila secara rutin data i,apg diinginkantidak dapat dikumpulkan,
.          lakukan pengumpulan data secara periodikatau sewaklu-waktu
           sebagai suatu survey atau penelitian,Pada invesligasiKLB dapat
           dikumpulkan data tambahan     yang dibutuhkanuntuk mengetahui
           sumber dan cara penularan.

           Data tambahan yang dibutuhkanumumnyaadalah :

             /   Nama ahlibedah
          .- .,/ Antibiotika yang digunakan
             ./ Faktor risiko

           Data yang tidak akan digunakanjangandikumpulkankarena akan
           buanq waktu dan tak berquna.


t44
                       mungkin namun mencapai tujuan-
Kumpulkandata senrinimal

Srimber Data:

Sumber piimer (utama) yang sering digunakan :

/     Laporan laboratoriumrnikrobiologi
,/    Kurva suhu
./    Catatan pasien, catatan dokter atau perawat (status pasien)
/     Catatan Obat
/     Laporan personil rumah sakit lainnya, baik lisan maupun tertulis.

Sumber seliunder

./    Laporan farmasi yang mungkin mengindikasikan adanya infeksi
      (distribusiantibiotika)
                            -
/     Laporanotoiisi dan laporanpatologilainnya-
/     Laporan masuk rumah sakit (diagnoslsmasuk) yang memheri
      informasi adanya infeksi komunitas {masyarakat) atau infeksi
      nosokomialpadawaktu dirawat di rumah sakit sebelumnya'

/     Laporan pemeriksaanradiologi-
/.    Laporan pasien se.reiahpulang (pasca rawat). Laporan ini sulit
      Cipero!elt.
,/    Laporan pemeriksaan mikrobiologi daf sampel llngkungan (tidak
      dianjurkan rutin, dilakukan hanya bila ada indikasi).
 ./   Laporan hasil investigasiatau penelitian-
             i



 Data PenYebut

 penyebut adalah       pasien
                 seluruh      yangberisikoinfeksi         Data
                                                 nosokomial-
 penyebut yangakandikumpulkan   tergantungmetodesurveilans{enis
 infeisiyangdipilihrumahsakitdan kegunaan              misalnya
                                           datatersebut,
 datapenyebut untuksemua jenisinfeksinqsokomial RuangPenyakit
                                                di
 Dalam,sedangkan    untukllo bersih data penyebutadalahsemua
 pasiendenganoperasiluka   bersih-


                                                                     I A<
 e. Menentukan kapan data dikumpulkan

               Sebaiknyadatadikumou|kansaatpasienmasinberadadirun]ahsakit
                                                       dikumpulkan' sedangkan
               karena setelah pasien pulang data sulit
                                                    faktor berikut:
               frekuensipengumpulandata tergarrtung
               . Jurnlah pasien
               .   Lama harirawat rata-rata
               . KarakteristikPoPulasiPasien'

  f.   Menentukan SiaPa PengumPulData

       .                                         melaksanatian
                               yang dianggapmampLr            surveilans'
               Tetapkankriteri-a

               Disiplinmanapunyangmenjadipe|aksana.survei|anstidakmasa|ah
                                                                  keterampilan
               yang pentingt"t"n,-ni kritlria rninimalpengeiahuan'
                                     sebagaiberikut:
               maupun sikap (attitude)

               /' Paiofisiologi in{eksi
                                      -
               / M;krobiologi
               l.|lmuPenyakitDalam&Bedah(Medical&Surgical|''lursing)
               ./ EPidemiologi
               .i Statistik dasar (deskriotif)
                                                                       ship) yang
                               .nL, ;nrnu sia (interpersona! relation
               ", Hubungan                                         di rumah sakit
                    rnampu rneyakink'anpara pengambit keputusan               staf
                    pentingnya'p""g""d"ii"n in{ekJi nosokomialdan memotivasi
                                                                pencegahan    dan
                    rumah safl ,r,it"tt melaksanakantindakan
                    me|engkapicatatan(status)pasienc|engangetiaptandadangeja|a
                                                                masing-masing'
                    infeksi sesuai dengan standar protesi
                    Pengalaman Oi ntgl'" maju suatu        pengendalian infeksi
                                                                          perawat
                    nosokomiatru.rnefertitdan efisienialah menggunakan
                                                                         termasuk
                     sebagai petarcJna pengendalianinfeksi nosokomial
                                                                   (lCN)'
                     surveilans,yang disebul !nfectionControl Nurse

           .    Tetapkan uraiantugas, petan,fungsidan tanggung iawab'
                                                         yang dipilih) apakah
           .    Tetapkan kedudukan (kalau perawat                               n
                                                                                2
                kedudukannyadibawahbidangkeperawatanbaiksebagaii".b":?,l a
                                                     perawat tersebul menduduxt 1t
                struktura! atau iungsional disaiankan
                jabatan fungsionai-Jelaskan    hubungan keriasamadengan ketua
                PanitiaPIN dan anggotalainnYa'

t46
        sebelumkegiatansurveirans
                                infeksinosokomiar
                                                dimurai,
                                                       dianjurkan
        untukterlebih
                    dahulumembentuk panitiaplN.

        Pelaksana    surveilansinfeksi
                                     nosokorniar                panitiaprN
                                                adarah  anggota
                          posisikuncidarampengendarian    infeksi
                                                                nosokomial
        llang.menduduki
        Karena  sebagaiperaksana    surveirans memiriki
                                             dia           informasi
                                                                   tentang
        besarnya   masalahinfeksinosokomiar,  faktor risikodan masarahrain
        yi:9^l-"I\"jtan dengan kineriastaf rumah sakftdatampetaksanaan
        Kewaspacraan     universar dan aspek fain yang berkaitandengan
        pencegahan    infeksi.

 g. FormulirpengumpulanData

   .    Ru ti n:
        Memuat   dataminimalyang
                               dibtiluhkan mudah
                                         dan   mengisinya.
   '    Kl-B

       Memuatdatatambahan yangdibutuhkan
                                       untukinvestigasi yakni
                                                     KLB
       yangberkaitan
                   dengan:
       ,/ Sumberpenularan
       ,/ Carapenula,-an
       ,/ Aspek lain yang diperlukan u n t u k p e ; . la n g g u t a n g a n
                                                                           atau
          memutuskan       penularan.
                     rarrtai

       -) Bagaimanapun
                     bentukfonnuriryang
                                      digunakan
                                              tidakmasatah
                                                         yang
          pentingmemuatsemuadataminirnar
                                       yangdibutuhkan praklis
                                                    dan
          dalampenggunaannya.

       (contoh : formurirpengumpuran
                                   dara rutin infeksinosokomiar
                                                              rihat
       lampiran hat .161).
               2

3. PengumpulanData(Monitoring)

  setelahprogram  pengendalian  infeksinosokomial
                                                dimulaiterlebihdahulu
  sosialisasikanseruruhaspekkegiatanpengendalian   infeksinosokomial
  pada staf ruangandan staf laint6rkait.


                                                                          I..11
      a- SumberData:

          .   Laporanlaboratorium
          .   Catatan/ statuspasien
          .   Kunjunganpasien'
          .   Laporanpersonilrumah  sakit.

      b. ldentifikasiInfeksiNosokomial

              Informasikan ke ruang-ruangterkait tentang pengeridaliandan
              surveilans infeksi nosokomial di rumah sakit bersangkutan dan
              jelaskan kapan pengumoulandala dimulai dan mintalah agar
              perawat dan dokter ruanganbekerjasamadalam pengendalian
              infeksi nosokomialdan mintalah jelaskanpentingnya kelengkapan
              catatan pasien (status)sesuai dengan standar profesi masing-
              masing.

              Siapkan buku pedomans_urveilans             inleksi nosokomial
                                                 / definisi
              sebagar rujukan penelrtuaninfeksi nosokomial.

              Siapkan semua formulirpengumpulandata yang dibutuhkan

              /    Daftar lsian

              '/   Check Lisl proses penerapan kewaspadaanun;versal,lihat
                   lampiran 3 hal 162 yaitu daftar tilik pengendalian:nfeksi.

              /    Bukui catatan untuk mencatat temuan di ruangan yang
                   berkaitan dengan pengendalianinfeksinosokomial.

              Lakukan kunjungan ruangan

              Cari indikasi adanya infeksinosokomialdenganrnelakukan telaah/
              kaj:an laporan laboratorium.Dapat pula dilakukan kunjungan
              laboratorium untuk mengetahuiapakah ada hasil isolasi positif
              pada waktu tersebut di ruang perawatan dimana dilakukan
              kegiatan surveilans.



t48
                                              tanda infeksi
 / Kajiancatatanatausiatuspasienuntuk rr.elihat
   danhasilkultui. ada,
                 Biia   pasienirrfeksi
                                     nosokomial catatkapan
   rnulaiteriadi, kapanpasienmasukrumahsakit-
               dan

 /    Jikagejataatau tanggalmulainyatanda infeksi kurang lefas
     tanyakandokteratauperawatpasienyang bersangkutan'

 / Kajiancatatanobat untuk-melihatpasien dengan antibiotika
   (kemungkinan infeksinosokomiai)-

 / Kajian kurva suhi.:untuk mengidentifikasipasien dengan
   demam..

 / Tanyakanpada                     apakah
               perawaf dokterruangall
                     dan                  ada pasien
   denganinfeksi
         ..f


 / Masalah / kendalapengunrpulandata :

     '    Status pasien tidak lengkap baik cataian dokter maupun
          pasien-
     '    Pemeriksaan laboratoriurnjarang dilakukan
     '    Pemakaianantibiotika  yang kurarrgrasional.

                                  caiat pada Caftarisian'
. Jika ada pasien-infeksincsokomial

. Lakukan pengecekan apakah pasien infeksi nosokomial
  sebelumnya (kalauada) sudah sembuh atau belum-

. sambilrirelakukankuniunganruangan perhatikanapakah ada staf
  baik perawat, dokter maupun keluarga pasien yang tidak
  melakukan standar pencegahan inleksi dengan benar jika ada
  catatan pada formulvcheck listpenerapanprosedur kewaspadaan
  universal.

. Perhatikan apakahfasilitas/ bahan seperti anti septik, sabun dll-
  tidak digunakandengan benar.

. Sewaktu - waktu lakukanwawancara / diskusi dengan perawat

                                                               t49
        ruangan tentangketersediaan         untuk
                                    fasilitas           pencegahan
                                                 tindakan
              meliputi
        infeksi       kemudahan  memperoleh,   kecukupan persediaan,
        kenrudahan pemakaian      kenyamanan
                              ciarr

                diatas
        Informasi     pentinguntukperencanaan penyediaan
                                                       sarana/
        bahandan menyusun  program pelatihan diperlukan.
                                           bila

4. Pengolahan& Penyajian
                       Data

  a. PengolahanData

        Tujuan:

        Untuk memberiinfornrasiyang  berEuna  bagistrategipengendalian
        infeksinosokornial.
                          Disampingitu pengolahan   data bergunauntuk
                  serta validasidaia, juga rnernucahkan
        konsolidasi                                     penyaiianciata.

        Sarana

        / Soft ware computer
        / Manuai biia tidak ada kompuier.

        Pemindahan data ke daftar tabulasi

          Memilih kategori data yang akan diolah

          Cara:    i,

          Lakukanpengelompokan ketegori
                                   /           datadalam sumberf ormulir
          tabulasi,jika pengolahandilakukansecara    manual(contoh lihat
          lampiran4, hal 163),jika data diolahdengankomputersiapkan
          software pengolahan data_ pengelompokan data untuk
          pengolahan rutin minimal adatah jenis infeksi nosokomial &
          Ruang Perawatan. Secara berkala dapat dikelompokkan
          menurut jenis kelamin, irmur, lama hari rawat, pemakaian
          antibiotika,dan kultur positif,jenis tindakandll.

          Dari daftar isian pindahkandata ke formulirtabulasidenqan
          cara melidiseperticcntoh berikut:
Rumah Sakit "XX"
Buang :      BedahBulan :                     Desernber
                                                      1999
JumlahPasien Keluar:200onng

                                              JUMLAHIN
           PEMWATAN
       RUANG
                                        udi           Absolut
 rL0                            )r,Lilt]ttt l                16
 lSK                            LK [l                        8
              .
 PNEMONI                        ill                          3
 BAKTERIEMIA                                                 0
 FI-EBITIS                      )nr-                         (

 LAIN.LAIN                                                   0
TOTAL                                                        32

 .     Menghitung besar masar.ah
                               Infeksi Nosokomial

       Dari conloh di atas dapat dihitung besar masalan infeksi
       nosokomial ciiRuang BedahRS "XX" pada bulan Desember 1999
       adalah:

             Totalinsidentrateinfeksinosokomial
             fY-l                         -

             |? .* | = | zmx 100% = 16"/"
                         ?t
                         32 *too*=t,
                       l#
         /          ratespesifik:
             Insident

             Untukmenghilunginsbent spesifik menurut
                                     rate                jenis infeksi
             nosokomial (lLO,ISK dll), terlebihdahulu harus dihitung
             jumlah pasienberkikountuk masing-masing    jenis infeksi
             nosokomial padabdan yang sama (Desember).      Sebagai
             contoh pasienberisikoISK adalah total pasien dengan
             katetermenetap misalnya ruangBedahtersebutada 2O
                                     di
             orang,maka: insidens spesifikISK :
                                 rate
                  o
              $       x 2gr1gg"/"=5"/"
              rt
                                                                  lrl
                      /   Proporsiinfeksinosokomial
                                                  menurutJenis :
                          .ILO
                                           #=soz
                          .ISK
                                           # ="*
                                           # = o'gz
                          . PNEMONI

                          . FLEBITIS
                                           *   = t'sx
      b. Pbnyajian Data

            Data perlu disu5un dan disajikandaiam berbagaribentuk.

        Tujuan

        '      Memperlihatkanpora infeksinosokomiar     dan perubahanyang ada
               (trend).
              Memudahkan analisis dan interprestasi  data.
        '     Penyajian data, perlu memenuhikriteriatertentu
                                                             anrara lain :
              / J-elas: menggambarkan apa yang disajikan, kapan
                                                                 dan dimana
              /Sederhana, tidak rumit
              /Menjelaskan diri sendiri (self exptanatory)

        .     Contoh FenyajizrnData:
              / Tabel
              / Diagram Balok (batang)dan
              / diagram kue (pie)




t52
                          Jenis / bentukdan kegunaan

            Jenis                         Kegunaan

           Tabel        Biasanyamenunjukkan frekuensikejadian
                        dengankategoriyang berbedaatau sub baglan
                        suatuvariabei
           Grafik                   kecenderungan
                        Menggambarkan           menurutvraktu
           garis
           Diagram                           gan
                                    pi:rbandin
                        Menggambarkan
           batang

        I Diagram Menggambarkanproporsi

        t-,"t":
                            Tabel1
                                 RuangPerawatan Jenis lnler-''
   InfeksiNosokomial RS"X' Menurut
                   cji                         &
                         Desember 1999

   Ruang       Jmt Insidens               ienis infeksi nosokomial
              Pasien
 Perawalan    Keluar Rate(%) Flebitis   Pnernoni      rLo       fSK       '.:zl

Anak               60     3.3      'l         o           1

Penyqkit       100        4.O      1           o          1
Dalam

Bedah          140       10.7     2            3          8          I



Obsgyne        100       11.G      1           o          6          4

Totai          400        8.0      :)          J         16           U      :'z
                         Diagram'!
      PemakaianAntibiotikaMenurutKiasifikasi
                                           Operasional
                 dj RS .XX" Desember.!999




100


BO

60

4A

20

 o
                           Data
5. Analisis dan InterPretasi

   Tu ju a n :

                       apakahada masalahlnfeksi nosokomialyary:
               infon-nasi
   tviendapatkan
   memerlukan                          lebihlanlutmisalnya
              penanggulangan invesligasi
                           atau                           terjarJr
   KLB.

   C ar a :

       Pembandingan  angka infeksinosokomial(insidens rate) unt;r
                     hdanya
       mengidentifikasi    penyimpangandengancarasebagaiberikul

       ,/ Per hatikan kecenderungan f e k s i n o s o k o mia l a p a k a r
                                       in
          menunjukkan kenaikan yangcukuptaiamatau tidak.
          Bandingkaninsidens         nosokomial
                            rateinfeksi        bulanini dengankur,;'
          waktuyang sama  padatahunyang lalu, apakahada kenaikz'
          yang cukupbermakna  yangperlur,rendapat pertratian-

       ./     Perhatikan bandingkan
                       ciarr         kecenderunganmenurut'ienisinfek'.
                                            dan patogen penyebab k' z
              ruang perawatan$enis pelayanan)
              ada.

       ,/     Gunakanmetodestatistik     untuk melihatpenyimpanga.n ye('-
              bermakna,namunberdasarkan      pengalamananggotaPanitiaP" -
              khususnya tCN dan ketuapanitia  dapatinenggunakanakal sei,','
              untukmenentukan   apakah penyimpangan
                                       ada              bermaknaalaut-icz'
              dengan melihat insidensrate rala-ratapaoa kurun vtz.'-
              sebelumnya  (tingkatendemisitas) dikonfirmasikan
                                                dan              dencz'
              ditemirkannya                              nan
                            determinan yang kemungki menyebab'r.'.
                                        lain                             -
              penyimpangan   tersebut.

              M i salnyateriadi pelanggara n rh a d a p s t a n d a r c a (a -c z : 2
                                            le
              pe ncegahanadanya mahas is wap ra k t e k d i ru ma h s a 7 ' : '
              terbatasnya alat atau bahanyang diperlukanuntuk pencegah2-'
              infeksi.nosokomial.

        /                      Tateinfeksinosokomial
              Bandingkanlnsidens                    bulan ini dengz-'
              kurunwaktuyangsamapadatahunyanglalu,apakahada kenai2.a-
                                                                                i'
                                    perhatian
                    yangperlumendapat
    Vangcukupbermakna

/   Bandingkan pula angka yang diperolehdenganrumah sakit lain
    yang serupa,tiamun perludiingatmeskipunrumah sakit hampir
    serupa kelas dan ienis pelayanannya    tetapi mutrgkin ada
    perbedaanpopulasiatau penerapan   definisiinfeksi nosokomial
    ataudeterrninan yangmenyebabkan
                   lain                 perbandingan   tidakvalid-

ld e n ti fikasi masalah dalam pela k s a n a a np e n c e g a h a n d a n
pengendalian     infeksinosckomial.

Petunjukuntuk menentukanindikasikaoansuatu masalah infeksi
nosokomialmemerlukantindaklanjut.

/                                   ?
                           kelrtatian
    Apakahinfeksimenyebabkan

,/ Infeksi     padalokasi(anatomi)tertentu ataudisebabkan
         terjadi                        saja
   oleh patogentertentusaja-

/   Apakah organismeyang diisolasi(kultur)resisten terhadap
              ?
    antibictika

    Apakahpopulasitertenturentanterhadap          iertentupula-
                                          organisme
    misatnya,RuangPerawatan  Bayi rentanterhadapSalmonella-Unt\
    Luka BakarrentanterhadapStreptococcus   A?.

                 masalahakanlebihmeluas
    Adakahindikasi                     ?

lnterpretasi       i

Interpretasi yang dibuat harus menuniukkan      inforrnasitentang
penyimpangan   penting.baik peningkatan penurunan.
                                          atau
Perlu dijelaskansebab-sebab   peningkatan   atau penurunanangka
infeksi nosokomialjika ada data pendukung     yang relevandengan
rrrasalahyang dimaksud-tetapitic;ahi;olehdibuatspekulasimengenai
peningkatan maupun  penurunan   tersebut tidakada datainformasi
                                         iika
yang mendukung   misalnyadata yangdiperoleh     sumberterpercaya,
mlsalnyahasil kunjungan   ruangan,   wawancara   dengan perawatI
dokterataudatahasilsuatupenvelidik     formal.
Contoh
                         Tabel3
lnfeksi Nosokomialivlenurut
                          Jenis lnfeksi di RumahSakit "XX"
                         s;/d
              September Desember 1999

                                                      ta?? a
Jeitis'lN';                                           )€l :    Tdtel,'

rLo               -l
                                9          8     16               4A
I SK              I             6          9      8               30
Flebitis          6             i
                                    A
                                           5      5               20
P n e mo rri      3             2          2      3                10
Tota!           23        -zl             24     JZ              100
(tR)           12"/"     1A%            17"/"   17"/"           '13"/"


 Dari tabel 3 di atas tampak bahwa rata-rala insidensrate infeksi
 nosckomialselarna  kurunwaktuSeptembers/d Desember1999adalah
 13 7" dengan raftge 10-17"/"

 Bila dibandingkan  dengandatadasarinfeksinosokomiai "XX" maka
                                                   RS
 insident rate pada kurun waktu Septenrbers/d Desenrber1999 rata-
 rata lebih tinggi dari data dasar (lR = 1O%).

 Bila dilifiat infeksi nosokomialmenurut jenis maka baik pada kurun
 waktu SeptemberDesember       1999 maupun kurunwaktu sebelumnya
 (data dasar) proporsiinfeksinosokomialtertinggiadalah lLO.

 Namun bila dibandingkandengandata dasar maka proporsi ILO pada
 kurun waktu September s/d Des-ornber19Q9nroporsiILO mengalami
 peningkatanyang cukup berarti(data dasar proporsiILO =.35%).

 Bila dilihat kecenderunganILO menurut bulan maka meningkatnya
 proporsiILO disebabkan  pada bulan Desemberterjadipeningkatan


                                                                         t51
         jumlah lLo yang cukup bermaknayakni lebih kurang dua kali dari lLo
         pada bulan-bulansebelumrrya-

         Berdasarkanhasilpemantauanpelaksanaankewaspadaantrniversaldi
         ruang perawatantidak ada masalah yang menyebabkan tei-jadinya
         peningkatan -
                   ILO

         Jenis infeksi lainnyatidak menunjukkanperubahanyang cukup berarti.


      6. Laporan & Diseminasi Informasi

         a.   Laporan:

              ' Laporan cukup dibuatdarambentuk taber,gr'afik  arau diagram
                yaig nienunjukkan   besarnyamasalah infeksinosokomial(:ate,
                rat;o atau proporsi)yang ierjadi dalam kurun waktu pelaporan
                dengan narasisingkatlebih kurang sepeni contoh anarisisdan
                interpretasidiatas.

              ' Laporan dilengkapidenganrekomencasitindaklanjut bagi pihak
                t^erkaii
                       dengan peningkatan
                                        ILO_

              . Misaln,,adarihasilanalisisdata diatas,saran tindaklanjut adalah
                mengadakaninvestigasi  KLB lLo untuk mengetahuisumber i:ara
                penularan dan faktor lain yang mempengaruhi agar dapat
                dilakukan tindakanpenanggurangan    yang efektifdan efisien.

              ' Yang mbmbuat laporan adalah ICN atau anggota panitia plN
                lain yang melaksanakan
                                     surveilans.

        b.    Diseminasi Informasi

              ' Sebelum informasidisebarluaskan
                                              terlebih crahuludiskusikan
                dengan ketua Pinitia plN.

              ' Tujuan utamadiseminasiinformasihi6it kegiatansurueilansiaiair
                agar pihak terkait
                                 dapatmemanfaatkan   informasilersebut untuk
                menetapkanstrategi pengendalianinfeksinosokomiai.
r53
      Laporan
            disampaikan
                      pada:

      /    Seluruh anggotatim
      {    DirekturBumahSakit
      ,/   Seluruh RumahSakit
                   staf
      ,/   Ruangatauunit terkaitdenganmasalahinfeksi nosokomial
           yang dilapoCran

    . Carapenyampaian
                    laporan& diseminasi
                                      informasi:
    . Kapanlaporan
                 dikirim|      ,

.     ,/ -. Periodik
                   sebaikrrya      palingtidak tiga bulanar
                            bulanan,
      ,/ Segera ada KLB
                  bila

    . Bentuk
           penyampaian
                    :

      ,/ Lisandalam perlemuan
      ./ Laporaniertuiis
      ./ Papan buletin
                     dimanasemuastaf runrahsakitdapat melihat
         dengan mudah.




                                                              t59
                                                           Lampiran
                                                                  1

       PERBANDINGANRISIKO            NOSOKOMIAL
                               INFEKSI
                         RELATIF              DAN
                   ALTERNATIF
                            PENGUKURAN
              B ERDASARKANKEPENTINGANRELATIF



                        ffi       wi
                                   ffitf;$ffiffi
                                                 .i :':1'." ?i :   '' - -

                                  U0jj
                        ,iffi l{ets]        f-'-EiNI-*ft,.,.
                                   rTBiaffil?diil*
                                  iF.i?

                                            *Y,.i-dapa!,.ri,

                                          ffi ffi,'={
                        ;tffi     xffi=
                        i$j$€
                        r-iffi
   tLo             24            37        42                 35

   Pnemoni         10            24        39                 22

   ISK             42            11        13                 35

   Bakteriemia      5            4          3                 35

   Lain-lain       1e            4          3                 32

   Total          100           100        100                 32




r5 0
                                                       Lampiran
                                                              2


                                            llrmr Ru.'ihSltlt I l4ilyontrl
                                            Trngg.l           i H.rllo;

       |     |    t     I     ro



      J .nh I Pr o:.dufl ttnggtt
     Inlolrl | optilrto^rtl Opril!l
                                      rlr



o.
                                                                                        Lamoiran3
                          D.A,FTAF
                                 TILIK PENGENDALIANINFEKSI
                                Ru-rng:
                               Tangal:


                                                                                :! Ya ." Tidak

       l.   Pengelohanalat         Wada:rtahan lusukan
            tajam                  lsi wadahkurangdari 34
                                                                                                 I
                                   Itdak ada bag'nrrlajam yangkeluar
                                   iarurnsuntik tidakdisarungkarr
                                                  satu
                                   Perryarungan tangan

       2. Dekontaminasi
                     alat           Larutanklorin0.5%
                                    Lanrtankloin dalamwadah    plastik
                                    Alal direndam datarn              15
                                                        klorinselama menit
                                    Alatdibilasair sebelum       ke
                                                          dikirim CSSD
                                    Alatsterildisimpandalam  wadah keringdan

       3.   Cuci tangan             Ait menqarir
                                    Sabun
                                    lap kering dan b€rsih- steril
                                    Pelugas tampak mencucitangan&
                                    mengeringkannya   setelahkontar der.:an :
                                    . cairan tubuh
                                    . melepas saruno tangan
                                    . kOntekrlanga; pasien

       4.   Alal pelinoung          Sarung langanslerii
                                    Sarungtangane(sih
                                    Sarunlltangenrumah    lanoga
                                    Sepatuboot
                                    Gaun/ jubah/ apoon ce!-.mak
                                                        /
                                    makser
                                    Pelindungmata/ kacamata

       5. Sampah                    Sampahdipisahkansesuai ienisnya
                                    Sarnpahlerkontaminasi
                                                        dalamwadahlerlutup
                                    lncenerator
                                              ber{ungsi
                                                      baik
       6. Pemasangan                Cara pemasangan
          kateterurin                              /
                                    Kualitassarana alat
                                    Kecukupan  alat
       7. Pemasangan
                   infus            Carapemasangan
                                                  /
                                    Kualilassarana alat
                                    keorkupanalat

      KETERANGAN :
      Ya    :                ada / lersedia/ dikeriakan sesuaiindikator
      lldak :                tidak ada / tidak tersedia tidakdikeriakan
                                                      /               sesuaiindikator
lo/
                                            Lampiran 4
             Fo;mat Tabulasi
RumahSakit
                 Ruang :-.-......
                      :
Bulan
                 JumlahPasienKeluarRS (pulang) :




                                                   l(.;3

				
DOCUMENT INFO
Shared By:
Categories:
Tags:
Stats:
views:1290
posted:4/2/2012
language:
pages:172
galih endradita galih endradita Admin www.vis-pt.com
About Hospital Manager in East Java, interesting with research in health care system.