Docstoc

Acetobacter

Document Sample
Acetobacter Powered By Docstoc
					Gene#   APA_(common) Start           Stop           Strand   protein sequence              gene
    1   APA_00010              813            388   -                                      ruvA
                                                             METAASDCPIYRITVPGLLRAKGRPRFGNGRTFTDTKTVQAEKHIQR
    2   APA_00020             2420           1206   -        MSRVSPHQLTARQVSALKGGSLCDGGGLWLVAQGAAKSWFFRFTSP
    3   APA_00030             3160           2681   -        MTRIFVDSDVCPVKNEVYRVASRYNLHVFIVSNSMLLVPQSPLIEQVV
    4   APA_00040             3400           3927   +        MKKVLMATALTLGMMTSAVSFAHAQEATPAVGAPPPGGPGCGPMH
    5   APA_00050             4064           5311   +                                      cflA
                                                             MTTSSAPLALFKNGLPLRLILLLGLVTAIGPLATDMYLPAFPDVERDL
    6   APA_00060             5722           5336   -        MNPSMLLAKKTGTLIGNLLLVSPLLVACHGPIEGDNIDVPPERPGRFL
    7   APA_00070             5938           5753   -        MSDTPPLDSRLLSVLVCPVTKGPLTYNAETNELISKKAGLAFPIRDGIP
    8   APA_00080             6669           5965   -        LAAVFFQDEDDIPRRVPKLGDVTLADIPPEIGLFPLSGVVLLPRGRLPL
    9   APA_00090             7643           6684   -        MEHLLGQPQSDTQNGTIAPQNTAPVITDGSQATFMQDVIEASRSVPV
   10   APA_00100             7819           7706   -        MRDKATAAIVFNLIWASHALIAIAHHALIDHLEHINR
   11   APA_00110             7882          10746   +                                      uvrA
                                                             MKKSDFSGQQSIRVRGARVHNLKNVDIDIPRDKLTVMTGLSGSGKSS
   12   APA_00120            10746          11585   +        MKKQFLALAGVGFSALFVNGAETYSAVAETSCSALPSSVLFEKQTWT
   13   APA_00130            11693          12991   +        MVPEIMRYSVMASKAYLIAATALAAVMSAGTAAFAQDATQPAPSAQ
   14   APA_00140            13071          14306   +        MMSHFQNENIENNNAKKKLSPFQKLSSAQEALKKDILEFCKAHQKDE
   15   APA_00150            14534          15094   +                                      nifU
                                                             MFIETEGTPNPATLKFLPGQAVMGDAGTIDFIDADAVAGRSSLAEALF
   16   APA_00160            15161          15790   +        MPALSMIDARQGKIHMLDENGLDLLFRKARTPLRWTTRTVEEDVLR
   17   APA_00170            15787          16479   +        MMVQRILVLDGSPAGESACGMAACVLAEGDKLSVLNAEMVAGKQA
   18   APA_00180            16482          16934   +        VHVQEASIAHAQLLASMHAQCFNTGAQWDQTAITALLSSPGVHAGIV
   19   APA_00190            18266          16983   -        MQEKTMRVLLVGSGGREHALAATLARSPELSALFIAPGNPGTAELGI
   20   APA_00200            18318          19772   +        MTEQFDIPSASNNVPEFTVSEISGAIRRTLEGTFSRVRVRGEITELKRY
   21   APA_00210            19871          20212   +        MSIRFSVGVVSLCLAGGLLAGCAPQQGHRIPPQSFAPGLTTEPSATND
   23   APA_00230            20386          21561   +        MTAASLSVLPRPASRPLNPCFSSGPCAKRPGWNVSALANALVGRSHR
   24   APA_00240            23036          21645   -        MAYATINPFTEEQVKTFPTATDAEIETAVGKADAAFQKWKNFSHAD
   25   APA_00250            24104          23076   -        MSGKMKAAVVHEFGKPLTIEELDIPPIKPTQILVKMIACGVCHTDLHA
   26   APA_00260            25595          24180   -        MFIEYIVGLSGLIAAGLFIYGLKAMSSPVTAVSGIVTAGYGMIFVIAAT
   27   APA_00270            25922          25596   -        MITATSMTFIIALYIFMLAAFTGYVVISRVPSILHTPLMSGSNFIHGIVV
   28   APA_00280            27070          25919   -        VTLKIAILKETAADERRVAMIPSVAQRIAKFGASLVLEQGGGAAATY
   29   APA_00290            27361          27233   -        VIARPAAFFCTLQNIDTHPKQKPTAMVSRLSARHTEQGAGQR
   30   APA_00300            27476          28498   +        MGYRVAVVGATGAVGREILKTLAEREFPVDEIVALASPRSAGREVSF
   31   APA_00310            28635          29108   +        MQDIRKALYVGSRSDGRLIQRPMSPHLQVYRYRLSMVLSIMNRITGV
   32   APA_00320            29110          29523   +        MNASAPHIEVMRSQLGRARGLGAGHSGVGHWWAERVTAASLLPLS
   33   APA_00330            29641          31452   +        MNANTSPSRGAYRIVDHAYDVVVVGAGGSGLRATLGMGAAGLSTA
   34   APA_00340            31489          32271   +        MVELRLPRNSTIGKGKTFPAPAGAKNVRTFRIYRWTPDDDKNPVIDS
   35   APA_00350            32449          33111   +        VFDGHLSSSSGRARAWTDSLFVDHAIFRLMWTNFHAVIPGKVYRCN
   36   APA_00360            33171          34064   +        MVPHKPVPVLAVVAALLSWACAYPVVRLALPFFAPVPLAAARYMVA
   37   APA_00370            35351          34128   -        MAELPFSTLDTLDPKGKRILLRVDLNVPMKDGKVTDETRIERVVPTIR
   38   APA_00380            36373          35351   -        MAVKIAINGFGRIGRLVLRGIIESGRTDVVPVAINDLGSVEANAHLLS
   39   APA_00390            38357          36426   -        MAQATLIEHPFTSPAAALPAQDTVVLRLCAAARLLLGKARNSAHLAL
   40   APA_00400            38515          38991   +        MLPVSRVIEKGSFLRVVVAGCVLVGVTGCKLVDQKTFNPNAGVAPK
   41   APA_00410            39052          40359   +        MPRPFLTRSEEKISVGAIKNARHPFYDHCHQALDQIKHQGRYRTFTPL
   42   APA_00420            41285          40407   -        MVSLWINLLYGGQQQPNLAVMTARAIPFQFMDKDTMQNLKSFLRLT
   43   APA_00430            41333          42790   +        VAARSIIPRFTRFKTVLSGSRKRAGALALALTSVLPACSSGSHIAQPVE
   44   APA_00440            42879          44075   +                                      recA
                                                             MATAAKNFHKAVTRYIRCCRRGFMAGIKRIIFRAWCVTHSRALHTSG
   45   APA_00450            44594          44082   -        MTPSADTTWRAMTPDDLTGVMTLAARVHPDYMEDLAVFEERLKLA
   46   APA_00460            44664          45029   +                                      modE
                                                             MTARVRLTLRLDADGKPALGHGKIHLLEKLEETGSISAAGRAMGMS
   47   APA_00470            45096          46640   +                                      mdoG
                                                             VSANVQRRDVIKAGAGATLASLVGGAIGRAHAEELVSATGAFDDNT
   48   APA_00480            46643          48775   +                                      mdoH
                                                             MPDSTQMFRALPSESPLDMPVQDFHAAPNMAGRGRTPITSPRNIVLR
   49   APA_00490            49927          48824   -        MTELSGNLVLPNTVVSGKINFETTIQNIAPTKHEMNRYILPGFIDGHIH
   50   APA_00500            51204          49933   -        MHNRTFWRAISCPAGPYGWPPLVLVAILFFIIGFVTWLNGPLISFVKIA
   51   APA_00510            51780          51238   -        MPTLCSSPQSPLLYLLAMNRLKTEHPRSTDLCIKRVLRVFLFRPSTPLF
   52   APA_00520            51979          53952   +        MSDNTDAQLPQDEGLPNPEMEGPGLFGDEPAQQAPEQLPATQQDQA
   53   APA_00530            54052          54375   +        MKNLASLMKQATQMQSKMEAMQSTLEAMNIEGSAGAGMVQVVLS
   54   APA_00540            54407          55003   +                                      recR
                                                             MGGQEIEQLIRLLGRLPGFGPRSARRVALYLLKEPQTRLAPLAHAME
   55   APA_00550            55024          55824   +        MPLDGFPISAAIPRRALVTGGGARLGRAIALGLAQAGFDVAIHYRSGQ
 56   APA_00560    55828    56229   +   MAVFAPWADQPPLRRLFIRNMILDANIGVFPHEQGVSQRIRVSVSFGV
 57   APA_00570    56638    56303   -   MSQPDLGTKRVCVSCGAHFYDLNRTPAVCPKCGTEQPPLVPRLRRN
 58   APA_00580    56831    58231   +   MVSGGLTCRPTRRNEQGMTQQTTSSTRPLRVSRAQAPLSGSIRVPGD
 59   APA_00590    58228    58881   +   MTRGGPVIAVDGPAAAGKGTLARRLAEALHLPYLDTGLLYRAVGRL
 60   APA_00600    59166    60884   +   MASATTQTADHFRGEDFASLLDETLGRDTGFDGSVVRGRVVRLTDD
 61   APA_00610    60998    62350   +   MEGLGRKRPDTCQSVAHCVSDSPKNWRHNGMVRRNIMLNQKPLSP
 62   APA_00620    62968    62369   -   MNSIKLERGSTLVLATHNAGKLAEFATLLADFGIKVVSAGELNLPEPE
 63   APA_00630    63699    62965   -   MRPSGRQPDQMRPITIETGFAHHAEGSALIRVGGTEVLCTASIENRVP
 64   APA_00640    63799    64899   +                                 hrcA
                                        MDMRRSPCVMKRGLLPVKAALPPGLNARSAAILREVVEEYVASGEP
 65   APA_00650    64995    67757   +   MTSAPSSGDPGSSSSHSQGRSPQNRRPDLRRPRFRQWRKVLGATAAL
 66   APA_00660    67975    68946   +   MMRERTLLANQIEGVEALETNVRDTSELIELAEAEGDADLVAEGMA
 67   APA_00670    69289    70038   +   MQGDKGGRANMNDYEQQPGSVKYTFRVGAVVSVVALLVVVALHL
 68   APA_00680    70108    71121   +   MMRIMRKMTRLPRSFVSGLAAPALALLMSTAAPVAALAQDAAPAAP
 69   APA_00690    71155    71574   +   MGMQVGDSGGEDDVVSAINTTPLVDVMLVLLIIFLITIPVATHTVKV
 70   APA_00700    71629    72069   +   MGMNVGSESTTEDEGIVDINTTPLIDVMLVLLIMLIITIPLQTQAVSID
 71   APA_00710    72082    73311   +   MASRFLRTLFCATTAWVVMQPVAHAADELGQQVGTELEAAQSALA
 72   APA_00720    74566    73400   -                                 rodA
                                        MKFHKRLLRAEPSFRLMSKLWRISWLYILLICTLAGVGYVTLYSAGG
 73   APA_00730    76491    74563   -                                 ftsI
                                        MWLKRRKKENRRFLPVREQKDPARGVFTRRALLFMAVQTVALGEL
 74   APA_00740    77074    76511   -                                 mreD
                                        MSDPSPPSWDPDLEPRLTLGQKLDRTARHLLPSAFIVLVIIFFSAPLAIP
 75   APA_00750    77994    77080   -                                 mreC
                                        MIPVSIQVRQALGKLVLPVLLLLSVGIIIAGQADRRLADTARMYVADV
 76   APA_00760    79136    78090   -                                 mreB
                                        MFSRLLGLMSADMAIDLGTANTLVYVKGRGIVLNEPSVVAIADIRGK
 77   APA_00770    80984    79341   -   MAQPLYSCSRPDFFRKNSMSADTTSFNHPSFGRMTPDRVIVFDTTLR
 78   APA_00780    82275    81226   -   MTPAHRKLISGWLFLLCFMLLGMIAIGGVTRLTGSGLSIMDWQPVSG
 79   APA_00790    82290    83069   +   MMRWAWQPLALWVKFLYRVYSQLAGCCKKMVPLGWMEQHIRPPS
 80   APA_00800    83231    84493   +                                 cflA
                                        MASPSAVRDAGTSFIGGRIPMWVPVLLGFLTAVGPISTDIYLPAFPAM
 81   APA_00810    84597    86840   +   MPRHPARRAHVLALIGAGLLIVTFGTMGIELGNEMARHGNLDRQSTA
 82   APA_00820    86885    87535   +   MQDRAGAGLPERVLLFGRIQGRSNRGPALGWHAGRIIKAMTAHEEID
 83   APA_00830    87680    89914   +   VKSMTLSLGQLWRSVSIIVRQALVGGGPPRKLDHLRWLFAPNLLSFG
 84   APA_00840    89978    91273   +   VQSDIKIEQNKQASTLLRSMFDAAVAAADPFKVLAKYLPEKPKGRCI
 85   APA_00850    91921    91280   -   MKQTQTKLEWCTPSSAKSSDVETQLNCLVQEIRKCTACAHKLPLGPR
 86   APA_00860    93470    92052   -   MMINRLKAALGAVAVGLLAGTSLAHAQNADEDLIKKGEYVARLGD
 87   APA_00870    95751    93523   -   MTRPASAKRRSLLGILAAGTICAAALPYAAVPARADGQGNTGEAIIHA
 88   APA_00880    96523    95960   -   MFLIAGIRLPAPMLEFFQQIQTFFPNREWEPEPFLFLPLVIVGETSDPDV
 89   APA_00890    96711    97487   +   MSFSHDYRSPATPTDWNAQAANLDAGLRAYMLRVYNWMASGLLLT
 90   APA_00900    98099    99025   +   MKNKLLARVARLGGLSSALLLAGCELDVLDPKGPVGEGVKTLIATST
 91   APA_00910    99031   101022   +   MLGRLSLSAIPLDVPILVGTFIGVVIVGVAVLGLITYYGKWGYLWKE
 92   APA_00920   101024   101629   +   MAQNTTVQTAGHDEHHHESPVVFGFWVYLMTDCIIFGTLFAVFAVL
 93   APA_00930   101548   101961   +   LPEPVLALPGYRLDLRFHLCLSGEHDLMSNPHTSSSGESHGSVSSYIIG
 94   APA_00940   101990   102190   +   VAVGKQAEKSPCSYNGYRGFFIGHVFLTDLRRVSGIYGYPPPYGLWM
 95   APA_00950   102563   102231   -   MTYVVTENCIRCKFMDCVEVCPVDCFYAGENFLVINPDECIDCGVCE
 96   APA_00960   105274   102734   -   MQDDAPVRAILGPTNTGKTHLALERMLAHSSGMIGFPLRLLARENYE
 97   APA_00970   105284   106870   +   MSGSSHTAGRNHHANIVGCRVWKSKPSDAIILTDENMLAGSLPESEG
 98   APA_00980   106969   107442   +                                 marR
                                        MSLYLERSGKACSKRKVKLMPQAAEKTEDLAKTLRDTIVSLVRGDA
 99   APA_00990   107583   108029   +   MRFSSFFAAAALAASASFIPVAHAEDAMGSPTATVTITARSADIGVGY
100   APA_01000   109130   111160   +                                 capD
                                        MASQHSQPLHRNPRLRPVNRIAVNILLDGVLAALAAPLARWLAAPQD
101   APA_01010   109136   108039   -   MPLSCTYSVAPAILEAAQPDDCLFMSFSFSCVAIFCLLGACVLSTCLV
102   APA_01020   111157   112293   +                                 degT
                                        MNGSQNRPIAFLDLAAQQKRLEPALRQRLETVLAHCRFVMGPEVLEL
103   APA_01030   112310   112774   +   MRKETAFIIGFFIFTLSTAALIWKVALPNLKPVSFPQVASGTLDVGPM
104   APA_01040   114232   112868   -   MAPSAPFIGDQRGPFDLALKGGSVVLPDGTVETTVYVKDGTIAAIGG
105   APA_01050   115636   114239   -   MSYDFDLLVIGAGSGGVRCARIAASHGARVAIAESRHWGGTCVNLG
106   APA_01060   116593   115697   -   MSETMLENDILPRMSASEVPSGLLPVDGQEGVWHLASPTKEYGHLY
107   APA_01070   116912   119260   +                                 suv3
                                        MTSDSSASPARQALACAVARTTIAPEAKEEHEVLRRLARNLEPGAHE
108   APA_01080   120266   119316   -   MTGRRAWRVNHNQPDLKGQVALVTGGNSGLGFQVALGLAHRGAR
109   APA_01090   120925   120263   -   LHNFFSVDYLSSLFAQYGYGVVGVVVMLESMGFPLPAESLLITGALF
110   APA_01100   121036   123063   +   MLNTCGVWVHVFLDATAGMVKNTSMNNTPPLSSSVTPMPCGTWPS
111   APA_01110   124753   123119   -   MPSASTPQLRGMALLNNAHLNKGTAFTEEERRLYGLEGLLPTQVENL
112   APA_01120   125431   124901   -                                  nusG
                                        MAKRWYVVHVYSGFEKKIAQHIREEAEQKGLSDHIDEILVPSEEVIEV
113   APA_01130   125630   125436   -                                  secE
                                        VSFSPGKFLHDVRAEAERVTWPTRRATLVTTGAVLAMAGMASIFFFF
116   APA_01160   126200   126391   +   VDAEGEFFITCLASFCVSWFVVIYGLFLRAFGGTNGCGIKNGASGML
117   APA_01170   126435   127058   +   VECRRAQKERTKRVVASGVTTAQPVAFASNGLEGRYATALYDLAAE
118   APA_01180   127058   128593   +   MEIRPAEISDILKQQIASFDKESDVVETGTVLSVGDGIARVFGLQNVM
119   APA_01190   128611   129501   +   MASLKELRARIGSIKSTRKITSAMKMVAAAKLRRAQASAEAARPYAA
120   APA_01200   129533   131005   +   MSDTTTQTQAPAATKTNAVGRITEIKGPVVDVQFEGELPKILNALHV
121   APA_01210   131033   131443   +   MPIQIEIISPEKVLVSREVDMAVLPGMEGDIAAMPERAPMMLLLRGG
122   APA_01220   132038   131502   -   VKLDERAKARNICKKPHVQEHKMTPADDGRDQLTQLGKQVAAPQS
123   APA_01230   132092   133300   +   MARSATPEFPPARLISSTQELEAALAPFHNESFVTVDTEFMREQTYWP
124   APA_01240   134330   133332   -                                  pfkB
                                        MTVSDVKYDILGIGNAITDILARVEPAFLQKQGLTPGSMTLIDADRAN
125   APA_01250   134488   135234   +   VPEQWGLSKSEQPARRGIFLFKRRKPEDNRPSEQSGSASQAGAQRSA
126   APA_01260   135926   135318   -   MEWTEEIIAQLKALWAEGLSTAEIGRRLSITKNAVVGKAHRLGLPAR
127   APA_01270   137555   136074   -   MPDKTSTPHTTPSHTAEGYHRALNKRQIQMISIGGAIGTGLFLGAGGR
128   APA_01280   138763   137726   -                                  cysA
                                        MSVNLHSFTQYAPGSSRKILDNINLTVEDGAFIALVGPSGAGKTSLLR
129   APA_01290   139578   138760   -                                  cysW
                                        MTTARFSISRFLLCGCSYAVVLLMLLLPLVLIFTEALRQGLSAAVSAL
130   APA_01300   140414   139575   -                                  cysT
                                        MFFLRRHTLPGFPLTFGITLLWVGLLVILPLLALLLRPWQDGTAAIWQ
131   APA_01310   140938   141174   +   VCSLSRGIKMLESQIIEVNGTFLGTVILEADRSTRRFYAAHESVKSLHN
132   APA_01320   141353   142234   +   MWVKNNQCGCWGRLMTGSVRSGFLLTTAISGLFFPCVLHAETSEAE
133   APA_01330   143762   142377   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
134   APA_01340   143883   144731   +   VDLVRNLAGGVARFSVGGEHYEKRWLVSGYFTGQKFGDRSKDTTIV
135   APA_01350   144758   145792   +   MKNKDFSLSRRRLLVGAAALGGGAFLGVHAGEAQAASFNLLNVSYD
136   APA_01360   146966   145821   -                                  araC
                                        MICDLTARYIFLTFHDKDGCSLHTRFRQRIAMSPLPAFSASGVMAAAA
137   APA_01370   147059   148447   +   MVYRCTLGGETYSFDDLKTLLAVASSERSGDQLAGVAAQSDVQRIA
138   APA_01380   148444   149229   +   MTDKKLLATGSTLPEERDDWQGLRQFTRARIGLSRSGNAQCTKDVL
139   APA_01390   149262   150614   +   MGEGSTHLNKSLSTFHLWGIAVGLVISGEYFGWSYGWGTAGTLGFL
140   APA_01400   151114   152304   +                                  acrB
                                        MKREVSSLTHAAVVGVLIGLSGCDQKASTPEIPPQSVQVQVMKKQSV
141   APA_01410   152310   155465   +   MSLSRFFIDRPIFAWVISLIIMLVGGLSIFRLPISQYPSIAPPQIAISVTYP
142   APA_01420   155470   156954   +   MTHFSASRQSRLYRQVACFAVSVGLLGGCTMIPKYKRPQPPLAQTW
143   APA_01430   157240   157034   -   MATGTVKWFNPTKGFGFIQPDNGGQDAFVHISELERAGMHTLTEGQ
144   APA_01440   157848   157534   -   LAVPYSPDVYLLAHRLPIKKYHAYLPWEADYAAHPWHGYDRDLCV
145   APA_01450   158637   158026   -   VVAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQGSP
146   APA_01460   159509   158844   -   VLDSYWPIGGALTVISLATFVMPMCLNQPVSMPQAFCGGFATALLPF
147   APA_01470   159552   160802   +   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
148   APA_01480   161317   160892   -   MRVTNRLITPLVLFFVCTSFFIFRNIEGLGGLPFSDESGHFLGVLAMQH
149   APA_01490   163715   161361   -   MHDRFHTFCAAGTFGALLLTTSALAATPVSTKPHTGAKPAAIKTSAP
150   APA_01500   167195   164040   -   MSDISQNTTIGGDSSSTEQNGGTVINNVGLFVSSGGTASGVTAEAGG
151   APA_01510   168472   167201   -   MTEQTTVTNTQANQSKPAQTPPYPTAAALPTQQAPKNIRFDFNEGCR
152   APA_01520   169426   168917   -   MNAHNKPNYVIDGSETAAGRQTMLTLKQRMVGAVAILACSVVGNT
153   APA_01530   170655   169426   -   MNLGYRREHMIPVSPRFSGKLTTHLSRYSRILSTCFILGTITSQYARAA
154   APA_01540   170703   170855   +   MREMTYFKEIKSCLDILLYIETYIINKNSFFRQQKTNSHSIMCGVDRDF
155   APA_01550   171034   172041   +   MGSTGSVSAWEEALLVALIQYPVPVIKGPEDIQTQVDQICRAVDSTK
156   APA_01560   172986   172087   -                                  luxR
                                        MNGIVLVVDDSPENLSLVMNILENGGFTTLLSQSAEHALSILLEVDVD
157   APA_01570   176465   172983   -   VFTIRRLTYKGVLKKLFSFRNRYLLYIQPISGPSLAGSVHSVVGRRMF
158   APA_01580   176466   177803   +   MPTFRQSRYCHGVYRHSQPKVVALMPDKKTHLLKLQASRRQMLTG
159   APA_01590   177858   178784   +   MLSGYSFNDLASIFVMQSFAGLILFSVFLLMALGLAIVFGQMGVINMA
160   APA_01600   178796   179911   +   MLSLQNRKDILFLSILAAILLIVLPMGLDAFRLNLIGKYLTYAFVTIGL
161   APA_01610   179923   180669   +   MTIQNDPLLSVENLSVSFDGFKAVDDLSFQLEKGEIRVIIGPNGAGKT
162   APA_01620   180686   181402   +   MNIPALGTPLLDVRGLHVAYGASEVLHGVDLQIGHGEIVVFMGRNG
163   APA_01630   182034   181603   -   MFTGMRLGEICNLRHQDIEVIEVVPCFHVHPQMPKNLFDHGTFASET
164   APA_01640   182240   182674   +   MVLHCFATNSFQLLLFGLSNHHAQRENSFSFAMCGGQRCQKVEELT
165   APA_01650   183943   182918   -   MFDNSNLFRWATSELSQDAFICWLLSWADSSYANKNPEMHNAGKIF
166   APA_01660   185108   184107   -   MRFEKAGMIIKLARLLAGTAEGMTIDEIAITFHVSRRTAERLKATVEA
167   APA_01670   185430   185831   +   MIFVSDLSHEPNIGIFWLVKENGKIVFLVDKVPASQGDCHENMTTWG
168   APA_01680   187422   186049   -   MLRVRGTTYHFRRIVPPALRTALNRREIWVSLKTGYHNEARKRASLL
169   APA_01690   188712   187675   -   VGSFTRLAKVKAADFRKLLSEEQSQTAHERDIKNTRLSIRRTTAEFYN
170   APA_01700   188776   190215   +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
171   APA_01710   191128   190358   -   MIVKESRIKTKSGAGAIARHVLHGAKNEAIRVLSGSEWLLHDHMREA
172   APA_01720   191543   191151   -   VRNPRRTSRLSVRASPDELMRWNHIARSHGHATTAHWIRSLLTSAEL
173   APA_01730   193154   191715   -   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
174   APA_01740   193501   194562   +   MLNSCLQHQIFQWLRRETVKVGVRRVVAFQGAVASDVGTVRSENQ
175   APA_01750   194598   195656   +   MEHIFSNRYSCKISPMQGGMATVYQCRDLILERDVAIKIMSRGMEAR
176   APA_01760   195653   196735   +   MNGSLVTGQKIAGRYVVENYLAEGGMQYVYIAYDEVTGQKIALKTP
177   APA_01770   197349   196840   -   MRLGEICNLRNEDIQDVDGIPCFLIRPHPEDKWIPKTEAGTRNVPIHSG
178   APA_01780   199139   197529   -   MTHAPAVLPDDPDILREMIVSLQTEVARLSASARAYEALVQSLKIRIA
179   APA_01790   199550   199203   -   MIGVGNGVRVYLACGVTDMRKGISGLAALAQDVLRQNPTSGALFAF
180   APA_01800   199906   199547   -   MAQEILIGVERRRRWSDERKLAILAEVGVDGASVSDVARRHDLTRQH
181   APA_01810   201032   199971   -   VKCKPASPQSFSKLEKFSMLALVGTHYHFRRVVPVALRPLFGKTEFW
183   APA_01830   201905   201228   -   MLEGYGAAKIIWRISAKAKRCIIRISAKEQAILVTLPKGFPYTQALAFV
184   APA_01840   202426   201971   -   MTAPFWETTPLTEMTTEQWESLCDGCGRCCLHKLRDDDTEELHYTS
185   APA_01850   202860   202423   -   MGAPQVIPSLMHIPLPYSFLWGFTCISMTSMFLMFVLLMLAFATHAG
186   APA_01860   203954   202842   -   MREVTLFSFSFLHGRSSGTPSPHPRKQEPSAGTISRRKALLAGLGGGV
187   APA_01870   205105   203990   -   MHTTHGSSTALAVHNLAFFHNAQPLTLSLPAGSCTAILGIGQDNEDLT
188   APA_01880   205179   205481   +   MSSDKIKEVKAAGEAAADTARDELEAVKAHLERLVTQHLVPALGRA
189   APA_01890   205521   205946   +   MRIFDLGKSALNAQSNLMQQMAIRYGKQAVLLAMAAVFGLFALITG
190   APA_01900   206080   206574   +                                  marR
                                        MEPNHHPVMANEPRRFFGYRLARLAAVWRREIDADLRAFGLTDATW
191   APA_01910   206818   207729   +   MPLLRTLIRVVLTLAVVSLAIVLGITLWNVYMIAPWTRDGRVRVYVV
192   APA_01920   207739   209268   +   MRQNMKGRRRLGLFLATSMLLSACTVGPNYQPDRMKVPAAFKETE
193   APA_01930   209333   209575   +   VGGGFTLMCFTGWMAVAYSHPQDSWAMLTFRWVFPVSGAIMVAA
194   APA_01940   210291   209581   -   MTSASAQPSPSRPGILVGLKAEARLIRTIFPHAAIAASGATHAGAKREA
195   APA_01950   212266   210296   -   MAADGSALSESRLSSEALDRAVLSAHTALSQAQQDDGHWVYELEAD
196   APA_01960   213630   212332   -   MTGTLHIIGAGMAGLAAAVEAAGSGPRIIVHEAGRACGGRARSYMD
197   APA_01970   214530   213652   -   MHDEPTPLGCDPADLAWVESTVKQAGTSFAAGMRILPPMRRYGMY
198   APA_01980   215489   214629   -   MTNTTSVWGTADVSSGKGASDENFPVGSLLISKRLRPHVHAYYDYA
199   APA_01990   216799   215603   -   VILALAILCAIIWIGLIFFHGKFWQAGPILRPAEAGRTHMDIAPDVTVV
200   APA_02000   217805   216810   -   MTAHTLVTGATGFVGSAVARTLLERGHSLRLMVRDGSDRRNIADIPA
201   APA_02010   218000   219091   +   VCWTDRAGALKKLTVFLTFLGLVAVTAAMAWSGFDSVLHAVMRIG
202   APA_02020   219099   219980   +   VPVFDTLAVIGPGLIGSSVLRRAQAEGNLARKLIAVDQSPDVCARVAE
203   APA_02030   220685   219996   -   MRHPALFGWLNTHVMRKTRFSACRRNGFLFVGLCAIYAGLPATVWA
204   APA_02040   221886   220924   -   VLPLPSAQQLRYLITLSELRHFGRAAAACAVTQSTLSAGIMALERQLD
205   APA_02050   222067   222609   +   MLTVGDKFPSFDLTAVPGGPEGLKGDFVQISDKSDAGKWKIVFFWPM
206   APA_02060   222817   223344   +   MSIDAIKDRIPDYAKDLRLNLSSLANDVTLTPQQLAGTFVASALAARN
208   APA_02080   224277   223669   -   MSTLFPRPFLTLVGLTFVLSTAQAAPAFSAVEQGNYAVDPNHTQMVF
209   APA_02090   225176   224358   -                                  ligB
                                        MPIPGSSLPSRQPVLFLPHGGGPCFFMDWPDTWDRMAEYLRRTQKT
210   APA_02100   225864   225337   -   MDVSKLSPGKDVPFDINVVIEIPQGSSVKYEIDKESGALVVDRFLFTPM
212   APA_02120   226174   227853   +   MASYQYVYVMKDLTKSYPGGREVFKGITLSFMPGAKIGILGVNGAG
213   APA_02130   227976   228479   +   VDSRSVRTPRLLLKPVTWRDTEDMVRLKADGGAFGRMLGGVRSRQ
214   APA_02140   229161   228535   -                                  ttg2D
                                        MKFLSSRRVVLGAFALLCAGGLFSAPARAAENAKQFIQVFGNQLVAI
215   APA_02150   230037   229189   -   MISGRNGSRLRPRAQAKKSQTREGSSAQRRFRLGTFCLAATLLSTAG
216   APA_02160   231109   230282   -                                  djlA
                                        MAIWGKIFGGVAGFAVGGPVGAAVGTALGHAADTGAILQPPTGGW
217   APA_02170   231433   231188   -   LSRHLRKRSLILAGHDTSVALESAFWNTLEDIANQQKQTLPQLVTKV
218   APA_02180   232518   231430   -   MTAPSAHPSQPAALAEKIRIKALELGFDAIGFCPAHLGPEVRTRLKDF
219   APA_02190   233691   232531   -   MTRFNWTCESTDGAARAGMLHTAHGPVATPTFMPVGTVGTVKAMT
220   APA_02200   234770   233688   -                                  queA
                                        MSSDRTEDFDFHLPESLIAQEPARPREAARLLDATQPDMFADRHIRDL
221   APA_02210   234941   235153   +   MSYALLDAARVAKAAEVSLGVLKTSDETTEAHQRKVIMIERIEALAK
222   APA_02220   235173   235670   +   MAFVLTSPAFVNGDTLPQAQVYNGMGQHGQNLSPALEWKDAPAGT
223   APA_02230   237840   235738   -   MPFYLLSWHGALAGYTGLRLHPVSFAQSFMRGTTPATLDEQSGVLN
224   APA_02240   238650   237901   -   MSLSRLSVELIPRSAEALAADVATVKAAFPAADTLNIPDLMRFPLRSW
225   APA_02250   239561   238647   -                                  FolD
                                        MTNASSSSLPSDHQASLIDGKGFAAKMRQHIREDVLAFHEKHGVTPG
226   APA_02260   240828   239680   -   MADWSISLHNSIHAIPATEWDACAGVDNPFVSHAFLSALEDSGSVRK
227   APA_02270   241312   240848   -                                 yjgF
                                        VMSTPESRLAELGIELPTPAAPVANYVACVQTGSLLVVSGQLPLKDG
228   APA_02280   242945   241389   -   MNATARRHWNGVLMSTLEAAADPDAPLRSVTLPAEWDTDAATALA
229   APA_02290   243023   243523   +   MRIWGITFCEVAFPAQIPLARAQLIESACIFHGPGMARSPIIHNMANFG
230   APA_02300   243572   244117   +                                 ttg2C
                                        MRLMASAMAEKSRRSLTELLTGTFVLVAIGGMLVAAVVGEGRKTDT
231   APA_02310   244169   244390   +   MEKPRVWPQDDGDPITCHEKLRVLEENWQEVQDIMRDAFEDAMLM
232   APA_02320   244387   244974   +   MKRATSKAVACGAILAAMPLLAHAAGTALAPPAVYAPDTWQGKNT
233   APA_02330   245151   245894   +   VLGSLGAQDFRFHLPPLNETAFLLDFDGTLVDIAPTPESVVVPNGLLD
234   APA_02340   245898   247244   +   MGRLVIVSNRVPAVRDRAQPAGGLAVALRDAVQGQECLWFGWSGQ
235   APA_02350   247241   247756   +                                 DsbB
                                        MKGSHPSRPLALFLAGAALLALGVVWYTQHVLQIMPCELCLWERWP
236   APA_02360   247863   250820   +   MKCQDISMSLSGHIKKIDWSVFDATWYAEKYGDVLNFLGIAGTEALE
237   APA_02370   251333   250836   -   LTSIHDLLHFPIMKTSCHSCLPRSGVLAIVRRQNNFLLVRRANAPDAG
238   APA_02380   251467   252450   +   MSADTIAIPGIAKPASRIALGTWAIGGSMWGGADDANASKTIDEALE
239   APA_02390   252562   253014   +   MKEPHPPYQAEPEQATVCMFPLQQLLGRAEAAEYLGIPARRLRFLEIF
240   APA_02400   253084   255330   +                                 uvrB
                                        MASKTSSSAARGKKRPSLSERAASLPPVLFEPEKQAPRPRLKRMEVV
241   APA_02410   255474   256139   +   MTTSDTFIQPDYTALEQASVAPDPFPHVVVPHFIRSEDLGRLFAHRPH
242   APA_02420   256181   258925   +   MIFRKPSAARTRFSLLAITLALLGGTALSPTLAHAQDAAPGMPSALVP
243   APA_02430   259156   259635   +   MSGEKKPVSKVRSSRVKVARKKVTAPAVSEVHEPAVAPQVTEQVAA
244   APA_02440   261565   259715   -   MSTTTKNNLPLTSPDFLFPTDLQKTERKINRILLVGSCLTSLYLEAFKG
245   APA_02450   261894   263444   +   MVSLTAWNKKDIKSIIDSGKFDIEFYLKENPDVKKSGLDPIIHYVLYG
246   APA_02460   263441   264211   +   MSVIKPWDPSPEVIFSYKKKSRKPKNLITVCVTNFNYASVIEECLDSIA
247   APA_02470   265357   264287   -   MIQAASVFSSLQPRAGVKCCPAVCRSLVGTLLLSVGLSTAHAADTGN
248   APA_02480   266847   265354   -   MTASPTSDGHTPANAGARTEDGYHRGLGKRQIQMISLGGAIGTGLFL
249   APA_02490   268185   267106   -                                 impB
                                        MTAVVRRIIHIDMDAFYASVEQRDNPALKGQPVAVGRCQERGVVAA
250   APA_02500   269039   268281   -   MKDLPSSQPNKRPFLIRIGKALRPVFNKLIARDSLIPNTPVLDPDIFPW
251   APA_02510   269821   269204   -   MTRSPVYLTDLACSERLTLWTIRRLAGIQTNPHTPTTGPSGGLFLPCF
252   APA_02520   269999   271072   +   MSVLASLSLPFLRRLDPEQAHELALDALTLGVSVPIKRPKDDPALATR
253   APA_02530   271069   271947   +   MTAQQTVEDMQQITGLAALADQYDGYIIDLWGTVHDGVQPYPGAV
254   APA_02540   271941   272363   +   VVSAQPTLPAVGCGAAILNNAGQILLIRRLKQPEAGCWGLPGGKVDP
255   APA_02550   273207   272392   -   VRLLFLGDIVGRTGREAVLSRLPALREKLALDLVVVNAENASHGFGL
256   APA_02560   273819   273232   -   MVAPHISSPQGDPPAVAARKKELRQHCMATLKARDEALDSGILTHLH
257   APA_02570   274309   273941   -   MALVSVRINGHSYTVGCDNGQERHVQAMAQQVERRVQRVRDMGF
258   APA_02580   274618   274316   -   MQDQAVEPSLPQTDEHAGKQHPATQPPAGQDPIARLDRALQRISFAV
259   APA_02590   274662   275204   +   MASSMLTKNASLFLPKLQPDRLFTIDGYESGMAACRAAREVAGMIDG
260   APA_02600   275201   276115   +   MTLTPKVKAILDQYESDNPGTKMNLARLLNAGKLGGTGKLVILPVD
261   APA_02610   276160   276732   +   MSDLYLVTPAVSDAQAFLPVLEAGLAHHQPAAVLLRLVDMPASAAR
262   APA_02620   276925   276779   -   VWEEPINPKCGKAVFLFSMENIQFSIIVPLPSSADQYDLFDQKARSDT
263   APA_02630   277722   276979   -   MTENLIPFSFEGTEVRVLDRKGTPFWVHADVCAVLEIAQPHHAANRL
264   APA_02640   277976   277719   -   VNISIQTPPLSQREQAEKTQLLADMERIAKELRQRNLNNAVSLAMEA
265   APA_02650   278188   277973   -   MQLAIVDYSTLSRAEIEGMIDSLISALDDRDAAFEDLDPEEDCGGAGE
266   APA_02660   278540   278776   +   MPTVLRVGGYRFFFYSMEGNEPSHIHVESGENVAKYWLEPVSLAMN
267   APA_02670   278805   278999   +   MDTDLLHVVMADGRELSVPLEWFPRLRDASPEQRSHWRFIGRGKGI
268   APA_02680   280706   279321   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
269   APA_02690   280929   281609   +   VPTWLEVQRQRFKCKTCGATIYECLPDLDDKHRITKRLREAVALSAV
270   APA_02700   282210   281599   -   VVAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQGSP
271   APA_02710   282455   282898   +   MEAYRAKEEFFYIYDMDSKAQAISFYERWLDRLPAYLTRHFQPLITSM
272   APA_02720   282944   283369   +   MLAMAAGVVTAPAVHAQGFGGGLGSIGKSALSGAESGVASQGTSM
273   APA_02730   284479   283472   -   MIFWETSMHSKRVLYRTAFTSRALAPAAIGIAALVLGGCTQSRARQD
275   APA_02740   284942   284532   -   MMHKRFILLLGALALTGCQVPSKKERRQLDSMIGKQTTDVVRTFGV
276   APA_02750   286059   285034   -   MSDSATVQPDPGMKDPDHILDRLPFLLRRNLVLRGARAFLEARGCVE
277   APA_02760   286080   287129   +   MSFPVKPSFSRRKTLRTPDDLIAAGLVPPKQHEMLDDVAQHYATAIP
278   APA_02770   288952   287132   -   MPAPIQRFSLPSRLVAMAVLCMGVGATTIQPLWAAAPVASAPDPLAF
279   APA_02780   289759   288959   -   MAGRGGIILHTEEDFKMLRAAGRLAASTLDMITPYVKPGVTTGELDR
280   APA_02790   291033   289885   -   MRHATTAENNKLPKLKRKKTPSLRKWVGLLAGLAVGTTATYGKAH
281   APA_02800   291348   291725   +                                 clpS
                                        MVLHRDPVLHTGNGPLRRGGGTDSSDDGADIGVVVRAKPKTRKPAM
282   APA_02810   291892   294237   +                                   clpA
                                        MLSRNLEQTLHRALILAGERHHEYATLEHLLLALVDDADAVTVFRAC
283   APA_02820   294831   294328   -   MMSSRFPALMLAGLTGLAASCLSSPAQARWGWKQEAPAASSMPATC
284   APA_02830   295755   294838   -   MNTLSRFLDALDSYHVTDGSKFKLSAHNPNDDGNLGLTKADGKLLL
285   APA_02840   295869   296477   +   MISVNSSISAPSEPEETHSLAGMLLVASPMLAQTPFAQSVIYICAHAPD
286   APA_02850   297481   296501   -   MVTADDTPAPRRILLVSGLSGAGKSSILRILEDLEHEVIDNPPLGMLDD
287   APA_02860   297746   298144   +                                   yjgF
                                        MTQKQQADRALVKQHTPHLKHITGGFVLSGITAPHIKGLDMAEQCR
288   APA_02870   299967   298165   -                                   chvG
                                        MTSPPAPSFFKALAGRIGGLHYLSMPGNKPRKGSIEATAAYQASRTRL
289   APA_02880   300690   299977   -                                   chvI
                                        MTERTKQTIALVDDDRNILTSVQMTLEAEGFNVRTYTDGESALQGLT
290   APA_02890   300884   301480   +                                   grpE
                                        MTQDTDPTQVETPAAQPAPAEQTAPEHEAAAEAAQNGQPSGPEARIQ
291   APA_02900   301686   303590   +                                   dnaK
                                        MSKVIGIDLGTTNSCVAVREGNETKVIENSEGARTTPSMVAFTEGGE
292   APA_02910   303746   304888   +                                   dnaJ
                                        MATQLDYYAILEVSRTATADELKKSYRKLAMKYHPDRNPGDDAAEA
293   APA_02920   304895   305674   +   MRIGIAGITGRVGRLLVEEVQAAGATLSGGTTRKPEAASGLPQGVPL
294   APA_02930   305674   307050   +   MPEQRGGQCPPRVGRKAENGDSGWPVWSILLTAAFYPFIRPRPPFLG
295   APA_02940   307069   307806   +   MAEAKGSAENGQPVVTDVKPPPERLYGRQRGHPLRPRQERLLDETL
296   APA_02950   307839   309482   +   MVCMWHVGSSARITFLPCERSAMSQTTLPIRRALVSVSDKTGLLDLA
297   APA_02960   309604   310362   +   MRYLLSLSAALFVSSVAVAAPAHKTPATKAESFSARQTHTEKQADGV
298   APA_02970   310495   310665   +   MAILRWVLIFLIFALLASIFGFSGAAGNFTEIAKILLFVFVVLLVISLFFG
299   APA_02980   311634   310675   -                                   duf6
                                        MTSSRSLTLGVLNGMGSGALWGTVFIVPLLLHDFTSLQMTAGRYIVY
300   APA_02990   311646   311855   +   MQKTGKACSSLGLPEKGWCLSKRVLGQTLCFLWVAATRLRATHCV
301   APA_03000   313916   311856   -   MPELLIELFSEEIPARMQSQAGENLLRLLTEALAPLHPQNAVAATGPR
302   APA_03010   314967   313921   -   MWRGYKPDARSPAQEELHHGLPSLPVRRMGLYGVPARSMYELHYN
303   APA_03020   315011   315862   +   VLGPKGQGRYGMNNDERDLIEKFFARVSGAPQGGFASVPSTRPNLPP
304   APA_03030   316398   315904   -   VKHTEQEPIDTTMIQPHAAASAIDAHVGKRIRLRRTLLGLSQEKLGEA
305   APA_03040   318209   316563   -   VVKLPAFFQTAHTRLRRCWRENWRFMGFMLGVGALSALALPPLHFL
306   APA_03050   319122   318274   -   MSATRNNGGGLSALDLERKGFPELRGGTLSVRIAETEAELEAAQALR
307   APA_03060   319607   319119   -                                   fur
                                        VILKAQSAESRIEQLCVEHGLKMTGQRRVIARVLSEADDHPDVEELY
308   APA_03070   319767   320060   +   MTRSAAYVPDFNVQEEPRIAVLDITTEKCPMTFVRTRLALDGLPPGG
309   APA_03080   321420   320122   -                                   rho
                                        MHLAELKAKSPADLLACAEDLNIENASSLRKQDMMFAILKALADND
310   APA_03090   322188   321655   -   MQQFWKTAFFCASLMGAVATAHAASSTPVQAPPPNGYQAFFDHLST
311   APA_03100   323380   322190   -                                   corA
                                        MENRMFLAHRPGMPARAIETAADAADAVWLDLLDPTPQEQALATQ
312   APA_03110   323568   324887   +   MTGDVRLLHIWQARFFTRYGSGRPEMADPKEHGTSAVHSNSLRHQP
313   APA_03120   324884   325717   +   VSRIAARFKALAAQGRGALIPYLEAYDPDWDTSLELLRKMPAAGAD
314   APA_03130   325751   327004   +   MTHASAANIVIVGAGPAGLAAAEYLAQAGYGVQVLERMPSVGRKLL
315   APA_03140   327001   328479   +   MSSMIIMGEVPGGGPAQLDLAELLATRLLVQGNSGSGKSHLLRRLLE
316   APA_03150   328532   329716   +   MTGTPCSAIARSMTEDPPFSPALLPAGFVDFLTPDARTEAEGVATLMD
317   APA_03160   329784   331073   +   MSNVTVIGAQWGDEGKGKIVDWLASRADIVVRFQGGHNAGHTLVV
318   APA_03170   331296   331985   +                                   phoB
                                        MNKADLLVVEDDPALSRLIGYNLEKQGYAVRVVGDGEAALEQVRQ
319   APA_03180   332005   333312   +                                   phoR
                                        MVAQAWLIMGEGAMVGAAMATLGGMVLGRMRASVSRVPVLARRS
320   APA_03190   333386   334420   +   MLPKMRFSFRSETCAAAVACLLAAVPSFSHAQSVTGAGSSFAAPIYEA
321   APA_03200   334586   336241   +                                   oprO
                                        MAMMRRCSPLLPFFAFASILMSGIAPVAEASSSDDAQIRALKAEMAE
322   APA_03210   336788   336345   -   MKLYKAAFAFLPALLLAACAETPMGPTAQVLPGPGKDYGTFLQEQN
323   APA_03220   337008   337874   +   MKDLRMNTVVKLFIGCDPNDCDLEQLMVLHYSITKYSSLPVDITFMQ
324   APA_03230   339222   337927   -   MNFPCLRSSAFLFASLLGTTFSLFPPAIIIPEASAAQADTSDATLERVVL
325   APA_03240   340541   339219   -                                   corC
                                        LFLFIMGLLTLVLLIAVSILISLSEISFAAAREVRLRSRAEAGDKRAQAF
326   APA_03250   340766   341746   +   MFKALYVEKTETGQQVTLRELDEADLPEGDVTIRVQWSSLNYKDAL
327   APA_03260   343912   341756   -   MGVTLKSLEFGWRSRTPVMLQVEAAECGLACLAMIMGHYGNQIDLA
328   APA_03270   345216   343912   -                                   eamA
                                        MSSDLFRREVLEARRQSWLGQVQASQPLSIRIAAWFTLALVVLAILYT
329   APA_03280   345571   345311   -   MKTLNDSEIAMVAGGTLGDALGTTLTDTLAGLDVGLATILGGVNST
330   APA_03290   345829   347247   +   MKLYGDSQMSDSNTIEITSSNQDVSLSGASGLTGSNYYEISNPYDYHF
331   APA_03300   348076   347345   -   MSNRVALVTGGSRGIGAAIVEALAKDGYDIALSYANSAEAAEKVAQ
332   APA_03310   349039   348119   -   MTQKPVVFIDGEAGTTGLEIRERLAPLPVTLHSVEHAHRKDPAARKE
333   APA_03320   349112   350089   +                                   mazG
                                        MAKCHHIFLHRVAVYVCKPKAETSMTTSPASRQPTKSAQQGNSQQA
334   APA_03330   350690   350163   -   MFSTKKTIMAASCILGLSAASMAHAQNTPSHLPAGTTFPTTPADALPV
335   APA_03340   352826   350949   -                                   htpG
                                        MTETTQNTTPNAETREFSAEVGRMLDLVVHSLYSEREIFLRELVANA
336   APA_03350   353858   352932   -   MKNLAHSLLPRHLARLLENTSEADLPDQTSRAIAPAPFVMQGSVGAP
338   APA_03370   354360   354091   -   MRVWTPKGITKEKTVFVPDVTLHDLRHTWASWHYCLYRDILALKED
339   APA_03380   355071   355796   +   MSGTTTSSGTPISSLPQASAVSGTDTLVGVVTSAGTTQAEQIPVSVLA
340   APA_03390   355803   356603   +   MSTTYGAPTGLDLSACSVTATGGTTSQTLADLGKAVGDNATAVATA
341   APA_03400   358131   356746   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
342   APA_03410   358375   358500   +   MLRYEEIFPVILAGLTLQVSDLVSRVTVMENASKTTTGGAA
343   APA_03420   358500   358910   +   MSTLLDFSAGVATGAGGNTLSGGQIVDAVTSGTPILTKLNPGASCNL
344   APA_03430   359034   360290   +   VEGDLPTTSTTPNMSVTVFEGTTPLFSASGTWQTQGQSSQGALKQNW
345   APA_03440   360341   360847   +   MTDEQSAGTPCVADGVHARLDDHEERLAAVERRQDVTDGKLDSISR
346   APA_03450   360844   361332   +   MSTKNVWGANLSAIKRQIILPVLEAINLGGNAAVNLVTGTGLVESGF
347   APA_03460   361505   361915   +   MLTGCLSACGEVAYMTDAPVPVKPQRSTVVAQTAKAITAGLSLPAM
348   APA_03470   361912   362292   +   MKKVFFALGLLPLLAACANTAQGKLHQAVYDVDSAYHVLANPMPD
349   APA_03480   362294   362494   +   MNAAEISAILGVVTTVAGLAEKYGPEVYETVKQAIEQSKSKTGPNVA
350   APA_03490   363427   362702   -   MDSLKKFKRSLKEQLSLLGYYRQLKHIVRNTQGLEVVSVGDHCLTA
351   APA_03500   363647   364504   +   MSYKTIFMMKGMSTQSKRPNPPHVKMDFFRCLHEGVESGWLPTLAQ
352   APA_03510   364646   364750   +   MSTVTISVLKEFVSKASALHQTWKTSKPSASELS
353   APA_03520   366020   364920   -   MMGKYNKNIEIQLMRIISIALVVMAHQASLRTNIHPHFGESLGTVLRP
354   APA_03530   366704   366312   -   MEQPSPSSTNTPEALRERRTQMITAKLPTKMRRGIQWLRKPEQKWVR
355   APA_03540   366739   366852   +   VPLFGRYLFYKGISYFMAFNKGSIVYSKQGFTLVSVQ
356   APA_03550   366849   367634   +   MSVRVAKICLGVVLACLPVSAAWAQENAACQAFGPENRLPALTRPF
357   APA_03560   368097   367750   -   MFFLLKTLLSALIIALVSTLARRYPGFGALVAALPLVSVFGMIWLWLE
358   APA_03570   368247   368927   +   MRLKALFAASAVLLTSFSVAQAGTVHTTWEKFKAGHAMHRLSVDG
359   APA_03580   370631   369216   -                                 xre
                                        MPQTRTKLFAGPRLRQLRQRETLTQANLADMLDISPSYLNQLERNHR
360   APA_03590   370763   372325   +   MQYHDVRVHPESDRLPRPEQLAWKIAQVAADPVPVEAAVTDMIINR
361   APA_03600   372358   373524   +   MTTHLHRKPKKSVALSGTVAGNTALSTVGQSGNDLHYRGYDIKDLA
362   APA_03610   373521   374453   +   MTYLVGKDLPQTPAGQRFRALLNKPGIMQIPGAHNGQAALQAKDNG
363   APA_03620   374509   376497   +   MSENITILPTQYADYPALMPPAELAAMQRYARRDPDGFWLQQARRV
364   APA_03630   376723   377985   +   MTEPSFSSVTPSTLPDQSVDKATARHVVLASFLAWMLDACDFFIVLF
365   APA_03640   378057   379175   +   MVLASTGLPYAQAHAATPAEQRIITRNAQPRPVPPLATAQVQGDDLH
366   APA_03650   379273   379839   +   MEDLFEGHNVGTARPLKLSEDVVSTATYGGPDKCYRYKLKRVWDP
367   APA_03660   379990   381282   +   MHIMALQNTQGAAGGYLASAEFATMLDRLGEVAARTGLNVAHGQQ
368   APA_03670   381279   381827   +   MRHTLKLSFRSALLGIVGAAAVVAGTAAQAQTVSTGGNGAPNLTPE
369   APA_03680   382908   381895   -   MRRSRRLPLPLPLARGFCFTPGHSARAASMAVASVLLGSVAALPLHM
370   APA_03690   384792   383005   -   MHPYRSHSCSALRASDAGTTARLSGWVHSKRDHGGLLFIDLRDETG
371   APA_03700   385982   384915   -   MPLPQTTTPPQQFGSDNYAGLCPQALEAISRAAKGSTPAYGDDAWTR
372   APA_03710   386144   386758   +   VSKITSIEASARAKAGKGAARATRRAGLVPGVIYGGKQEPTLIAIDPR
373   APA_03720   386855   387436   +   MLLWVGLGNPESSMRRHRHNVGFMAVEAIARKYGFTPWRNRFKGE
374   APA_03730   387436   388530   +   MGFNCGIVGLPNVGKSTLFNALTATATAQAANYPFCTIEPNTGRVAV
375   APA_03740   388615   389940   +   MNAEGESKLQGVTTASANPVQDVPAQAQGQGAMAALAHRARLAAR
376   APA_03750   389952   390671   +   MQPIARGAQVPVTFQPHLAAKPNARGTVIPTWGDNRCLRIGLLGGSF
377   APA_03760   390767   391228   +                                 iojap
                                        VRATTAGAAAPGSVRKKAAAAGPKATTKREAVAPDMLEQSLALITA
378   APA_03770   391284   391739   +   MRLVAIGRMKDKSERALVERYLKRLRPKLEIIELPDGRGSPDEIKRRE
379   APA_03780   391851   392729   +   MTDVLYTPDALRQLQQNGSAVLIDVRSEEDFAKGHIPGAVNMPDIFT
380   APA_03790   393676   392735   -   MDIRHLRYFVTVAEHGSITHAAEALGIEQPPLSQQIRQLERNLGVTLF
381   APA_03800   393773   394579   +                                 aldC
                                        MRLWEYCSMKKQSVMDMDVRSSALGNGVLKKPVANRLYQTSTMA
382   APA_03810   394661   396349   +   MTNPADNAAQCGAELIVKNLEAHGVKHVFGIPGAKVDRLFDALVDS
383   APA_03820   396386   396667   +   MCAPPVLQNASFCYNKRRSSSGCQKGQHSMTEIRASKADVHTLPYC
384   APA_03830   396680   398374   +   MAVTSVETAGGKTRRGAAVLLEVLRSEGVEYIFGNPGTTELPLIDAL
385   APA_03840   398406   399149   +   MKIGLFIPCYIDAFYPNAGVATLELLEKLGQDVEYPMEQTCCGQPMA
386   APA_03850   399146   400549   +   MKVKPVNHAKAAEEFIEDVAHESFHDERLWDLRQKRDEQMHILPEW
387   APA_03860   400546   401136   +   MSSRDAILARLRDNRPDPNAHPLPPVAKLGDMDAGKARFENSLQIIG
388   APA_03870   401327   402331   +   MVEKNTAAAPILAGADIQHGGTGAPRLIGLGLVASALFSVTFVLNRSI
389   APA_03880   403660   402398   -   MDRFIIRGGRPLHGEITIGGAKNAGLKLLVAGLLTSERLVLSNVPRIAD
390   APA_03890   404223   403669   -   MPVMPDTWIRQMAQDHGMIEPFVENQKREGVISYGLSSYGYDARVA
391   APA_03900   404444   404214   -   MTDTPENTSSGPRLSSKAEAARAERMARQAAALRANLRRRKEQART
392   APA_03910   406356   404551   -   VVNISDTHDFAGSGMTFLKTCRHKAEHDMPGRAFPTALSALLAGCA
393   APA_03920   406512   406399   -   MVCPMPFIFSSRALRSSAAFALKGELSTYLRWLTMLP
394   APA_03930   407532   406645   -   MKRAIISADDFGMSVEVNEAIELAHRNGLLSTASLMVAGEAVDDAIE
395   APA_03940   409062   407632   -   MTMRTLFLQPPTFDGFDGGAGSRYQARREIKSFWYPTWLAQPAAMV
396   APA_03950   410364   409195   -   MSAFPFLAAASAVLAVTGCVQSALGAGLLARFRRKEHKPVVLENNP
397   APA_03960   411098   410445   -                                   ttg1D
                                        MKRFSIRAGLVFGMTMALLPVAGAGISAPAAFAQSAPASAVSAPIQT
398   APA_03970   413129   411102   -   MDSSQDKNAPSPIPTLGRFPALDRVEYPADLRNLSVEQLKQVADELR
399   APA_03980   413553   414764   +                                   nifB
                                        MAVPIMQAVRVGKYVVTQHLKKRKRYPLVLMLEPLFRCNLACAGC
400   APA_03990   414925   416307   +                                   corC
                                        VALGEIIPYSVRQKPATRVPYTEGISFFMALSILVIFFLVLLNAVFAMG
401   APA_04000   418409   416448   -   MRAIGQIPHQIAAKAILAGAALLASASVVVTRAHAKPPEAGPEPYSEE
402   APA_04010   419488   418634   -   MMEAALSLLRLYTEWGVDVAVTDAPVDHRHAGAGLVLPPLRGKTP
403   APA_04020   419645   421507   +   MLFCRLLPTVFMLLSATVLASPLYAAQPDTSGAALKGAEPKADTAVM
404   APA_04030   421504   422409   +   MTVDVLDVATTTLTEIAPAKINLYLHVTGRRPDGYHLLDSLVVFAGA
405   APA_04040   422459   422893   +   VQTIPVWLGVGGFMSSKLDLSLSADHTEVHLKVLEQEGQPAVDVAL
406   APA_04050   422932   423129   +   MRGGLVAPCHVLGTFWPHAGRKDAWREATYGKAENATPFSRKNVL
407   APA_04060   424092   423085   -   MPTQIAVITGAGAGIGRAAARALGRAGFDIALLGRNEDRLKETAENL
408   APA_04070   424805   424227   -                                   dedA
                                        MLNRLYARVLRHAASPYAPLWLAALAFAEASFFPLPPETLLVPMVLA
409   APA_04080   425028   424819   -   MSKLTTEERNALPDDAFALPGRRYPIPDATHARDALARASEMLHRGN
410   APA_04090   426517   425021   -                                   matE
                                        MNRPSPPGGRHKACFTTGSIMRHVLVMAGTGAIGLMAVFAVDMLN
411   APA_04100   427468   426662   -   MTDIAVENLQITFPLYHGNARSLRKSLSKTLGRTLNTRFMHDNRDRV
412   APA_04110   428505   427474   -   MARCFGAEQAYAAGHNGSIKSMPTLHKQAGFSIALNTMNSTPTLPDT
413   APA_04120   428541   429560   +   MTTGPVVATPGPPESPFFVPHLRPGTVLVMKIVACNSNLPLAEAVAA
414   APA_04130   429572   430174   +   MSTLLPRPYWYLRHGQTDWNRAGLSQGRTDVPLNETGIDQAVAAG
415   APA_04140   431620   430178   -   MSDLQTILKNKIFVFIISLCSIFYTFSYLILPFSTADTTFYALIGRSLLQEH
416   APA_04150   432183   431764   -   MTFLNSVSNAISSVGDFVTAAWFNKSGLLSALNEVLGPVPTPDHPSK
417   APA_04160   432845   432378   -   VSLIKLVHKGGSPMNTLRKAALAAVCGLALAAGVAPAHAANVGVA
418   APA_04170   433225   433761   +   MSDLIVLGFDHVDDAAKVLTECRALQKEYLLDLEDAVVVTRDAQGK
419   APA_04180   434377   433865   -   MDMTWGNFQAIVQLSAGLNVAILSFVDISLPAIQERRKVFAKARQEL
420   APA_04190   436756   434507   -   MMVRSAALLLCSTVFTALGSSMALAETTTTTTETKQQQKPTETKPQT
421   APA_04200   437747   436974   -   MVDHSIKGKTVLIAGGAKNLGGLIARDLAEHGAKAIAIHYHSAASKA
422   APA_04210   437905   438828   +   MDRIDLFRIFARVVEAASFTHAAETLGMPRSSVSAAVQQLESRVGAR
423   APA_04220   438894   440606   +                                   nhaAP
                                        MLTIENILLLLLLAAVSSLLVALFKQKVPQPVILIILGVFAAVAGMHVS
424   APA_04230   441026   443185   +   MRLKTLLLTGSSLLLVETTAAMAADVANPTTSTGKNTVAAKVASTA
425   APA_04240   443185   444096   +   MQLSVFLRRVVVCALGAALAVFAPGTARAERVASLNLCTDQLALML
426   APA_04250   444093   445106   +                                   fecCD
                                        MKPLRPVVLNTLLALLVAVMAMASLWWGESSINVPAALADWWAG
427   APA_04260   445100   445861   +   MLNVQNVGFSIEGAQLLQSASVRFEAGSVTALIGPNGAGKSTLLRIM
428   APA_04270   448123   445880   -   MIKGFSIRIGLRVLAAGCAIGVLASLGAYPAPAKADTTPPAAFNAPRS
429   APA_04280   449106   448120   -   MPAQPTILALDGGGTHTRAVVIAPDATVLAQATGPGCNPFDRPEWA
430   APA_04290   450038   449106   -   MLQPASVPLAHTETLDARYTDLDIWPSGTVLEALLESQLGAVAAVKS
431   APA_04300   451561   450059   -                                   sss
                                        VQLHHAKTFTPDMTFADLLVMLAYLTALPLLALGLAGRQTSATAYL
432   APA_04310   451975   453261   +   MMSENSDALSISNSEQTASSAPKAENPQPAKAPYPPVATTPTQAGPEG
433   APA_04320   453261   453785   +   MKMSDTTNPSQITGNAKIPSDTYGDSISNVYVTGSDSIEVDAGGTATN
434   APA_04330   453999   454610   +   VVAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQGSP
435   APA_04340   456266   454881   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
436   APA_04350   456411   458216   +   MSAGGYVSGTTLNNGKLTVLDGGTVTDATTHDYGNVTLISGTVNNL
437   APA_04360   459510   458425   -                                   luxR
                                        MLSDIIRNIYATIDNRSLWKNSLANIAKYCNGSDEGGAALVPLDPDCV
438   APA_04370   459721   461412   +   MAESIIFQPSGSSDYTQLTPDSDGNITINQSGSIVSADYYSTFQLPNPSS
439   APA_04380   462399   461470   -   MVARCAEFARTAAPTACSRYTRQKLCARLHRVGTQPPALPSGWTSG
440   APA_04390   462860   462225   -   MVDAHSPAPVLVLLRDDYRVADNPALHAACATGQPVLCAYVQDAA
441   APA_04400   463029   463496   +                                   msrB
                                        MSDSLSGSCGAGGCGPRGPLTPEQEQILFGHGTEYPGSSPLNHEKREG
442   APA_04410   463529   463969   +   MTTHALAHTGFSSFHSGQSANGQLSADALRRLKRVRRFAWLLDAAI
443   APA_04420   464165   465373   +   MRPPFFRPAGRRKHAVQPPDSSAPTPSITTPAASAPHVPEAPQLAGLE
444   APA_04430   465489   467105   +   MSTTPDAYQKFRHLSPFELKDELIKLASGRAQRAMLDAGRGNPNFLA
445   APA_04440   467197   468447   +   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
446   APA_04450   468917   468576   -   VELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQRGIT
447   APA_04460   469330   468959   -   MRRYSLRDDQWERIKDLLPGREGYVGGTAVNNRLFVEAVLYRYRA
448   APA_04470   471408   469507   -   MADDVTTISSNTSWLNYNGGGTQDSHTPPDNATSGLGTGPTLNVTN
449   APA_04480   472369   471821   -   MSTTTAKAAAAKEAHIKEYLGTPTDLKADKVKAVAGGLSEVLADVF
450   APA_04490   473497   472526   -   MKHRILVMGAGAWGTALALHAARTGAQVYLWARNPARLPSGAMP
451   APA_04500   473796   473563   -   MVVCSCNRLTHKDVEAAVADGATRPREIYAARNCKAQCGNCVKGV
452   APA_04510   474132   475583   +   MEGLGYLPFGDESGHFLGAIALHRGDRLYREYIDAHGPLVFTLSWVA
453   APA_04520   476198   475662   -   MSTQTFSSLQAASASSAMADHHTAQTAPAVGTRGTADRVRHVLLFE
454   APA_04530   476261   477169   +   MNVSLEQLEAFVATADAGSFSAAARRLGRAQSAISTHVANLEVDLGL
455   APA_04540   477327   478532   +   MSLQKVRPSLLRALLGSAAILTMGGTAAKAAEPVLQTEQSDVITLPPY
456   APA_04550   478529   479071   +                                  mauE
                                        MSLLAETAPLAALCAGGIGTMFLVAGVSKLRGHDAFLGTLASYRLLP
457   APA_04560   479071   479673   +   MLFLYIWQGLLTVLALGLAVMLVALARQIGVLHERLAPLGNQEAKP
458   APA_04570   479660   480247   +   MLPSENKNSAEQGTLFDRLTESLLRRFAGKTSRRGVVAKLGGVAAA
459   APA_04580   480250   480759   +   MLRAVFRLAVPAVAACATLALAGGVARAADAVPGATSLNPTQVAY
460   APA_04590   480869   482248   +   MGVSGSMRLRHRLSAGMCFALQLAALPAFAQEKTTPDDAERPLAVE
461   APA_04600   482297   482887   +   VQNLIYANAALTVVLLAACIVMGLMLRRIRRLFQEIAPVGALTSSRGP
462   APA_04610   483016   483768   +   MTDSFHLPKISLEGLEKIIIAYSHVPDNPTLDILARLTKMGSAAISRNN
463   APA_04620   483853   484749   +   MVLHAKPACYRLTPDSGEHVLGIPDITLHDGLTFPVITFGTYKLNGVA
464   APA_04630   484756   485622   +   MEALRLAQLQIFCAVMEEGSVVAASRRMHCVASNITARLKELEQLLG
465   APA_04640   485728   487176   +   MADVKQQDLFINNEWVKPTSGNYTPIKSPATGEEVGQAAEGNPQDV
466   APA_04650   488584   487280   -   MTHAFSFPPAKRVSLSGTGALAALLLATLCLPTHAAHANAAEDGTPG
467   APA_04660   490781   488589   -   MSTHSPSSTTRLKTSRRRVLQAGGALLLATLWPTARGRAAQATQAG
468   APA_04670   491239   490778   -   MPTLMINGQPHSVDVDADTPLLWVLRDILGLNAAKFGCGIAQCGAC
469   APA_04680   492426   491344   -   MSVSLSAFPCVFQAAGGRGLIETSPRMGGNFAFGGTLPDGTHSLLTD
470   APA_04690   492534   493631   +   MQDGSYNEVPVIRTPVFKTPADDLAYWLANPDVAACGLSAPQHYAQ
471   APA_04700   493873   493646   -   MINAPSPTPEEDWTEEDPIDAEIDARVAQVHQAAGLPPERPARFGPM
472   APA_04710   494184   494017   -   MFMYLQQVNYVETYLPFFNGAQYRFRPNLRGIQAVPTIHRLEMGLIW
473   APA_04720   494253   495941   +   MGGKGVAVTINSSGNWGDLATDSTDIILDGTASPITLNIIAKNYGSWT
474   APA_04730   497293   496022   -   MPANINTPPPPTRKPTTSIQTPYIIAWFLCLVFYLLQYSTRSAPSVMVS
475   APA_04740   497722   497964   +   MTDDEARMLVGTELDPQKLYMQVEGLKDVLKLAVSGLPPQSLQNL
476   APA_04750   498323   498700   +   MNLRAHDPLYAAKAGLKAGNRIEREVWDSFAGDFERLTGTAHAIRC
477   APA_04760   499224   499853   +   MRYFSKISGALILSFILSGCSSLPPFNFSAKNIQISKNIIKEDLKSITVGIA
478   APA_04770   500222   500527   +   MFQYAFEHGWRQDNPVKDIKMLKYRKNPFPTWSEKDIRIFENFWPIG
480   APA_04790   500771   501181   +   VYRAYQFAVKLYCRRPMADMRACHKGVPGFSAKRDLAFVFFVFML
481   APA_04800   501188   501634   +   VRRLALARFVKNGATAMPHLFRTLGLFCATIAATPALAQDTPPATSA
482   APA_04810   501914   501735   -   MGMFLCIALLGLDLMLYFLGMNVAAMSSAVIAFIVPVIVMCSYSLTH
483   APA_04820   502180   502368   +   MSEKTENHTHHLPSATDISREMEQVKREYDIALKDRPEHAKALGERL
484   APA_04830   503219   502434   -   MTVLPCPSLPSSASVASLFYRARGLAALVLLPTLAGCGYIDSRTAHKG
485   APA_04840   503937   503251   -   MAELSPSSSVRVSARRILVLDLLAGYVDALGFVYLGGLFASAMTGNT
486   APA_04850   504181   505122   +   MLGFRPVFLALGACTALLAAPPAAYAAEKNPHYGLQIMKMRPGPAP
487   APA_04860   505216   505608   +   MSVLIEQFKQSFKYTGRLSVSDFRRWSAWLLLIFILTYIAHLYAVHVL
488   APA_04870   505719   506153   +   MPAPNRQALEKTDKRMRKIVTLGLATIMAATIGTAANASEPGGCLKY
489   APA_04880   506767   506267   -   MISASKKVFRKVALGVTLAVTVAPAAVSALVSTAHAERSERFGGDFT
490   APA_04890   507812   506988   -   MRFSAPFFRPGLFALCAAGAALAGCAEPRTPTTPEGKETPVAATGPK
491   APA_04900   507819   508013   +   VSFYFSCPLAAQARRAVENACLYLCRIMPELLRGMYATTGAVLGLYR
492   APA_04910   508060   509469   +   MVMATASTIPSSGDYILNFAIVDSKGNVSNIQNSVEVTFNRKTSFTING
493   APA_04920   509657   510391   +   VHAPRLHAYAQYGRRRADLTKGCPMPQPSGYDPEETAEIGTDAGYV
494   APA_04930   510398   510775   +   MKIQGYNFFCDMPDDARYLRRAQPDERFIEENMIFILPDRLRKFRRNL
495   APA_04940   510838   511527   +   MAQQRFLKVHFARAGLLAACGTLAALLHGPAQAATKTPDADTTLLD
496   APA_04950   511954   514170   +   MHRNKVIFCALPLTFFISGKVLAATRTPTSGQSQQVGATAAKQGKAA
497   APA_04960   514784   514254   -   MAQHPIFAKQAQKARGFCTALLAATGLVATAHAALAAPRHAPAAPP
498   APA_04970   516039   514789   -   LKRRNLFAASLAAGALAAGRKSWASVPEAAQAMGRTAPPGTVPALT
499   APA_04980   516447   516130   -   MPTPPAPSAPRKQPLPNTQDWPPLPGTRAYMARQLAQDTATVRQIV
500   APA_04990   516547   517413   +   MFAVLGASGHVGTAVTEYLLQQGQAVTVVLRNPQKAAAWAQRGA
501   APA_05000   517437   517868   +   MKIQTVLLLSAASVLCTVQARAADKCPGLTTPEIADCQKQGVDKAQ
502   APA_05010   518275   517886   -   MFQRMKSLLTFYNRPSTEWQKMPVPLRRFLFATFVVEGVLCSYLLTS
503   APA_05020   519969   518482   -   MATSVDTNQTVVFDASDSARRTTVTFTGTGGNLDIQNLSARKPIALT
504   APA_05030   521799   520348   -   MAASTITIPSNQTVTFDATSSTLNSTIDFTGTSGNLELTNLSASNPLAL
505   APA_05040   522034   522687   +                                  lysE
                                        MTWHNWGVFCGIVFFLCAIPGPNMLHVLASVARVGMARGVATMLG
506   APA_05050   522810   523028   +   MSQPKKGWPKSWPLAVLCCCIILTLSIAAFSVGVALVLENSVAGPLW
507   APA_05060   525112   523070   -   VLVEWLYCIRTGLYNSMTTPDWSTGSDYTWVGPTTGGVWTDASNW
508   APA_05070   526132   525281   -   MTRSPVADELERRMAHLGLSQKALARKAGVGDTYVRDILKGKSRNP
509   APA_05080   526290   526955   +   MPVPGSIAFHVFSNTISNHNVLQFPTLLRAPKRGGVMPSNAAALHQV
510   APA_05090   526955   527791   +   MPRSASSPATPAATPASTRRRWSKFWWQDHERDPALRLCSLAAQGL
511   APA_05100   527792   528391   +   VPQRAQIYLGSVQGGTAQKGTEPQARAYGTHLAQAQGAGAITHTPH
512   APA_05110   528435   528974   +   MKTQATAQHTTSAPAGLMAQAALNKPRRTVQGLLQAGDITQEAAD
513   APA_05120   530822   529062   -   MSSSLYGYGNTVTKSGSYTLFPAGWVLGLVSLGGADATFEGSNVTA
514   APA_05130   531135   531695   +   MVMMIGYVSADCPFVSRDEQKRILEETGCNVIFYGTFSKDGTFFLQF
515   APA_05140   533000   531774   -   MPYFSGFEKKFWMRLVPSGSRNILCCSTDTEVVFRGVSQKEEMTALP
516   APA_05150   534831   533488   -   MPANDLRLLIIQPTHYKAPTDRTLFKTKRRQMVPLALPYLAALTPPEW
517   APA_05160   535262   537451   +   MIGFGFLRPVMQAAARGMARTYAQPSGAVPVVLARISQRLARVAAW
518   APA_05170   538086   537448   -   VTENLGRLGDGEVMDKACAWCDRIYHTNTYAPYCSARCQKKAEKA
519   APA_05180   538249   538791   +   MPTAGRRAELACGAVLRGSGRWWVVAQAVPTGVVMCPLLCTPRDH
520   APA_05190   538993   540447   +                                  terL
                                        MPHARPECARTMQAGRVARAELARRQAARQHVLDFARYTLPDYKA
521   APA_05200   541595   540444   -   MGGIEMQPDCGAVSRGAERMICNHPTSPRNLPSMTAQPTAPTPDTDT
522   APA_05210   541744   543123   +   MSGLSFSPRARLGWWQRLRGRRAPVALPRKEPVLPQGAFAADVAKV
523   APA_05220   543120   544121   +   MNTRNTGQARASPHATVAPDTQPLALDRASVRRVDADGHLHIAHCI
524   APA_05230   544159   544659   +   MSFQNQVNIQPALAVPGDFASLNPTATFPAGEGALVAAAGGCTVAA
525   APA_05240   544659   545696   +   MLTSHSELAELNRLGFVVPDARGLIGAEHLVSDSMAMDAQPALSTTA
526   APA_05250   545740   546057   +   MATSSTVTVGCKLPNGLVLELAGQRHELAGARTAKAGGYGLTPVPA
527   APA_05260   546094   546600   +   MFSMPENQPMQAAALPSACNMAEDGAVVFDAAAFKACYPNLVASA
528   APA_05270   546591   546971   +   MAMNALFNMALGATAALLPSVPAILRVNTGYETAPDGSTTPCFMDIA
529   APA_05280   546968   547504   +   MITQNVQQPDEAQLFAALRAFMLEVLPAGTTVLQSRQNRTPPPRGM
530   APA_05290   547523   548677   +   MILPVSSLVSVTPGVLAAGGTTNLLNGLVFSTNTALSSGLSTFATAAE
531   APA_05300   548680   549117   +   MSDYDITAANSVFTITVPGLYNTPITLENYAADRAFETTTRDLAETAM
532   APA_05310   549157   549612   +   MKTVEYTHSLPGEDQGKVFVLTRMDAFAADSWARHVLQAAIRGGA
533   APA_05320   549636   549797   +   MAAVVASGLASLHDLKTVYDSEDFYTLVEILSVRNWNMAHTPAQES
534   APA_05330   551589   550204   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
535   APA_05340   551655   552458   +   MYNPSVRFPRLQGGVLPVFAARTGSVRHKVDVGSVRGMPDRQKGV
536   APA_05350   552494   553207   +   MPMLPVSLPSVWNIPVAAGVPALMGQSVSAGVQASASVTVGSLLDD
537   APA_05360   553204   553524   +   MSSTDTTLVQVPISAVPAQMFKITLAEQTLQIALRQRSTGLYADIWCA
538   APA_05370   553521   554447   +   MSGTQTTKTPDWATRDVEVTFRLLNGVFGAADGVDTVTLSGLQVQ
539   APA_05380   554444   555133   +   MTYQNSFASGFPPNMPTSGQAVFDRAGAAASDYNALVAVMRRMLV
540   APA_05390   555145   555498   +   MKTLLLDRATWDLAVDAQGNIAVADVPYATAQDVSSAVRVFRGEC
541   APA_05400   555527   556720   +   VPAPTLDDTGFVLPQEADILSGVLADINAAFGNTLNTDLSTPQGQLAT
542   APA_05410   556720   557298   +   MQNVGQTVLSQYACSPSLNALLEGWNQCFDPAQNIENWFASIWNIE
543   APA_05420   557306   558403   +   MKQADISGQFTTPIAASATAANCADIPAAQTTAGDGSASMALGFPPE
544   APA_05430   558410   558979   +   MTCSCNTASTACALLPEGAVLAPGWQPASARVLPVMITPGLCLRGQL
545   APA_05440   559102   559548   +   MKPKQQKPADSLVNRFNENVAVKMTIMFGSIWCVYVFFLFSLVPAV
546   APA_05450   559621   560883   +                                  nhaAP
                                        MPPFFNPLALFAIVITLATAFAIINHRYLHLPTTIGITAQALGVATILLFL
547   APA_05460   560890   563391   +   MSALIQREVCWCAAPKVRRCCRQRWWMACALASGTLLSGMVWPG
548   APA_05470   563394   564644   +   VADISLQNTAQFGVHGVQEKRDWPCLTLDEVCAVLAHFANMPPARD
549   APA_05480   564644   565207   +                                  pnuC
                                        VSGLEWLAAITSALGVWLTGRRTVWCWPVMLLASVLYGAVFAQDH
550   APA_05490   565877   565332   -   MKFRYLAAAAMMGVMCASAPLHAEPQFNGPGGRGGPQGGPNGGPG
551   APA_05500   566127   566432   +   MKKALFLLAALGVAMPVASHAESHHHKHEHKHNENGDNQNGRGD
552   APA_05510   567455   566550   -   LRPRALYTGPVEEQRSIRQRMQFILTFSCPDQPGIVAAVTSVLAERGA
553   APA_05520   568182   567760   -   MPHQPDIRIRRVYEAAQPDDGARVLVDRLWPRGISKERAALTLWLK
554   APA_05530   568264   568773   +                                  badM
                                        MGIPAHHGVKGPMRLTLHTDYALRTLLYLAVHTNRRVSIKEIARVYG
555   APA_05540   568845   569690   +   MAHAHCCGFPALGLAPFHAQKRAMGMTRKQPQTVLVTGATAGFGH
556   APA_05550   569701   570135   +                                  crcB
                                        MSFYSCLIVMLGGALGTLARYFVSVLTAPISRYIPWGTIIGVNMVGSF
557   APA_05560   570647   570264   -   MFTHIVVGSNDIARSKKFYDAIFEAMDIPPSEIHPNGRLVYAKQGQRF
558   APA_05570   571541   570717   -   MKHWQIDQLPWDQFDPSKVDPQLVPAIKAASVVERNSVDYALYLNN
559   APA_05580   572213   572413   +   MQYCSFWQEPYVLTCREEAALHESIACRIARKHGGMQLQFFVIKPAL
560   APA_05590   572214   571774   -   MPRSENSQIPTDIPTIRVVAMPTDTNPAGDVFGGWIVSQMDLAAGTT
561   APA_05600   572534   574228   +   MAINLLFDRVIDYSVEDLINLNVTGNILVTRDANTPAGDPVVVNLSN
562   APA_05610   575543   574338   -   MGPVCVNPAEQVENNGRVMIDRFSSSRHPARQEPRLLPDSGTRAAEN
563   APA_05620   577872   575668   -   MPEVRWGGIFFCFRTLRWMGLPRTPAPEERKRRLHLSKLLSRSSLRG
564   APA_05630   578009   580465   +   MRCTLCGGPQVHKSKGYGVISGRSRNRQRVAIGQVPHQSRRVAAQR
565   APA_05640   581300   580629   -                                  tetR
                                        LTQPPTTRRSASSRPRIRDAEATRQRILEAAKKEFAQNGLEGARVDTI
566   APA_05650   581561   582580   +   MAKVKTAAQAVTLIKNGATIAVNSSSGLLCPDAVLEALGQRFAAEGV
567   APA_05660   582584   583099   +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
568   APA_05670   583157   584542   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
569   APA_05680   584805   585692   +   VDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTAD
570   APA_05690   585901   586470   +   VPLLDFKFGCASNAEAFVASPHQFSYFQAGGFDCSLLSFLEIGQDGSV
571   APA_05700   586513   587772   +   VIQDDRTFLSKLFDAAIAAANPEYVLAAHLPERPRGRTVVIGAGKGA
572   APA_05710   587908   589050   +   MFLNETQEEVRATTRSFVNAVVRPAAEALDREERFPAEIYEEMGKLG
573   APA_05720   589047   589814   +   MTQVALVTGASRGIGLAIAEALAKNGFSVAVNGLADDAELAYACQH
574   APA_05730   589817   590974   +   MTMKIFLPDSKGVKTAYQLSGKYTPAKSLPPNPARIVYSAAHVTADP
575   APA_05740   590974   591831   +   MRDFRLSTAALALNTATLGHNMPGAGAGWSAEQTLDACARRGIGG
576   APA_05750   591847   592608   +   MKILVPVKRVVDYNVRVRVRADGSGIETGNVKMSMNPFDEIALEEA
577   APA_05760   592900   592673   -   MRERIWDMGARPAIPAKRRDGPVACPKWAYRCRHLVENLWARLKE
578   APA_05770   594035   593148   -   VDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTAD
579   APA_05780   595737   594298   -   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
580   APA_05790   596103   595741   -   VVAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQGSP
581   APA_05800   596339   597205   +   LTAIEPLGQADVLITGQNCKGAAEAAAQFIGVRKVFVADDAALAHGL
582   APA_05810   597475   598974   +   MTNMTKTITLPTVPREFGLYINGKWVAPQGRNLFERRSPAHGVPVTR
583   APA_05820   598974   600566   +   MSRGYDYIIVGGGTAGCVLANRLSSNANARVLLLEAGKADKHPFIHM
584   APA_05830   600659   601930   +   MECSIANAKEIQVENGGIFTFLPFSMFFLFGGITSLNDIVMPKLKDVFN
585   APA_05840   601978   602256   +   MREVSLTVGALACLALLPSKGEARSRRPELSEYYWQSRTGKEPKALY
586   APA_05850   602253   603488   +   MTGDWWGLRHRLAQRGVVFSGHYFQDTAGNPAGGKTKAVRYAHE
587   APA_05860   603733   604320   +   MAGKNGACLMALALLLGACSSRIALNEASFPIQDLPVQHLVQTPVAY
588   APA_05870   606160   604403   -   VNLYVANFLTFLRCFMATDTWTGAAGDGNWNTAGNWSDGVPTSD
589   APA_05880   606529   606894   +   VSACADCFPIFWGDRQMRRYSLRDDQWERIKDLLPGREGYVGGTAV
590   APA_05890   606952   608337   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
591   APA_05900   608659   609000   +   VELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQRGIT
592   APA_05910   610026   609109   -   MTDQATDTLRAAEHERERMRQEIIDDLDEEIELELQEDGLDGSISESE
593   APA_05920   611695   610082   -   MSGTLLSPAAAPRPNMKGGTNQAFRMFFMGVVTAALVFVGYSVLA
594   APA_05930   611990   611766   -   MCAEPVTAMQPDAHKPKWREAVRERWRTTLLYVWERNGTPHPYA
595   APA_05940   612229   613224   +   MYGKVRQNMSVQISREALLRAYRSMRTIRVFEERLHVEFATGEIPGF
596   APA_05950   613272   614300   +   MGKKSFRQAINEALRQEMRRDPRVILMGEDIAGGRGGTAGITDAWG
597   APA_05960   614304   615470   +   MPNTITALTMPKFGLAMTEGKLASWTVPVDQSVQQGDELADIETTK
598   APA_05970   615663   616217   +                                  hspA
                                        VILLSVITRVPRAGPLCQNKEDKMTSYVNTGRSPVVRVPVGTVRVAD
599   APA_05980   616246   616437   +   MKDRLMSTKNKTVQIDSTKYEMLGVINDGDSKVRLKDSAGKVEEM
600   APA_05990   617992   616709   -   MSDRFRVVIVGGGVAGMAIATRLGNSLGRSGKLDITLVDKGFSHVW
601   APA_06000   619182   618127   -   MSTETQTLRGLIEKRGAHIKVEGEITACAATRDNSRFAFTTGEGDVVV
602   APA_06010   620183   619179   -                                  cobW
                                        MSDASSAPASAAAADTRIPVTVLTGFLGAGKTTLLNHILTAEHGRKY
603   APA_06020   621737   620271   -   MLCMKCYTRLHPFFLPFMPLRMPPMPASVFPTTESLRHLREHAKAGT
604   APA_06030   622755   621790   -   VPELPLPSSNRGIAVVSLGVSFVALGLKYAAYATSGSIALYADALETII
605   APA_06040   623997   622816   -   MRLSMPSPHDHTPPSQPAGSACGHAHHTPGQTNGHSHAEEACTAGH
606   APA_06050   624204   625862   +   MLRLTELRLPLDHSPQALAQAICERLNISPDALEHYSVFKRGHDARKR
607   APA_06060   626690   625893   -   VLLNVIERGPDAPSTLPPVVLLHGLFGRARNLGFVQRKLAATRQTLA
608   APA_06070   626940   627755   +                                  uspA
                                        MQRCLVILSQQDQAEVLLNMAAQFLARVNGNRMDVLAAREPPTQV
609   APA_06080   627816   630152   +   MPAFSFSARHRFCAHWPVWHMVVLVLLPVLVHLPELLGPALWGGA
610   APA_06090   632213   630243   -   MTPSPTRRELTLRGLILGALITIVFTASNVYLGLRIGLTFASSIPAAVISM
611   APA_06100   634254   632386   -   MTAYPGFSRPGQAIAAVYCPAFSPPALPARTPVYWPAFGLHILLAASA
612   APA_06110   635145   634501   -   MVERPGTGAAAFPICGPAIGQPPTLPQPFRSIALPAPLSAVHVTHRLEE
613   APA_06120   635222   635452   +   MSGSISPSEISRLQTALRRLLGSEKLTINPAPRAGMSVELAADGEVIGT
614   APA_06130   636186   635575   -   MISLPQFGQPARAASLTPRQTARGICVASAAAALGVYLASPFVTLWS
615   APA_06140   636380   637192   +                                  moeB
                                        MISQFSEDEIQRYSRHILLPEVGGIGQMALKGASVLIIGAGGLGSPTAL
616   APA_06150   637470   638486   +   MMFTRSSIFRLHLLACAAGCAVAFASVPTVSANAAEQKKTSAHSHHA
617   APA_06160   638519   639979   +   MAESTQQGSGAEQAQTCRTKIVATLGPASSDYATIRDLALAGADVFR
618   APA_06170   640124   641338   +   MAPPRSRLARRAMLKGITALSATVAAPVLARGADEVLPDTVRPPDVT
619   APA_06180   642504   641350   -   MLLHSPARSAVSAAPTLSLTVVGLMFGLVMGLGAPLFTLEMVDLGF
620   APA_06190   643069   642569   -   MAATGGGRTQAAWLAFAPLWWCARHLGTHYIERVFSMDIQAIDQT
621   APA_06200   643211   645028   +                                  bipA
                                        MDIRNIAIIAHVDHGKTTLVDELLKQSGSFRENQHVAERAMDSNDLE
622   APA_06210   645384   645683   +   MISRRLLAALSTVALLGAAAPSFAQEAAPPAPPAASGPEAGAQAPEGA
623   APA_06220   645814   645677   -   VLCVRHKKGRGGKTTSGLFVFRSFTPQQAGSTAPVTQCPFLPGYY
624   APA_06230   647196   645940   -   VQVIILGAGVIGVTSAWYLASLGHEVTVIDRQPAPALETSFANAGQV
625   APA_06240   648436   647420   -   MTDTPAETDVAIIGAGPAGLFAAFQCAMLRLNCVLIDVLPEVGGQCA
626   APA_06250   649821   648601   -   MAKIKVKNPVVEMDGDEMTRIIWHFIRERLILPYLDIDLKYYDLGIEN
627   APA_06260   650208   652325   +   MFSFISLHGHILAHRDFYLTGIPVAQAVSPQWNVVQLNPAGNNLQGF
628   APA_06270   652333   652485   +   LAKAGQFGLTGFFINSSPGRLNPKYIVAQRLQPVAVDASQQGSRADA
630   APA_06290   653869   652694   -   MTKLLNRQIANQPVTIFTLMSELARKHNAINLGQGFPDTEGPQDMVQ
631   APA_06300   654109   654447   +                                  glnBK
                                        MKKIEAIIKPFKLDEVKEALHELGLQGITVIEAKGFGRQKGHTELYRG
632   APA_06310   654553   655998   +   MVKKTAPAGDSKAAAIAKVFDLIQEHSVELVDLRFTDPKGKWHHTC
633   APA_06320   656081   657187   +   MVLKTRIFSALGLLCLAGCATSGSVPGGHVATAPHAIAQPQPPASATA
634   APA_06330   657392   659806   +   MIQTNSHRPDIVLRITAAVFAILGVFLAGGGLWLALLGGSCFYVVCGV
635   APA_06340   659918   660172   +   MRDPALMWNEPYLETCCRAALHRLCLAGEVGRPTGMKDDPCLTRL
636   APA_06350   660169   660813   +   MIPAERIWHALDTLAQERGLTPSGLARAAGLDATTFNPSRRHTGQGV
637   APA_06360   660939   662744   +                                  lepA
                                        MTDTPLSLIRNFSIIAHIDHGKSTLADRLIQACGALTAREMTNQVLDN
638   APA_06370   662871   664046   +   MNSTTPLAIGEQQHVRFAEGLGLDCGVTLAPVDIAYRTYGTLSEKRD
639   APA_06380   664046   664651   +                                  metW
                                        MRLDQRLIAEMIAPGTRVLDIGSGDGTLIDHLFRYRGCDARGIELNME
640   APA_06390   665108   666445   +                                  rhlE
                                        MTKFSDLALAPPLLKALAEQGYDTPTPIQERSIPYLLQGRDLLGLAQT
641   APA_06400   667486   666521   -   MNKHVKACPLKLLLHRWKKKPPKGPSFFFSALVLVACCLSFTSATAA
642   APA_06410   668105   667419   -   MPSCSEARSSLLSLLRGVEHFNTEIFPAKKELFASLAKGQAPEALFIAC
643   APA_06420   668886   668263   -   MNLQKTEKTCLFIDGSSLYSTSRSLGFDVDYKKLLDFFAAKTHIIRAY
644   APA_06430   669042   669554   +                                  hppK
                                        MSEMNTRLVLIAIGANLPHLRLSARQTCEQAVQALKNLPQLEVEAVS
645   APA_06440   669645   670016   +                                  rpoK
                                        MARVTVEDCVEKVPNRFELVVYAAQRARNISRGEELTVDRDNDKNP
646   APA_06450   670022   672394   +   VAHTGGDHSPPVPVSVKDSGEGIMQPVKTDAPVEENTAPVPAAENG
647   APA_06460   672391   672798   +   MTLISAGVDLCDMRRIAQALERFGDRFTQRVFTQQERAKAESRSGQA
648   APA_06470   672887   673693   +   MSTPEHPPTTGASKPEKGGNTVLDSLRTIITVVLVVTVVRTFLFESFV
649   APA_06480   673708   674424   +   MSDAARFRLEELEVRLGYRFVNPDLLQEALTHRSAAHQKAGGRKRQ
650   APA_06490   674431   675333   +                                  era
                                        MADDTTRCGFAALVGAPNAGKSTLLNRMAGAKLSIVSPKAQTTRFR
651   APA_06500   675408   676184   +   VGSVWDFLQDRGPMTASVGEKPSRKRVLLKVSGEALMGNGAFGVD
652   APA_06510   676291   676854   +   VSDLNALLDDLKRRMDGALDSLRRDFSGLRSGRASPALLEPVRVEAY
653   APA_06520   676917   677657   +   MSTRLTDKKPAIPTHVAVIMDGNGRWARERGLPRLAGHRAGAEAVA
654   APA_06530   677654   678490   +   MSTNAQDTSAWRDLRPRLMSAAVLVAVAGTCIGLGGLAYDALILGM
655   APA_06540   678500   679723   +   VVWPPVERSAAVCIFRFGKTLSMRTVTVLGSTGSIGCSTVDLLEQAR
656   APA_06550   679755   680867   +   MMIHDYLRTLLSFVFVLGVLVSFHELGHYLAAKWRGVHVEVFSLGF
657   APA_06560   680953   683457   +   MGFRTKSDPDGRKQILTGKRSALFVSVCVLPFVMVDGRQASAASTEG
658   APA_06570   683462   684334   +                                  ompH
                                        MMRFSTRTALLGAVVLSFSSALVPSAQAQNGGGWFVPKTQQPAAQA
659   APA_06580   684337   685422   +   VAEGTTFSGPADPRFFTRAGPFDAATLAETAGAELVLPKAGAVPEEG
660   APA_06590   685536   685946   +                                  fabZ
                                        MQAIPHRYPFLLIDRMEDIVLGEEATGIKNVSVNEPFFQGHFPARPVM
661   APA_06600   686080   686937   +   VHAAEEARSTVVHPTALVAPGARLGQGVVIGPWCSVGPDVTIEDGV
662   APA_06610   686934   687791   +   VSTPSAVGILAGGGPLPGRVAEAAAAAGRPVFILGFEGFAEPEVIGPW
663   APA_06620   687816   688208   +   MASFLHTMVRVRNLEKSLAFYKLLGMHELRRREVPEGRYTLVFIGY
664   APA_06630   688644   688216   -   MQPCGRIPRKMEKNMNNMPFPIRAAAVIFCLPVAGAVLAGVLGLSFP
665   APA_06640   688766   688900   +   MKRTYQPSRLVRKRRHGFRARMATVGGRKIIGNRRSKGRKRLSA
666   APA_06650   688924   689304   +   MDGPAAQEQPAAESARSLRLKKRKQFLFLASRGRKAPVPGLVLQLFR
667   APA_06660   689427   691178   +                                  yidC
                                        MDPKRLILATALSALVLIGYDYLFPQHQPVPPPQPGVHAVAPPAPASS
668   APA_06670   691175   691858   +                                  engB
                                        MTDDAASSFRELKDEARIAAALEEGRRLFAGSCEFVFGAQKLGQLPP
669   APA_06680   691890   692807   +   MTEPRVPSSHSHHDAAQEAAILAGALPYLRRYAGDTIVVKYGGHAM
670   APA_06690   692944   693792   +   MTNETLRAHIEALWEKRDQISSATTGEDRKAIETALEALDSGALRVA
671   APA_06700   693831   695006   +                                 argE
                                        MADAAQVSIPANLALTDPVGVAQALIRLPSVSPDPGASQYLLAAMLE
672   APA_06710   695003   695626   +   MIPDTSKPGVIRRTLQGMLLLASGRRDGIACFDGTLDAFGAALAPQL
673   APA_06720   696439   695651   -                                 truA
                                        MMEEELAPVQRWAVKLEYDGTGLVGWQRQKSGLSVQSLLEEAAAR
674   APA_06730   697374   696436   -   MRLVFMGTPDFSVPALRALHAAGHEIVAVYCQPPRPAGRGKKLQAS
675   APA_06740   697954   697394   -   MTHAANTDISFSAASDGAAPLQILTPPHPVLRQKARLVKPEDVAEIRK
676   APA_06750   698048   698701   +                                 hspA
                                        VCCPIPPYGRIQAWGRGCVSAGLSHIVIRSDAVTGLIFLSRSRKEEAW
677   APA_06760   698720   698986   +   MKSSIYNGSAPVMPHAAERPANVRQLSESQFRSLGLREVAYTRPALM
678   APA_06770   699699   699079   -   MHIQVSGKQIDLSDALKHRVNSHLGNLAERYFDKALQAQVTFSKAR
679   APA_06780   700045   700347   +   MLLRSAPPVEMPKMPRGQMVRVKLGCMAGLGLLYGAFVWHLAHE
680   APA_06790   700380   701213   +   MTGLSVASVHVYPVKGLRGLSPTQARLWPWGLEADRQWMITDLQG
681   APA_06800   702046   701225   -   MNQEVTWTSEETVREEVVGVGPEPTDIHAPHRPGHGLYARGIGKSY
682   APA_06810   703155   702049   -   MRRLFSRSRPALRAASAVMAALPCAMLALSGTALAQAIDMSHGGQI
683   APA_06820   703894   703157   -   MTSPEDKRPQRADFARSEETIRRQRERLAPSAQLRKLPDAAKLARRR
684   APA_06830   704904   703891   -                                 kpsF
                                        MNMSTHISSQASSSPGVEAADVVRTERAGLDALAEALENPVGLGGA
685   APA_06840   705605   704952   -   MTSAPSEGAITLHRNDLPDNVTFTGSVAVDTETMGLNPHRDRLCLVQ
686   APA_06850   705810   706652   +                                 spoU
                                        MRQPRHGRPVRRPRVSSAGGREGAPSAPAGTCWLFGTHAVAAALNN
687   APA_06860   707938   706586   -   MIQSPPSAPQTGGLMEDLSAASVREPVPAALKTMPTDRVFWSHFSPN
688   APA_06870   708862   707987   -   MPEAAMLCHNHHKQRPICNMKHDTVLITGASSGLGQTLAQTLARPG
689   APA_06880   708905   709558   +   MAHNAQGNHNGAERRRGVCLVISAPSGAGKSTIANALRASEPVLKH
690   APA_06890   709564   710997   +                                 rfaE
                                        MDFSAITVLCLGDVMLDRFLYGSMDRISPEAPVPVLLLDSRREMPGG
691   APA_06900   710994   712178   +   MTVHDLPGAENLPLVAVRNRFARWLFEDALPFWASTGCDGIASNPA
692   APA_06910   712197   713753   +                                 dnaB
                                        VPVSRTWQRESDTSGVVSMTTTDTPNQKDESLLALTLRQPPANVEAE
693   APA_06920   713932   714720   +   MDKLGAIIAMAVCLLVLLNISTVFAFLFLLVKIALVVGLLALAGFLVF
694   APA_06930   717199   714782   -                                 mscS
                                        MRLKRFCSLFLACFVLTQGALLFAAPSPLLAADTDNTSVTPPAPTTLI
695   APA_06940   717580   717431   -   MKRAVLLLACTLGLSACGMFSSSEPKHLTTAAQWEKYGYHDHLKTG
696   APA_06950   718457   717669   -   MSQTMTGTTPKIRIRDLHKSFGAKKVLDGVSMDVAQGTSFVVIGGSG
697   APA_06960   719239   718454   -   MDMVLDLVARLGRATLSLIRAAGALALFAASGLSHIVRPPFYGRVFL
698   APA_06970   719448   720479   +   MDDVSRSVFVFGSPCNSNYGKVVFLPNGQLYGYQHENEHTWRMDG
699   APA_06980   720565   721956   +                                 radA
                                        MAKKPSRTYVCTNCGAVHAKWAGQCDACGEWNTLEEMAVEPLAA
701   APA_07000   722180   722356   +   MKKHSIRKIPSPHNINSAQGTHLGSFFYASIAARHVGGAVRDDSFLKS
702   APA_07010   722413   722685   +   MKKTLYMCVAVLGLGFVQSASAATWDGGVSRHVEVKNPDQPDTTK
703   APA_07020   723434   725029   +   MSNSFVRHARSHATSVCRGSRGFVKASCSLVALGLAAFAAPEEVRAE
704   APA_07030   725099   726469   +   MPEPTTLPAGKPADGLRNRHIAMIALGGTIGAGLFVGSGAAIAATGPA
705   APA_07040   727230   726499   -   MRIKPLFSFFFFRGDIMTARTGHDAKLVIAILMVTMAMGMLDAISLLH
706   APA_07050   731113   727388   -   MSGGNNHYEAKTTCTHGRPGSGSPIRNEKPMSSTDTFAPDFASRTPL
707   APA_07060   731936   731223   -                                 gntR
                                        MLPASLFAKTEITGHGTASEAICDALRRAILEDQIQPGQPLPQSELASG
708   APA_07070   732479   732913   +   MKLIAVRALSALALTTSLLAGAAVSAHAQENTDAPVTRAGDTSRLTD
709   APA_07080   733131   735053   +   VVDAFFPATDNPVSDRYQDLVQRAQRDPEEFWLAQAQRLAWHTQP
710   APA_07090   735407   735078   -   MVQKCAPSATQDHNLPQQDTPIMIEHNQNNTDTQVPEMPCPGLYKH
711   APA_07100   735441   736016   +   MFLFCVNPGHATTTGHAKTHAHTSKRTHHAAAAARSPAGGAPVVLT
712   APA_07110   736026   736313   +   VPAPQPGLAYTALKTLATVAITVVLIALLRGGLALLPKFDSATGGQV
713   APA_07120   737351   736386   -   MSTIRTAWLAADGLTSVLEADLAWRGVTIDRWHGRLALSSSKPVYS
714   APA_07130   737806   737348   -   MQEMAGHVAFPVFHYGGCAYTAELMSFSLLLPRLWRICGGLLAATG
715   APA_07140   737877   738443   +   MSIRLDRIVTRGGDGGQTSLGNGARVAKSSARIEALGTLDEVNAITGL
716   APA_07150   738719   739375   +   MNTTSFMPPLDADRERDEGLEEASMRNALERLGASHKGRSAPSSPRP
717   APA_07160   739409   739876   +   VRNPPVTPALVLLVADIAVGVACVLLPPLVMGFLALLKDIFGVLILPF
718   APA_07170   741435   739966   -   VCSPLLQEPAPMPENAALPQPLHDALLQLLGPAGLLTATSDIDPFCID
719   APA_07180   742014   741451   -   MSDIDPKELKILSDILALVLEDQPGQSATALEALRNRAKRNATTGGAL
720   APA_07190   743012   742011   -                                 sua5
                                        MTNLLDASSSGLQTAARILREGGLVAFGTETVYGLGGDATQPKTVAR
721   APA_07200   743872   743102   -   MTSHTDADLLALAARLADEAAEIIRTIRARGFETITKTDSSPVTEADH
722   APA_07210   744016   745500   +   MLQIKFSSASLPAGGALAILVPEGEKRSAIFQQADKATNGALTRAAKA
723   APA_07220   746008   745562   -                                 holC
                                        MTQIGFYHLTRTSVTEALPKLLARTLASGQKAAVWCASKPMLDDLD
724   APA_07230   746115   746969   +   MANTVTLADGTVLPALGVGTWNMGETPARWPEEVESLRYAVLNGV
725   APA_07240   748104   746986   -                                 htrA
                                        MKTLLRNLPALAVACFSLQETGAHHLAQAASLPTFEPAVPLVSGGPIS
726   APA_07250   750810   748243   -                                 hrpB
                                        MTASASSLNPFSIAQGLPVQDVLPELCAVLAQNPTTDHPASAILVAPP
727   APA_07260   751872   750910   -   MRFCAMMLFSRMRLSGLTAALLFPALLAGCADQKQPTQFAPLRYDN
728   APA_07270   752944   751994   -                                 hsp33
                                        MEKPAFLDRDRPDVPDLVVPGGVTPFYLAGRPVRGRLVRLGVLADT
729   APA_07280   753385   753068   -   MSGTDRTVSMTSTEDTPATPGWVESSLDAILATLPFPADKLAPFRSAY
730   APA_07290   754376   753390   -   MTTALPSSSLATPRHFLDLKDLDAATLRQILDVAASMKRMQQNRRFP
731   APA_07300   755635   754388   -   MQVQQPPTQRPDSMISALMPTYKRADLAFERGEGSWLQTSDGRRFL
732   APA_07310   755835   756497   +                                 recX
                                        MMHSGSSSSAHTSSGFPQLDRRVLREAALAHLARFGTTRHGLEQVLL
733   APA_07320   756494   756952   +   VKRSLVLVLPLLLAACAGGRGSWNGSVQCAPYAREHSAVNLRGAAA
734   APA_07330   757081   757338   +                                 tatA
                                        MGSLSIWHWLIVLVVVLVVFGGGGKISSLMGDMAKGIKSFKKHMAD
735   APA_07340   757372   757995   +   MDQTVTDFARAVQDILFAGQRMDQRGWVPATAGNISRKLADGRIAI
736   APA_07350   757992   758537   +   MSSLTVYKDTTPEHPVLQTQDPAEMARVLAPLGVRFERWEGPQIPPR
737   APA_07360   758549   759253   +   MADTRIPPRVVLLDIEGTTLPVAFVHKVLFPYARKHLPALLEQRENPV
738   APA_07370   759257   760204   +                                 ribF
                                        VLKAQLHTNWRDIPPEAHGCAAALGNFDGVHLGHAHLVHSTHAAR
739   APA_07380   760378   763293   +   MTTSSSDQDTQSPADLYRDTVFLPRTSFPMRGGLPKQEPQWLKKWE
740   APA_07390   763290   763805   +   VSSRPFMLRPAGLGLLVLMLTLSADQLSKYWILYGLDLPARGSVKVL
741   APA_07400   763852   764382   +   MARRVSTLISPLLLLGGCFLLSGCSGNEAARAFGLERSLPDEYTVTTR
742   APA_07410   764400   766331   +                                 mutL
                                        MPGLFAEPGMDIHQPETPPHVRRLPEVIVNRIAAGEVIERPAAAVKEL
743   APA_07420   766450   767967   +   VQPILLSLITYLPLVAALVAFFAPGRPEQQDSTARWVGLWSSLITLGL
744   APA_07430   768918   767992   -                                 eamA
                                        MTAAPSSASAALPLRTRLLALSQLLVSMVCIQFGSSIAKSIFPVFGTSG
745   APA_07440   771027   768988   -   MSDLFSNTPPARKSSTGKTRDAKPGTQADSAQAYDASAIEVLEGLEP
746   APA_07450   771661   771134   -   MSFSRFLAAGVLAAGVLHSSASFAASECGHSPAHEAFNVQGLKSELM
747   APA_07460   772050   772577   +   VRLRGIAGLALTGGMLAGCATTGGPIHVGSPNPFGYLKKSAVCSTTP
748   APA_07470   773151   772702   -                                 badM
                                        MILRRDRAMTAVLIMLDVAFHAGRSGTVSAADIAERSELARRGIEPLL
749   APA_07480   773234   774292   +   MVYLRYKFVLYGSEICKTDMGELLMAASTQEKEDYGFAAPRGRVYE
750   APA_07490   775631   774396   -                                 ompA
                                        MCAFVLLDAMPDVSRDYCHSREKTMKPRQKLLAQTLLSAPLAAGLL
751   APA_07500   776102   775761   -   MTPPPRLKTDIMARAILRQSGQDGSSAMLLRKGDPDAGGILVVLAAR
752   APA_07510   777768   776113   -   MVLAVLLFCQPAPLHAQSKADTPPPESAPGSASTTQAAASASPAAEQ
753   APA_07520   779845   777815   -   MSASPYASALPSVQELRAFLEGRAGAATGLTDILRNFQLPMRQKAAI
754   APA_07530   782545   779852   -   MTDVVVVESPAKAKTINKYLGDGYTVLASFGHVRDLPPKDGSVLPD
755   APA_07540   783219   782575   -   VLARHFPRRNRLIAGLGLGCVVVEAAPHSGTLITARMVVDYGRELFA
756   APA_07550   783262   783855   +   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
757   APA_07560   785406   784021   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
758   APA_07570   785504   786181   +   MMIERSIEAGVPFRWVAADSVYGVGDVERTLRRAGIGYVLGVKGNH
759   APA_07580   786897   786271   -   MTSLPACLRLARTEQVGPRTWRKLVDKYGSAAEALEALPYLPVRGR
760   APA_07590   787569   786928   -   MEALPPYALKLVAAMAFMGYTLGSVPFGLLLTNLAGAGDLRKIGSG
761   APA_07600   788861   787569   -   MNTLLFENVRLIDPASGLDQPGRLLVRDGVIAGTDKAGTEGTPENAT
762   APA_07610   789799   788858   -   MASFPGRHTRHLLGLEGMTPDQIEPLLDLAESYALLNRSRKVPRDVL
763   APA_07620   791198   789792   -   MTTIRTRFAPSPTGLLHIGNARAALFNFLFARHHGGEFLLRIEDTDRER
764   APA_07630   791237   793435   +                                 comA
                                        MPRLMLHLHSLLVQEQRRLVLWAPVGLALGAVLYFGLLRTEPSLLEG
765   APA_07640   793785   793447   -                                 ahpD
                                        MTDWNAYRANMAQNVKTLASLTPNTLKGLQTLETPLPEKKHLDDK
766   APA_07650   793803   795152   +   MWSKPITTASDVALFVTTRLGEACTLAECAVEPLSGRIMTQTDMNGA
767   APA_07660   795221   798235   +   MAFRQKGHRGRSALWGGVKKKWSGLRWRTTQYLANGAYVPRGKE
768   APA_07670   798345   799586   +   MSVEIKVPTLGESVTTATVAKWLKQPGDAVQADEPIVELETDKVSVE
769   APA_07680   799667   801391   +   MPIEIKVPTLGESVTTATVGKWLKQPGEAVKVDEPVVELETDKVSVE
770   APA_07690   801457   802491   +   MFVPRHPTVWAMAGSLLLAPGGLAAAQTPAPDAASQTEESRPEKSS
771   APA_07700   803120   802635   -   MLRGIAWLAFKHSASCIVKVMLALAKGFLNMSIFGSILSAIFHHAKAA
772   APA_07710   804586   803297   -   MSDYKVKDLSLAEWGRKEISIAEGEMPGLMALREEYGQSKPLKGAR
773   APA_07720   804768   805478   +   MSVLRSVLFNVLAFLLTLLMGVGAFPIRWFAHGLALPYAKLWSRLV
774   APA_07730   805818   806900   +   MKKKLLSVAVGAGGCFLVLSGYWWASAQYLQKQADNMPSGCQAH
775   APA_07740   807631   806906   -   MPLDVQAIPVLSDNYAWFLRDTETGTTAVVDPGEATPVADFIEKEGG
776   APA_07750   807715   808488   +   MLDVMPPESSFYTTARGQCFLALVGERLRWFWPDLGQQHAVLGLGH
777   APA_07760   808513   810246   +   MVLSAGFHSRLGPGSIFTSFVLCSLLAIFAALGVFAVLPDRLLRGAAV
778   APA_07770   810243   811259   +   MKQDLTWGWAFGCVAALAIQAALMVLVAPWFAGWVHRLAGRLVG
779   APA_07780   811256   811846   +   MTLAAILMPLLALCVVARGMGFLPLLGLVAAAAMLVDGHTPLQQAG
780   APA_07790   811843   812976   +   MTGTAGAGMFLAALAFVWPFLGAAAVCAVPVARSRELAIWMSAIGC
781   APA_07800   812978   814474   +   MNAASHIWAGEETETPWRFRLQEMAWRDLVDALKHDDLPFVGLWC
782   APA_07810   814510   815007   +   MGLIRAVFDAAFRQDMRRMKPVGPRWPLLLFHVDTGGCGGCGMEL
783   APA_07820   815901   814996   -   VTQPSSSPSAPAQQTSETPRRRRRLRRRVRSKIRGPSFNRLIPNILTMLG
784   APA_07830   816603   815914   -   MSLLASLKLVVARPHREARPFLLASGATAALAYWAGRKLRCPVLRN
785   APA_07840   819331   816686   -   MLTTNEIRTAFLEYFASNGHQIVPSSSLVPKNDPTLLFTNAGMVQFKN
786   APA_07850   820007   819504   -   MSNASPSPSAATTKLIRLIKFGMVGSLGFLWDSGTVYALRPLIGLTAA
787   APA_07860   821234   820107   -                                  ompA
                                        MRLRTALLATTLMAAAPAAASATTITGPYVNVAGGYNLVQNQHAH
788   APA_07870   823312   821579   -   MSSRISSPHSETTDPPPIPLDLERVSRSHGSGIIPFGRSIVLVGLMGAGK
789   APA_07880   823375   823713   +   MNRTVLIVAAAVFAVVLGGFAALGLSAHPPVPQPVHRDLPLAAPATS
790   APA_07890   823717   824637   +                                  xerD
                                        MLSGGVDLFLEMLAAERAAAPNTLAAYEADLTSCAESLAREGQTLQ
791   APA_07900   824712   825668   +   MRQFLDFEKPVAELENKIDELRQMTDPNGVNIEEETARLSEKAEKHL
792   APA_07910   826480   825725   -   MRRTSALILIGNEILSGRTKDENIQFLALRLGELGIPLREIRVIPDIRETII
793   APA_07920   826638   828263   +   MSESRSAPVSDLPRAWPFEEARKLADHVGVRSTANGEDDARPALLE
794   APA_07930   828284   830371   +   MTQTPPPPAPPSSLPGGGGWKKWLKHLPHILGLLLMVAAIVVVQHEL
795   APA_07940   830429   831166   +   MSAHFPAMLLTATAFTSSISSFLLAFPALFSIVNPFGAALIFAQATAGR
796   APA_07950   832002   831181   -   MNYRHAYHAGNFADCMKHALLVTLLQSFLRKPAPFMVLDTHAGIGR
797   APA_07960   833105   831999   -   MNETAQNRRPDGPILAIESSCDETACAILVPNGTVLAQRVISQDGHAD
798   APA_07970   833251   834324   +   MDSAYPSSSAPSPALQELAAEAAARQKKASGHSGRRTLPLRVGTRGS
799   APA_07980   834334   835062   +   MHPRGVIVTRPEPGLSETMAAVADTGWLPLASPALVVQRHTLRLPQ
800   APA_07990   835622   835125   -                                  secB
                                        MSETEQSAPPALPLAVNLQYTRDLSFEVPVGAEIFATLRSQPQIGVNID
801   APA_08000   836380   837108   +                                  tim44
                                        MCCGRTGARFLVDVRQMDFSLGHFPVDLVLLALVAAFLVLRLRSVL
802   APA_08010   836381   835749   -   MKQNRRIACYLSHSHAHGGIQSPTLLLKGHYASYLAGIMIILRHCESE
803   APA_08020   837105   837962   +   VKAAKGNGASRANTTSTKAPRARRYKIGQQEIVMGDCLRALKRVPA
804   APA_08030   838097   839524   +   LKRLIVSAVGAALLAYGGTVAYLQHFDHITAPELPASSPTLKDPVALA
805   APA_08040   839660   840292   +                                  mutS2
                                        VNRRRRHLQEGEKALWALVVRDVAPLHVAELVPPAAQNEPEPQAIP
806   APA_08050   841486   840272   -   VILASYALNMGRKQKEDLPRLPHADKPRLFVMPERQLSRRVFLNTLL
807   APA_08060   842411   841497   -   MTPTDTADVSAHQALREPARQWFESLRDKICAAFEAIEDDAVKQNSP
808   APA_08070   842551   843774   +   MYPISGVRGEKGKMAATPARHTEQAEKEAHSFLQQAGAYARHYGR
809   APA_08080   843771   844562   +   MIVQKIRPTFWLRGGGMLLLSAMVLGPDITQPAQAQPVKAPEQNWS
810   APA_08090   844549   845433   +   MSENETVEPVIGLIGGSGLYDIDGLEEKEWRTVETPWGLPSDQLLFGR
811   APA_08100   845476   846057   +   MPWVFRVLAKPALKTERIRYMVKSARTSAPLLIMCLLVGGVHAAQA
812   APA_08110   846200   846835   +                                  lysE
                                        MPHVFLPVLAFAAAWGVLVLTPGTETALIIRLSISVGRTTAIGAVLGIA
813   APA_08120   847199   846846   -   MCTEERRYILIWASGAFLMALSLPVTLMVIIKDAMLRANIPVHDPHSI
814   APA_08130   848092   847442   -   VTLLETLTHRHTTKAYDKTRKIPADIFAQLQEALRYSPSSVNSQPWHF
815   APA_08140   849108   848209   -   MQYYGAPETQALLPFPALVNMLARTVRDYANGGITCPPRTVVPTQD
816   APA_08150   850687   849269   -   MERTMPDVTSANLRRILDHQRATFLRAGPPSLKQRRADLRRLKAEIL
817   APA_08160   850776   851402   +                                  tetR
                                        MSETTNRPYHHGDLRHALIDIALAMLAADQNWAFTLREVARRTGVS
818   APA_08170   851666   851929   +   MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
819   APA_08180   851926   852753   +   MKRPAQRRELAAQAVAHHGVSIALACRILGISETCFRYRPRLAAEND
820   APA_08190   855087   853702   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
821   APA_08200   856133   855699   -   MIRALLSLICAICIGGTAHADAKPESLEELTYNLNTVLNEELDGKAFLN
822   APA_08210   856870   856529   -   MFPRIKNLGGGPFGEDADIFGDTLREVVQDAPQTHDLPFKQQTVNEL
823   APA_08220   857597   856884   -   VHGTPPRHRKPGPNVAVHAAALKAHAPPAVANLAGAAADALIPGGL
824   APA_08230   858562   859128   +   MLIGYARTSTTEQIAGLEAQERELKAAGCSKVYSEQISGTKRDRPQLA
825   APA_08240   859327   859779   +   MINFDKAPKDTAMALSQNFPRSYAVDSVDWEAVGLALGALAIRQAR
826   APA_08250   861506   859950   -   MRTQRRRIMTKTTESNTDTKGSSIIPFDMLPYISLSRQPNTKQSKELVS
827   APA_08260   863570   861966   -   MTKKAPRDMHGLKLTGGKTYSARLNIPKDRWQDVGRVYRTKSGIK
828   APA_08270   863719   865023   +   MCIFSKVLIHLESTVVHGRSSQFQLLRGVTRGVKSMSRLPPNQLSALK
829   APA_08280   865263   865517   +                                  hicA
                                        MKAKHRRTLELIFKRPVSGNVPWADIEALFISLGAEVSEREGSRIGVF
830   APA_08290   865514   865846   +                                  hicB
                                        MNNVMEIGGHRAVIQFDPEIGMFRGEFLGLNGGADFYADSVAGLQQ
831   APA_08300   866193   865888   -   MAGRKTGTPKTGGRQKGTPNKATREIKEIAQAYTDTAIATLAFIAEN
832   APA_08310   866940   867395   +                                  ruvA
                                        VPTNFVCTKHCRKQPFPCTACPFRTILSGMKSAASDCPVYRLTIPGLL
833   APA_08320   868300   868614   +   MKEVEEKNFKYSEFQDYFSLKKRISRHYEIGEEIEKIKDVANSLKHGN
834   APA_08330   868977   871109   +   MAANVIDQLVVMFAIDGRKATSGAKEVEKAIDGLTDAATSGAEASE
835   APA_08340   872716   871853   -   MNSITRHLTPQTIYAQIRMERQTHRGVFFLMEGSQDFRRFDKFLERTL
836   APA_08350   874122   872713   -   MFVNDSSPSLRLTHFSVQGLFGEFNHSIPLCKDEHITALIGPNGMGKT
837   APA_08360   874736   875854   +   MLSYRPFQIQQDFEDDVATFPQLTVSKTEIRRIGRELQSKLPDDASMM
838   APA_08370   876164   876523   +   MAQEILIGVERRRRWSDERKLAILAEVGVDGASVSDVARRHDLTRQH
839   APA_08380   876520   876867   +   MIGVGNGVRVYLACGVTDMRKGISGLAALAQDVLRQNPTSGALFAF
840   APA_08390   876931   878541   +   MTHAPAVLPDDPDILREMIVSLQTEVARLSASARAYEALVQSLKIRIA
841   APA_08400   879626   878799   -   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
842   APA_08410   879886   879623   -   MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
843   APA_08420   880649   880014   -                                 xre
                                        MMAIVNGTKISVSAAQVKAARALIGLSQDDLAALSGIPKRTIVRFELE
844   APA_08430   880930   881178   +   MSKMPTDIILIDQAACLDEIQNAMLMMMRELYERMDEQGDPAPTHA
845   APA_08440   881175   881411   +   MSNPIPAMTEAEHDHLANYRNPRLLLDKAEKIAQALHDLSQPENEVV
846   APA_08450   881411   882010   +   MPQYSSAKDIPDNLKNPADSIAWGHVRGLFVQELGDEKEGWVFWPC
847   APA_08460   882128   882319   +   MAKTISLSVQRVQEYGASYLLFALQDDGRMFCKMVSALCEADDAYV
848   APA_08470   882316   882582   +   MSNQMSLTGFEQETVKNMRIQSCILHDARMMAALIVEVTAGWSCDE
849   APA_08480   882579   882848   +   MTPDEAYAVLGVCDPIKHSRTWAENIWGVDGLPLSVAQRLIRQEAG
850   APA_08490   882845   883105   +   MTTPIQAATVAAINSDRRSWKAHNFKEGETESRRFVRACRAVANTQ
851   APA_08500   883102   883353   +   MSQKQTSASQRCKSPVATPDRLSVIQDATSELSCIGICLQAMSNGMLT
852   APA_08510   884504   884752   +   MTEEKHDLVHLADALLELNQARLEKDAAAACYAQSTAYGFAAAGR
853   APA_08520   885077   885460   +   MTSGVSLGHIIMADKMPSSSESVHLSRRIDFQTVNRAAMGILPALLGR
854   APA_08530   885457   888018   +   MSDSQHIPAMAFIDKNSLFKPLTDQERQAAGRLAADIHGAEIWEPMT
855   APA_08540   888173   888664   +   MVSQALRDLFARDSDPFHVSFLIKEIESLGVHIVLANGQPVIRGDRSII
857   APA_08560   889198   890016   +   VSRHQTVKRHTPRSLAALDAPIVSLTAYTAPMARLLDAHCDLLLVGD
858   APA_08570   891167   890076   -   MPTLFDTYTLKDITLRNRIVVGPMCQYTAQEGVPNDWHSVHYPTLA
859   APA_08580   891264   891596   +                                 arsR
                                        MKQYDHPAPEEFQLAGILHALADPFRLSVVQNLMQKQPQACAPLQD
860   APA_08590   892595   891612   -   MFAMRLHQPKTPLQWEEVPDPVPGPGEIRVKVLACGVCRTDLHVVD
861   APA_08600   893442   892708   -                                 hap
                                        MVAFAAAMQATFTGHAALAEGPAYRTHLAGVGLHDPRQRVDATQP
862   APA_08610   894445   893459   -   MARFLVTGGAGYVGSHVVLALLDDGHDVVVLDNLRTGHRAAVPDQ
863   APA_08620   897335   894534   -   MNQGGLHQSLTASTAEDGALAERLATARRHAAIVLRIERLWPALQPA
864   APA_08630   898675   897332   -   MAETPVYTDADPTLAELLQTHPQLTVDPTCGLMLEGVALNAIADSV
865   APA_08640   898930   898787   -   MNYRLIFGLALATILFLPLAACGKKGTPHQPGPQNQITYPRMYPPNE
866   APA_08650   900383   898935   -   MSLNSQNSTETENQKNANVQWGGRFAGGPSEIMQAINASIGFDKVM
867   APA_08660   900586   900392   -   MPPGTALSRTAAHRTAPPQDRPCHALCQNRHLRPRACNITVASLHPR
868   APA_08670   900623   900943   +   MNMTTPHKLTTFAVIDPGPNVLLEVIRAESPVVAVERLEGKMRGPEY
869   APA_08680   901045   901824   +   MSVDQVLMAESFVVHGRDEGGPFVLVSDHAGRAIPPELGDLGLSAQ
870   APA_08690   901821   902687   +   MIATDTAKPQIITGKAKLAGVLGWPVAHSRSPVLHNYWLRRHGVDG
871   APA_08700   902704   903291   +   MKILGLTGGMGMGKSTVATLLQRAGLPVFDADAEVRRLQADHGAA
872   APA_08710   903288   903962   +   MKRSILFDTETTGLDPATGDRVIEIAALELVGDLPTGRNFHTLIDPERD
873   APA_08720   904122   904640   +   MNSGSPLMRSASRHFAAALALCGAWFMPAGAETMLGPVTATVTFN
874   APA_08730   905775   904666   -   VKILEITNVDFSLTHFLLPLMRELRAEGHEVIGVCADGPLLQQPRSEG
875   APA_08740   907572   905785   -   MPLRRWTRGARLAYAMRNPLGGFARVPAAPAVALRDLWSGNAAGG
876   APA_08750   908350   907673   -   MRPVSYPLIAPSVLAADFTRLGEEVSALKQAGADWVHLDVMDGHFV
877   APA_08760   909746   908424   -                                 nol1
                                        MNTPARAPRSPKRGKGRPAPPQPDPTRDIAFDILCGVVEHRRMLENS
878   APA_08770   910415   909792   -   MSVEKTPIAILISGRGSNATALIRACEDPSFPARICLVLSNNPDALGLEM
879   APA_08780   911494   910412   -   MTSSPSTPSSGLTYRDSGVDIEAGEALVDAIRPAAKATDRPGTMGGL
880   APA_08790   911606   912373   +                                 dnaA
                                        MTRIDETKSPLNAPSGGQKRQNEANEAEQIALPFAHRPRFGRSDFVAA
881   APA_08800   912535   914820   +   VTAQDKKEQAPVKARSPARKAAPRKPSTRQPRQSRKTAERKITLEMP
882   APA_08810   914918   916408   +   MEADQPCRSAVVDLGSNSVRLVVFEGRSRNPLPIFNEKAVLRLGRGL
883   APA_08820   916579   918897   +   VASEEIIDPTVQHDASVRRVLLHLVLPFVVTVMAVLAIALVGINSYRT
884   APA_08830   918894   919793   +   MSGSQQTGGPNTTPSDDEPDLILQTDAHKPAKRIPVHEWIRRKLAWI
885   APA_08840   919795   920496   +   METYSAGPLLELNKAVPSFEDSGLPPVPFNMKLMPGECMIVEARDPS
886   APA_08850   920496   921446   +   MFQLRLRQKVKPLISLRYADEWVGFLVLLSLVIFAGAVIEAGVLRDW
887   APA_08860   921443   922381   +   MRYFSPAAAVLCLPLLLAGCGGAAQDKPTAQDDAAWDQAMTAGRD
888   APA_08870   922410   923786   +   MQRNLIIARCGAHSLHPEWLKGGEPEWDLVLCPFQPVDMQGLPGQM
889   APA_08880   923909   924943   +   VRGAVIMKRLLRRYRKKSQLDKEIRHTPLEDVGGSSTAQKKKEGGR
890   APA_08890   927151   924947   -   VVSFSFPLQWYRGLHAKIHSGSSFPLAWLIAPAPADLGFALRTTVAAF
891   APA_08900   929449   927263   -   VPSLPMFILDRIGPLRNFRPLHRPGERGKLPFAWLISPTPAAIGFAVRT
892   APA_08910   929691   930065   +   MSDFLQNILGKVESALGVDVQGALQQQLQSLLQPQNLEALLTRADQ
893   APA_08920   930139   930666   +   MDLGERIKRMDSWLLDEVCQPLADKLPERLTAFEVGMSCQLGSLLL
894   APA_08930   931425   930694   -                                  cycH
                                        MIWLSIALLSLLALAPACATLWKRTRTVRDERSAALALHEAQLAEVD
895   APA_08940   931913   931422   -                                  cycL
                                        MNMRRFLAASCVGFSLIAAPALVLAVDDPMEMLPNPKDEARAEAIG
896   APA_08950   932491   931910   -                                  dsbE
                                        MSNSETPPNASRRRLLMALPLAGAGVVGVAFWKMLSGMEHGSFNPH
897   APA_08960   934473   932488   -                                  cysK
                                        MLSPELGHYALALACVLAAIQGILPLMGARRRDVRLMALAPGLAIGQ
898   APA_08970   935041   934511   -                                  cycJ
                                        MTRKTRRLWLVIACVACLGTAAALILRAFSSDIVFFVTPSQVMASPPP
899   APA_08980   935199   935038   -   MTHLPYIAASYGLFAIMALVFSVGAALRLKRDRIRLATLEQKAPRKA
900   APA_08990   935969   935196   -                                  ccmC
                                        LSASPTFVARTGNFFHRYANPGQFLKLGARLQPWLTWPAILLTLTGL
901   APA_09000   936140   936433   +   MLFAITCTDRPGALELRKATRAQHLAFLEAHKDGILFAGPQLDANGN
902   APA_09010   936436   936855   +   MAYWLVKSEPDAFSWDEQVANGVEPWTGVRNHQAKKNLAAMKAG
903   APA_09020   937299   936964   -   MQYHSVSPDFAVSPQITVEDIPLIRDAGFKTIICNRPDGEEAGQPSAET
904   APA_09030   938093   937416   -   MTDPSPIQRSVRRFLRLAPLAAVVATAACATPQEQTYETRLAEARTA
905   APA_09040   938320   939177   +   MQQAGEARMSTQKTAGNALAPMLLDGHELAELEQALADVESGRGV
906   APA_09050   939424   939248   -   MNMRLSCLIGIAVCFAVTFWAPHYHLAAKVIGITLLGFAILTTFLEGE
907   APA_09060   940414   939440   -   VSTEAPRLIRSIRLLDAAEDRIKAEFTAPPPPERSLKTPALLELAKEFQP
908   APA_09070   940592   941233   +   MTQELTPQIMLGAYAAGLFPMASDATDTTLRWYDPDPRGILPLDGFH
909   APA_09080   941327   942139   +   MTGMDDIMSTRLYGRMRFFCLMGVLGAAVPVVGTVCSGQAQAQVA
910   APA_09090   942141   942770   +   MVAKRLLAGVGFVLVAAVASGTVAHAQIQPQTPEPTQISPADAPVVT
911   APA_09100   942818   943369   +   MKIHPSIALFYLFLAGVSLPVFAQADDGSSGTVSVCLRADIAQPPQAM
912   APA_09110   946638   943399   -   MRPRRTKTRRFLVYGAYAMVGLPLVGTALLFARMALGPINVTPLVR
913   APA_09120   946701   949778   +   MTQADHSLFRDVRQPRGHGSRMWPDADWPAPADKRAAELFTQDM
914   APA_09130   949859   950347   +   MTEKHTLEVGDAAPAFDMEASGGRKVALADFKGKPFVLYFYPKAD
915   APA_09140   950787   950386   -   MRQITKLLMALPVITGLGLASVPAAQAQPGPHMMGGPGWAGGPRG
916   APA_09150   952272   950989   -   VNTAQRIRGIVAGSAGNLLEYFDWYVYSSFTIYFAHAFFPHGNPTVEL
917   APA_09160   952421   952338   -   MTIDHRQWYDLPLRLPCVQNMHCMAGH
918   APA_09170   952508   953776   +                                  rmuC
                                        MSSIIVLLSIAVCALLLGAGLTILLRPKSGGTDADLLARLYVLVEREAA
919   APA_09180   953780   954511   +                                  kdpE
                                        MNGTADMSKEDTDFFSPNGKTVLLVEDDGTIAEEIAAELTARGFKVL
920   APA_09190   954498   955892   +   VFLTELFRTATFRITLMALAAMAGVMVMQFGLVYAQLEAVESRRST
921   APA_09200   955990   959163   +   MNEIVVTALKKPYTFVVLSILILVFGIRGIFNTPTDVFPSIRIPVVAVVW
922   APA_09210   959160   960512   +                                  acrB
                                        MTQEHPDASGPQSPTPAGSTRKRKIGFVAVGGVAILLAVVGIVQRHT
923   APA_09220   960509   962119   +   MRKGNILPRNVAHILLVGVATSALAGCDMAPRYKPAQFVLPDNWSG
924   APA_09230   962224   962658   +   MAKKVVGYIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAKTQ
925   APA_09240   962665   963357   +   MAKNKRLAAARAKVEAGKAYGVDEAVALVKSNATAKFDETVEIAL
926   APA_09250   963637   964155   +   LNRTEKKAFIASLAAVFAQTSMVVVTRNDGLTVAAVTELRRKVRAA
927   APA_09260   964256   964630   +   MADLAKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAAPG
928   APA_09270   964830   969023   +                                  rpoB
                                        MGGAGATMNAITKSFTGRKRIRKSFGRIPEIAPMPNLIDVQRASYETF
929   APA_09280   969117   973292   +                                  rpoC
                                        MNELMKILGQTGQAMTFDQIKIQLASPEQIRSWSYGEIKKPETINYRT
930   APA_09290   973632   974003   +   MPTINQLIAKGRKPAVKRNKVPALQGCPQKRGVCTRVYTTTPKKPN
931   APA_09300   974018   974494   +   MSRRHRAVKREILPDPKFGDIVVTRFMNALMYDGKKSAAERIVYGA
932   APA_09310   974585   975775   +   MAKAKFERNKPHCNIGTIGHVDHGKTSLTAAITKTLAKKGGAEFKAY
933   APA_09315   975884   976192   +   MDNQNIRIRLKAYDHRVLDNSTKEIVNTAKRTGARVRGPIPLPTHIER
934   APA_09320   976203   976886   +   MRTGLIAKKLGMSRLFKEDGTHVPVTVLHVDDVQVVDVRNQERDG
935   APA_09330   976891   977505   +   MEIEIKTLDNSSAGSATLPDEIFAVAPRADIMARVVHWQLAKRRAGT
936   APA_09340   977502   977837   +   MTNILAIRKKAERLSREAMYDIVRTPVITEKATALSEKNQVVFKVAM
937   APA_09350   977854   978684   +   MALKHFNPVTPSLRGTVLVDRADLWKGKPVKQLTEGKNKTGGRNN
938   APA_09355   978698   978976   +   MARSVWKGPFVDGYLLNKAEVSRASGRNEVIKIWSRRSTILPQFVGL
939   APA_09360   978983   979393   +   MSKPKHPRTLAETEAQAVTRNIRVSPRKLNLVAGLIRNKPASQAVAT
940   APA_09370   979397   980074   +   MGHKVNPIGLRLGINRTWDSRWYADSDYSKLLHEDLKLRAFLRRKL
941   APA_09380   980093   980509   +   MLSPKRTKFRKAHKGRIHGLAKSGTTLNFGTFGLKALQPERITARQIE
942   APA_09390   980511   980747   +   MVKATKPADLRAKTPDELEARLVELKREQLNLRFQQATGQTEAQSR
943   APA_09400   980761   981030   +   MPRRVLTGRVTSDKMDKTITVLVDRRVMHPLYKKFIRRSKKYAAHD
944   APA_09410   981049   981417   +   MIHPETNLDVADNSGARQVQCIKVLGGSKRKSASVGDVIVVSVKEAI
945   APA_09420   981417   981737   +   MAARIKKGDTVVVISGSSKGTQGEVLEVRPSENRAVVRGVALIKRHQ
946   APA_09430   981748   982317   +   MSAKQEGRSLPRFQQRYESELRANLRKQFGYKNEMQVPHLEKIVLN
 947   APA_09440    982397    982702   +   MAKTSAILRNAKRARMAARDKEKRVALKNIVMDRSLPVEDRFDASL
 948   APA_09450    982712    983110   +   MSLSDPLGDMLTRIRNAQRARHNACVAPASKLRVSVLEALQREGYIR
 949   APA_09460    983121    983654   +   MSRVGKYPVEVPAGVTIAIADGVLKAKGKLGELALPLSSHVSVDVQD
 950   APA_09470    983654    984016   +   MSTQQELRNRRRARLRFQLRRKAGGRPRLSVFRSGKNIYAQVIDDAQ
 951   APA_09480    984032    984607   +   MAREPREGGRGGREREREGDELVDKLVTINRVAKVVKGGRRFAFAA
 952   APA_09490    984600    984785   +   MSDKKTFKVVQIASGNGRKPGQQATLIGLGLNKIGRERVLEDTPSVR
 953   APA_09500    984787    985275   +   MKLNELRDNEGSRYRKKRLGRGIGSGKGKTSGRGVKGQKAREGVSL
 954   APA_09510    985411    986769   +                                  secY
                                           MASAAEQLAANFNVGSFAKATELKKRIWFTLGALIVYRLGTYIPVPG
 955   APA_09520    986766    987434   +   MNIIFLGPPGAGKGTQSKLLEERYGLIQISTGDMLRAEVAKGSETGKQ
 956   APA_09530    987548    987925   +   VARIAGVNVPTNKRVVIGLQYIYGIGATKAVEICKALEIPEAKRVNEL
 957   APA_09540    987992    988384   +   MAKAATPRIRKKERKNIISGVAHVLSTFNNTMITISDAQGNAISWSSA
 958   APA_09550    988494    989513   +                                  rpoA
                                           LVLQKNWQSLIKPEKLEVESGVEPARIATVVAEPLERGFGMTLGNAL
 960   APA_09560    989548    989973   +   MRHGIAGRKLGVTSSHRAAMFRNMAVALIKHEQITTTLPKAKELRPV
 961   APA_09570    990149    991210   +   MNGANKHGGIMRRVFLRIMLVISLLFVGLTQQARAGTPVRIGYIPVLG
 962   APA_09580    991207    991971   +   VRDKVSFSTKWALGLIGLIVFFGGWEAAVRTGLLPSGMVPAPSSLGP
 963   APA_09590    991959    992777   +   VATMSEKHSVASLDNVGLSHDGGANFVLRNVSLTLEQGEFVALLGP
 964   APA_09600    992861    993094   +   MSDDNTKDYALEEGIGRVQDGAEGLFSQLPSYDEMNPGKRCAATEA
 965   APA_09610    993159    993335   +   MLKLALFFLVISLIAGLFGFGGISTAAAGMAKILFFIAIILFVVFLVVAL
 966   APA_09620    994986    993421   -   MVSPSFSSMMLKHKKLSRRAASLMAPLVLMGCMVGPNYKRPSATIS
 967   APA_09630    998294    994986   -   MSISRLFIDRPVATILLTVAMLLGGILGYRTLPVSDLPNVDFPVIMVQA
 968   APA_09640   1001482    998291   -   VNPSALFIRRPVATTLLMLAIFMAGLLGYHFLPVSALPQVDYPTITVE
 969   APA_09650   1002714   1001479   -                                  acrB
                                           MDEHQPASPASPSSPSPRPPRKKRMLLAGIALAGACVLAFAFLRPHGD
 970   APA_09660   1004284   1002890   -   MPRPTKAQFTALIVASMMFMEQLDGTILATALPSIANSLHVDTVATS
 971   APA_09670   1004397   1004702   +   MAEDKIKNVESKVEGAATDAKGHVKDAVGGLTGNIGMQAEGKFDQ
 972   APA_09680   1004813   1005460   +   MERGAMPDFTREQQLGGRVAGVDEVGRGPLAGPVVAAAVVFGAGV
 973   APA_09690   1005457   1006560   +   MSGAKSASMELPLDQILRGECVETMRSLPSGSVDCVFADPPYNLQLR
 974   APA_09700   1007290   1006622   -   VRSLHFHTIMRCDSMTHTCNDGQTMTRFCRLASSAMLMGSFACFAT
 975   APA_09710   1009458   1007314   -   MMSSLMQSIGFAPLLPLWLLALLSVAGVLLCAWSLYNGARGALLRL
 976   APA_09720   1012250   1009455   -   MIFLAPLALLGLLTLPLVWWLVRATPPRPRQQVFPPVKLLASLKPRQ
 977   APA_09730   1013233   1012247   -   LRGPSFLTAAFRRNKAGTTTRAPHFATQADESVAIGQPSALTQQAQA
 978   APA_09740   1014276   1013239   -                                  moxR
                                           VLHTGTMTASDASQPAQQPSSPPEVREADRICERLQAVQQETSRIVFG
 979   APA_09750   1014359   1014964   +   VKGEHAVSGDSLACSGHQESPERKRHDLGYLPFLVRRDGVWLYRGT
 980   APA_09760   1014961   1016154   +   MTRNLLDRLEPTRLHALEQIWAVLPEARLVGGAVRDLMVGRSIADID
 981   APA_09770   1016212   1018005   +   MTSQASASSTRSSRSSRDLLPDDTRVLLRRLWRGQVRRYPGNLTAVV
 982   APA_09780   1018178   1019383   +   MRRAFEMAGNSMTDDHNDQSSANTGAPAKPEEKKKENPRRKIILTG
 983   APA_09790   1019380   1020957   +                                  emrB
                                           MSTQAEVAPGGWKPKHNPWTVAFVVTMAAFMEILDTTIVNVSLPHI
 984   APA_09800   1021545   1021033   -   MTDAGSPSLPYRPNVGAMIFHADGRIFIARRTDMPGAGGPLSEGTWQ
 985   APA_09810   1022633   1021542   -   MHTPSLWQQLPSNGRAFIRFWGGCATAAVALAIGLQVMGPPGLSIEG
 986   APA_09820   1024099   1022654   -   MKFRTGLMFGATALTGLALAFHPGHFSGSALVASPAQAATAPDATP
 987   APA_09830   1025744   1024278   -   MKRIRPFSSPVCPSSHWGKLAGYTALLVAAPALLAGYPAMPLQAATT
 988   APA_09840   1027283   1025745   -   MTSTSHPQKRPVMLVILDGFGWREDQSDNAVKIARTPNFDKLWQNS
 989   APA_09850   1028639   1027443   -   MITFEDVTAAADRIRGNVIRTPTIASHALSKATGADITLKLENLQAVG
 990   APA_09860   1029114   1028641   -                                  greA
                                           LQKTPMTGKGLLQLEDELRKLKSEERPAVIRAIAEARSHGDLSENAEY
 991   APA_09870   1032520   1029266   -   MPKRTDIRSILIIGAGPIVIGQACEFDYSGAQACKALREEGYRVILVNS
 992   APA_09880   1033937   1032537   -   MPLSIDTIIARIGGPDATAKLTGVGTEAIRKWRQAQAIPPRHWPVIAQ
 993   APA_09890   1034173   1034628   +                                  gatB
                                           MTLRERLIADLKTAMKAGESARVATIRMITAKLKDVEIAGRAKGQEG
 994   APA_09900   1034724   1036565   +   MAIDSAFLDELRARTPIASVVGRRVKLARSGRNWKGCCPFHGEKTPS
 995   APA_09910   1036684   1038702   +                                  rpoD
                                           MRAGRSRSGMATKTASTNAAQEQDGDTTLLDTRSSAVKKLIAKGRE
 996   APA_09920   1038692   1039273   +   MITDLNFNAESTTRMKVVVTFMRMFSPPQHAPLALPEGWHVQEHLR
 997   APA_09930   1039440   1039901   +   MPLYETVLIARNDISQQQVDAILDGIAAQIEADGGAVRKREYWGLRS
 998   APA_09940   1039908   1040183   +   MSDTMEVNPAARRPAVGARRPFYRRRKSCPFSGPNAPKIDYKDVRLL
 999   APA_09950   1040195   1040800   +   MAATEVILLQRVEHLGQMGDVVKVRPGFARNYLLPQGKAIRANDDN
1000   APA_09960   1040901   1042112   +   MKQVLDRILQHFIADGQLQVRWPDGSTSLYKGHNPGPSAGVVLHNQ
1001   APA_09970   1042762   1042118   -   LLNGPAESVTAVELDSRAVLVIQELAGFYPNRLKVVEADALKCDLTE
1002   APA_09980   1044317   1042953   -                                  surA
                                           MRLRSLALACCSLAALTVPAIAGAPYAQAATRHTSSAATQQTATPAQ
1003   APA_09990   1046726   1044399   -   VARRPFRSPLLRRRSTLSAATALGSMAACLLFSLPKHAHAQFRPQVM
1004   APA_10000   1047845   1046733   -                                  yjgPQ
                                           MIVAVTLSRYIARQFVFSVVAMIASLTGIVCLFDFIDLLRRVATKPDV
1005   APA_10010   1049067   1047862   -                                  yjgPQ
                                           MHDKAVASRTGEVDNRRMTVRSLQSWLKSRFLTLDRYVFHQLLVA
1006   APA_10020   1050834   1049179   -   MASGKKALVATVMAASVAGSPAMLPKAALADDYSDLLDVLRAKGS
1007   APA_10030   1051420   1053270   +   VSAEKEKHSQALPQGAQQQAVSAQPVITVPDEELPHYAGRPVAFLLR
1008   APA_10040   1053270   1053989   +                                  gntR
                                           MITTQTPQAWTNLRPEGRGEARGALAAYAYQQIRDRLIYCHYQGGE
1009   APA_10050   1054414   1054088   -                                  minE
                                           MTFLSNLFKRRSSAPVARDRLQILLAHERISVGDGKDDLLAQLHREIM
1010   APA_10060   1055226   1054411   -                                  minD
                                           MAKVLVVTSGKGGVGKTTTSAALGAALAKTGQKVVLVDFDVGLRN
1011   APA_10070   1056065   1055367   -                                  minC
                                           LSGTHPPLPRIRMSGRSFLALTLTPEAPLEDWLVALDHQITRSVGFFA
1012   APA_10080   1056199   1056918   +   MLFSLWRWGRQWHKSSGMRTLFHFPLSPASRTVRLVLAEKRLPFEA
1013   APA_10090   1056923   1058137   +   LKHQTAWHVPDVLVIGGGAAGLMAAITAGQRGCSVVVVEHGPEVG
1014   APA_10100   1059096   1060484   +   MTRACSLLSGLASQGLAGKQTWRKAGLAALGITGMALAGCADQSPS
1015   APA_10110   1059108   1058140   -   MHASSSRSSSTNNRPDEHRDRTSPLHSEGKPPSHAPSSPGLTLVATPIG
1016   APA_10120   1062172   1060568   -   MNTPAASAPSLPDQLTLRRARAEIIMGHFNEMRAVLEPFSTSENDLAK
1017   APA_10130   1062901   1062311   -                                  carD
                                           MNTFRAPPKGGVTDAMARTAAAATAAQAKTKVKDEDPFEEGDAIV
1018   APA_10140   1063842   1062967   -   MIVDQRVGLRIIGKEILGVILLMAGWDLIVVVLFQVFHQEWMEQPSL
1019   APA_10150   1063988   1064854   +   MTTQQTGLKLREEHLCHGGKIQFYEHFSHTLALAARFGVFLPPAVCA
1020   APA_10160   1065445   1064861   -   MLFIRLSFRLILLACFAFAGGFGWFVNDALRPPGYLPHADGIVALTGG
1021   APA_10170   1066437   1065490   -                                  ftsX
                                           MMMPFSGRKDGLSVSEALPDRSLFTLVAMMSFLAALTLAGATGARA
1022   APA_10180   1067216   1066434   -                                  ftsE
                                           MLCLSIDTPPASRLHCIHATIAPLYATSVLYGSSMIRLENVSWRRGKK
1023   APA_10190   1067338   1068456   +   VQQAQGGRQPCIKRVFMKIVCPSCGVAYQVPEALLAKRQMLKCSAC
1024   APA_10200   1068906   1068511   -   MDPRMPLSSQSSAASRSGASGFALVRTAIWSVCYFAFYFVQQIAELFA
1025   APA_10210   1069143   1070993   +   MSADFMPVAGKIMDFLSCSILFAGVDAAWQAHLETLLQARGLRVKS
1029   APA_10220   1070977   1072977   +   VITLPDLKQRPIVLVVDDEPEILVALTDLLEGAYHVLSASSGEQGLAL
1030   APA_10230   1073024   1073623   +                                  hslV
                                           MHTFHTASSSHDPVGWHGTTILCVRRGAEVAMAGDGQVTLGSTVV
1031   APA_10240   1073623   1074936   +                                  hslU
                                           MDAPNFSPREIVSELDRFIVGQQDAKRAVAIAMRNRWRRAQLSEGM
1032   APA_10250   1074936   1075379   +                                  sufE
                                           MEAPFVTPQEDTAEEAIEAIRDELEIFDDWMERYQYIIEMGRKLPPFP
1033   APA_10260   1077833   1075506   -   MGKLERIAARQDRAAGRGPTRRGFLLTAMGSAFMFGFARQGNAAQV
1034   APA_10270   1078302   1077826   -   MIKFKLNGRDVSVDVPEDTPLLWALRDDLDQTGTKFGCGVGQCGAC
1035   APA_10280   1079651   1078323   -   VIKRLLAGVAAAGVLGGLGFLYYAWYPPIAPIERPNPASFSAEQIERG
1036   APA_10290   1081523   1080051   -   MIPLSNATLHQLPVQVTTPRYDRQKTTAGIAHLGVGNFHRAHQAMY
1037   APA_10300   1081745   1081945   +   MPKMKTKSSVKKRFKITATGKVLSGPCGKRHGLIKRTQKMKRSARG
1038   APA_10310   1081960   1082319   +   MARVKRGVTTLARHKKVLELAKGYRGRSSTNYRIALERVEKALRYA
1039   APA_10320   1082484   1083554   +   MSNDLEILRQEVLSELAGATDLKAWDAVRVSTLGKSGRLTALLKAL
1040   APA_10330   1083558   1086017   +   MKFTLSWLYDHLDTQATLEEICAKLNQIGLEVESVENRGAAIEPFLTA
1041   APA_10340   1086038   1087084   +   MKEKRIMVGRAKMMSWKKTVALSALLCGLAGAVLPQAQAEQITGA
1042   APA_10350   1088886   1087183   -   MLASKSGKLFRSACFCVLLTAGTTEAGMAANVSDAPSPPHMGGTLR
1043   APA_10360   1089401   1089009   -   MPCPSHIAHGIGLIIHAFSCHYVNAPGLHATYQRLPALFLANRPKQRY
1044   APA_10370   1089516   1092116   +   MAVTGLAAVLLVIALLLVVVSTVQPIARKLELSETVLLAIVGIIIGSLA
1045   APA_10380   1092748   1092197   -   MPFAKKWGLFVALGLALIVLGFIACIDAVSVTLASTIFIGALLIVAGIM
1046   APA_10390   1093021   1093638   +   MSKRLESKYKINRRLGVNLWGRAKSPVNRREYGPGQHGQRRKGKPS
1047   APA_10400   1093738   1095285   +   MSDTASAPLSSDITRRRTFAIISHPDAGKTTLTERILRAGGAIQMAGNV
1048   APA_10410   1096041   1095304   -   MTRSFGGPWPALPLSASFRIDVETPPPAAPEDVEQEITHLWQQACATT
1049   APA_10420   1097170   1096139   -   MTTDSKTIPATLIAGDGIGPEIVESVTEILDTVGAPFVWDRQLAGMAG
1050   APA_10430   1099049   1097268   -   MASASSTRLAALRTLLQNEGLDGLIVPHSDEFLGEYTPACAERLAWL
1051   APA_10440   1100010   1099090   -                                  prmA
                                           MAPPTRRHATSLETISVTVPEAAVEAYENAIGSVCATVGIFEANPEGT
1052   APA_10450   1102241   1100010   -                                  uvrD/rep
                                           MVNTSEHPSAPLFSSPSASGDNYLARLNPEQRAAIETTDGPLLVLAGA
1053   APA_10460   1102287   1103111   +                                  radC
                                           MGRQSAEQKRQKKPGSFAVKADTTHGCLNIQQGAMPVFESTGPTGH
1054   APA_10470   1103123   1103872   +                                  radC
                                           VKSGKKPTRQFADATHFRLNVSAAEAIALPTEMYSGTAPELSVAEET
1055   APA_10480   1105075   1103906   -   MTSSHSPLKPNAVIGIVGGGQLGRMSAIAAARLGFRTHILTTEANGPA
1056   APA_10490   1105620   1105072   -   VSETAPLPSASDALEDKAASAPVVGIIMGSQSDWETMRHADALLTEL
1057   APA_10500   1105871   1105665   -   MLRDRDLLLAQLHELRSEHRDLDTVISRMAHETTFIDQLYLQRLKKR
1058   APA_10510   1106111   1106275   +   MTRLSRIESLKSRHFRIDQKIMSEGGRPRPDERVLMCLKLQKLRIKEE
1059   APA_10520   1106935   1106345   -   MTTLPLMPKATAVWLIEKTALSFEQIAAFCGMHPLEVQAIADGEVAH
1060   APA_10530   1107685   1107179   -                                  hspA
                                           MSYDFTPLFRTAIGFDRLAQVMDSAARSPGNSSFPPYDIAKTGNDSYT
1061   APA_10540   1108098   1107868   -   MKPGIHPDYHEITVVMTDGTEFKTNSCYGKPGDTLRLDVDTKSHPA
1062   APA_10550   1108388   1108867   +   MADLKSHVHAPGWVGEFRAFIMRGNVVDLAVGVIIGAAFTSIVNSLV
1063   APA_10560   1108935   1109357   +   MGYASYMKRSRSGFPVFFRSAVGVLAILGLAGCQSSRGLKVQETPRT
1064   APA_10570   1110382   1109432   -                                 secF
                                           MFGRPLLRFVRKDTQINFMRGRYMGLIVSAVLSIASIILFFHPGLTLGL
1065   APA_10580   1111960   1110395   -                                 secD
                                           VRMYYSRLKLASVLGVCLLGLLLCLPNGMRKPFPSIPWRQIHLGLDL
1066   APA_10590   1112196   1113176   +   MAETLKVGVIGAGHFGRFHALKVRHVARETLVGLFDPDSKRAALVA
1067   APA_10600   1113375   1115306   +   MTLIDVQENDIRRSSSGGAEAGEPDLFNAGKMEDMVQLPGHHQVRV
1068   APA_10610   1115380   1116399   +   MSEHMSGQEPQQEQKFDLLTANPVYKPFRYPWAYDAWLTQQRLHW
1069   APA_10620   1117160   1116405   -   MPARFAITPGTLLRGRISYSQFLQGYRTGLEPVLMAAAVPARTGQHV
1070   APA_10630   1117278   1118348   +   LGVAISLSETGRTTSQDGSGVSVSKPGEAGLKALADYLASDMLACNQ
1071   APA_10640   1119231   1118362   -   VQIDGPALSGLRHILAFDSGIGGLGIVRAIQALAPDICIDYLADTAIFPY
1072   APA_10650   1119991   1119236   -   MTSPSGVASAHPAETSDWDRDAALTTARLLLEIKAVNFRPEDPYTLT
1073   APA_10660   1120238   1120477   +   VAAEANRIARKCERAVITAYKELREVGTADVTAFNACTTLYRIHHPE
1074   APA_10670   1121950   1120640   -   MSASQKEGKLSTATISVGGKSAEMPVLSGTLGPDVVDIRKLPAQLGV
1075   APA_10680   1122627   1122103   -   MRRLILLRHAEAASALLGDFSAEADMNRPLTPAGQEAARRCGHWLA
1076   APA_10690   1122966   1122637   -   MTVTDDQSISPTQALQDLRRSIDNIDSALVSMLAERFRCTKAVGALK
1077   APA_10700   1123764   1123033   -   MLELLPHDGNVKDAMRNGLRIVGDVHGDLDAFRHAVATDRFVIQLG
1078   APA_10710   1124072   1125589   +   MTERIRNVALRSKVCPAETASELIKHGDVVGTSGFTGAGYPKEVPKA
1079   APA_10720   1126402   1125677   -   VQQSSKSSRGCFKKIALAVGLCVAVGTTLVVQHSKAYGIMARIHHGL
1080   APA_10730   1130969   1126422   -                                 smc
                                           MTVRFVRLRIVGFKSFADPVTVEILPGLTGIVGPNGCGKSNVVEALRW
1081   APA_10740   1131629   1131009   -   MSFTRRSILAAGSLAVASTALRGISLAADATDTRFTPRELGNPNAKIV
1082   APA_10750   1132646   1131702   -                                 corC
                                           MSEHDSSSDKQEASSRGLFSFFHRKKHQTDLRSSIAALVQQAADEPEE
1083   APA_10760   1133149   1132643   -   MQDMDAPEKSLPFQAVFSDEQNEGPEILIRDRRWRSYVHNPEQLVW
1084   APA_10770   1134263   1133166   -                                 phoH
                                           VCVRLSSTRISASPRMAAEMPHASATLQFEDNTLLARLVGDHDKHLR
1085   APA_10780   1135666   1134248   -                                 miaB
                                           MGQRHSGAPAIMTGTPANTSPARGLHVITWGCQMNVYDSARMGDV
1086   APA_10790   1136929   1135838   -   MTPRPSDQTRPPYASPKKKPHGISPLPAWVEAYFRRTADLRATLRLG
1087   APA_10800   1136992   1137144   +   MKKHALSYRDFSQLDNPSANLSATEAVFGFGTAFLSWYVHKRVCKQ
1088   APA_10810   1137183   1139111   +   MLNRLALTANRVLAGAALWGASSCLSWSWAADPQPYTTKLVPTGE
1089   APA_10820   1139111   1143340   +   MADTPEPILPRTPDKPARPLWRRMGRIALITGGSLVGITGLAVAVLLV
1090   APA_10830   1144206   1143394   -   MPRRMRLVTWNINSLRLRLPLLEKLVRHLAPDVVCLQETKVPDPLFP
1091   APA_10840   1144312   1145373   +   MTTQPSSVSPDAVALHRALFTLDSHIDIPWPDRNDAFEDTADRRVDL
1092   APA_10850   1145631   1147544   +                                 uvrC
                                           MMTADSTPSDTLPVAQEQATPAVKGVEAIRHALKTMPLSPGVYRML
1093   APA_10860   1147647   1148216   +   MLTDLPNVLTISRIVAIPIVVTLAAWGSPRTDALACLLFILAGITDYFD
1094   APA_10870   1148402   1148929   +   MRKAALLGLCMIVSGCAGFDKFVSDTATLPGENPNAPSGEDLNMRR
1095   APA_10880   1148993   1149256   +                                 MoeD
                                           MTGTVNILYFAALREQLGREGQQVILPSNTMPVATLVQELRQHDAK
1096   APA_10890   1149262   1149732   +                                 MoeE
                                           MSVRVLVQQVAFDTGAETARLSSLSEQVGGMGLFIGQVRGGDGLLS
1097   APA_10900   1151043   1149745   -   MGKHSMTEASGSSLSSMPEWYTQGLPHIWLPYSQMKTASAPLAAAH
1098   APA_10910   1151086   1152267   +   MTRFDNLFQKGLADLSAQGRLRTCQQWQYAGGALLKRSDGVVVTD
1099   APA_10920   1152267   1152959   +   MARLLPVFVHGWAFGPEFWQPVLAQLNWADAVTLDLGFLKPEVSG
1100   APA_10930   1152956   1154353   +   MRNSTRAARICQSFDAAEKYDQAATVQRVAARELFQRIHTCMAGKK
1101   APA_10940   1155052   1154402   -                                 lexA
                                           MLTRKQHKLLLFIDSHLKQTGFSPSFDEMREAMGLRSKSGIHRLISGL
1102   APA_10950   1156413   1155139   -                                 moeA
                                           MRIQVQKVKYSCIKAVQQAKKGGLFMLDVAVARARILENLKTCGQE
1103   APA_10960   1156483   1156650   +   MAKTNVIKIRLVSTADTGYFYVTKKNARAHTGKMELKKYDPVARK
1104   APA_10970   1157093   1156764   -   VQIGRFIRRTVRAVVPPLVFLGIAGYFGWNATQGDHGIQAYRQQLGL
1105   APA_10980   1158544   1157264   -   MSAIVDIIAREILDSRGNPTVEVDVELASSARGRAAVPSGASTGAHEA
1106   APA_10990   1158728   1159204   +   MKKLPFLAVVLMAAGLLPFVACTCGIMFFDSGVPVPNLLMALVIYGA
1107   APA_11000   1159306   1160277   +                                 thiO
                                           MNGKPRILVKGAGVAGMTAAVALAERGGDVTLYESGGRVGAGASW
1108   APA_11010   1160291   1160488   +                                 thiS
                                           MKVVVNDTAHEVSAKTLAALIDELGYSGARIATALNGRFVPKATRN
1109   APA_11020   1160493   1161269   +   MAVSFYGQDVVSPLMLGTAQYPSPEILRDAVLAAQPGVVTVSLRRES
1110   APA_11030   1161266   1161871   +   MTALPQKIYPVVDSATWVDRLGGAGARFIQLRLKDMEEDALRAEIR
1111   APA_11040   1164031   1161884   -                                 recG
                                           VSSPLSFTSSSVLGQDGNSALAPLLAPLESLPGVSTARAKLLGRIAGGR
1112   APA_11050   1164101   1164430   +   MQDNFTASSPSSSSSASGVAEDNLAARRRRLKFRANHRGTFETDILIG
1113   APA_11060   1164509   1167985   +   MTAQTGAQKRIATVWGVPEGYDALLLARRARDHKGPVLHIARNDA
1114   APA_11070   1168987   1168037   -   MFYLRHPLSEMKQYTFLSLSVLGAVSIYATVAAAPAFAAPPSGCAVV
1115   APA_11080   1169024   1170019   +   VRFLKLDPFLMGLVSAVLLATFFPCHGAAVPVFRWLSIGLIALMFFLQ
1116   APA_11090   1170044   1171489   +   VAGLDPENWEELRTLGHRMLDDMLESIKNVAKGPVWQPMPDTLRQ
1117   APA_11100   1173436   1171520   -                                  cobT
                                           MAERTKGPSSPNTPPFSREQAEKRADTFKQATSAALRAIGGQKEADV
1118   APA_11110   1174457   1173450   -                                  cobS
                                           MTDISSQSNASELPPISAISVPDMEVSVRDVFGLDSDMKVPAFSIRTEH
1119   APA_11120   1175166   1174546   -                                  dnaJ
                                           MIKRRNTRPRAFDPDPDAPARCCDMPSCQEPAGYRAPRSRDALNQY
1120   APA_11130   1175218   1175556   +                                  bolA
                                           MTSLSDSSALSKAEGVRMQRVRNVLEKTFNPVVLEIEDESHRHAHHK
1121   APA_11140   1175556   1176128   +                                  lolA
                                           MRKGLKLNRRAFAVLAPLALAACAGQTMQGTSGAKNADVARVENY
1122   APA_11150   1176810   1176109   -   MTKEQILWEISKKLVPYPQALSRMESMARSIRAEEAAERVWLLEHPP
1124   APA_11170   1177307   1178197   +   VSKPKPLRKAVLPVAGLGTRFLPATKAMPKEMLPVVDRPLIQYAIDE
1125   APA_11180   1178197   1179606   +   MSFTHRFESTSLREYDIRGIVGKTLSTDDAFAIGRTFGSLVRRNGGKT
1126   APA_11190   1179745   1180761   +   MLSSLMDPAGRRISYLRVSVTDRCDMRCTYCMAERMTFLPRSDVLN
1127   APA_11200   1181648   1180773   -   MDVPVIFDRKAVRLHRERAARTQRATTPILEAAADILLDRLDDVMRS
1128   APA_11210   1181721   1182488   +   MQVKIRKLGTALMDILYPPSCVLCGADVAQHGLTCAACFGRLQPISR
1129   APA_11220   1182538   1182804   +   MPEIEIYTQRGCPFCVRAVALLESKKVPFKEINAPRGTQEREDAIRRSG
1130   APA_11230   1182828   1183319   +   MICYQLCCANGHTFEGWYRDSAAFTRLKQENLLSCAICGTPKVEQAL
1131   APA_11240   1183452   1183964   +   MKNFMTRGVQTGIKAFFLSSVLGVSAALLPALAQPAMADSVAMGGE
1132   APA_11250   1183996   1185258   +   MSGSFSRRAFGLGSLACGFLGSTYARADDDTSVPATQDAATPPPPER
1133   APA_11260   1186052   1185312   -   MHATREEAPSSVSSEEIARFSALADKWWDPTGPMRPLHAMNGLRIEW
1134   APA_11270   1186162   1187478   +   MQVAGRAGAMRFTACLVENKAMSGSAPRIVMKFGGTSVGDLDRIRA
1135   APA_11280   1187471   1188553   +   MSDIASSLNPAPTSEEWQRARARLDKLWQRGTDFLGTPYAILAGAM
1136   APA_11290   1188546   1189820   +   MAENAPSSEQEQPAALPPLPDIGTYGVGGALRKRREQLGWSLEDVAA
1137   APA_11300   1189957   1191117   +   MSGYRPYQHIERRKSRQIHVGKVAVGGDAPISVQTMTNTLTTDAQA
1138   APA_11310   1191209   1192492   +   VTGAVVWEYVFVSSIQPVRGTHDLIGEDQRRHAHVVHTARRIAGVY
1139   APA_11320   1192489   1193547   +   MKFDERLDQIVSRALELEAQLASGLNGEAFTQASREYAEIEPVVARIN
1140   APA_11330   1194008   1193544   -   MPQFFHRIQHTTTCLLALLAMLPFSYAYAGEFTVTDGKADAEISEVSR
1141   APA_11340   1194046   1194924   +                                  hemK
                                           VNTAEKKVPCQPIAQLLREGTQLLAQAGIEGPRREARLLLIHALSLTP
1142   APA_11350   1195184   1195615   +   MNVKRMRTRNHRSNGSNGSSRQLNGQIPMNRNHVFDSHGPDVRVR
1144   APA_11370   1196489   1195968   -                                  ttg2C
                                           MLQGFMLILCHNIIIRDENTPMSRQNRAGACLFSGAVLAATLGFAVY
1145   APA_11380   1196549   1197397   +   MSFLQAIIIALLQGATELFPVSSLGHAVILPALFHWSYDPHDPAFLPFL
1146   APA_11390   1197413   1198939   +   MGDLSGSSRRKSLQRIEKENSTQRLSRTLGPLQLTMLGVGSTIGAGIY
1147   APA_11400   1200004   1198940   -   MTQAEKQPSPLSLFEFWPGWVFYTPVVAYWILLGLRYGDVTLPTAA
1148   APA_11410   1200567   1200001   -   LLDQFLELTAAYPLAQVIIVILATFVLEDAATVITAIQVNLHTLSPITAL
1149   APA_11420   1200796   1201791   +   MLRRKLLVGGASALFATPVLARTTAATTPHPAASSSYATFLAGVRRE
1150   APA_11430   1201788   1202654   +   VKKLALVGCLAVLACSRQQPVAQQDLHYTVGPAWQAGGKWFYPRE
1151   APA_11440   1202661   1203881   +   MLQTRRFLLAGGAALFSGAYALDAMARPRHHGAAAKGAAPAAAQP
1152   APA_11450   1203885   1204529   +   MACGMFITLEGAEGVGKSTQLRLLKENLEAQGQKVLTTREPGGSAG
1153   APA_11460   1204534   1205478   +                                  dnaC
                                           VQEPRLASLQLRGHQAALQAFRQAMQGGRLPHAWLITGPPGIGKAT
1154   APA_11470   1205475   1207013   +   MTRRFYVTTPIYYVNGAPHIGHAYTSIAADVMARFHRLAGDEVFFLT
1155   APA_11480   1207013   1207825   +                                  tatD
                                           MMTEDSKKLAGLIDSHCHLDHFSAEEMPELLEAAKEAGLSGMVTIGT
1156   APA_11490   1207857   1208651   +                                  phnP
                                           MKITVLGCGGSAGVPMVGGADGHGIWGACNPKEPRNTRTRSSILLR
1157   APA_11500   1209577   1208699   -                                  uspA
                                           MKDVRKILLPLPSTSNAEAALIRGYNFARRFGAHLAVLHVRPDGREM
1158   APA_11510   1210313   1209633   -                                  pdxH
                                           MPQLDVNEHELSPSMTETSPSPAALPLDSQPLIDLAANPFTLFEAWMK
1159   APA_11520   1210459   1211298   +   MSSPNATLPAQGTLMKGKKGLVMGVANDRSIAWGIASAVAAQGGE
1160   APA_11530   1211308   1212378   +   VSYNTFGQLFRVTTWGESHGPAIGCVVDGCPPRLALTEADIQPFLDK
1161   APA_11540   1212830   1212396   -                                  osmC
                                           MSIIKYGSAHWEGSIKEGKGTISTESGALKDQPYGFNTRFEGKPGSNP
1162   APA_11550   1212908   1214617   +   MVQEKLPCSRRDEQARAQRCAYNAFQLKACRARILLSCMQKKLGAC
1163   APA_11560   1215214   1214666   -   MPDLVFTRRFSMGHRLIHGASESCALPHGHNEFVTVRLKPTSFAPLD
1164   APA_11570   1215947   1215207   -                                  exsB
                                           MPLPARDKQESALVLFSGGQDSATCLAWALERYGRVETLGFDYGQR
1165   APA_11580   1216600   1215950   -   MTYSVKEIFLTLQGEGGQAGRAAVFCRFTGCNLWSGREADRDKAIC
1166   APA_11590   1217614   1216604   -   MPDGSSPLAHSSVTSSSEVRHDWTVAEVQALLDLPFPELMFRAQTLH
1167   APA_11600   1217697   1218059   +   VLKTYSGLYAILNVYNSACHDAAGMKENKMSAKKGVSGAVLAVAI
1168   APA_11610   1218382   1219146   +   VGSLLYLYHVVNYIFCHTGLCVVTALSDDTATIAKQLVPVQENPVLL
1169   APA_11620   1219211   1220005   +   MDHLDQLEAQSVFILREAYRKLKPLAMLWSLGKDSNVMVWLAKKA
1170   APA_11630   1220034   1221914   +   MSEKIYSSQDAATPIVIVGHVDHGKSTLIGRLLHDTDSLQDGKVAQII
1171   APA_11640   1222107   1222448   +   LDRRNNRRDEQGLSVVTANRLLDGRIVWLDAQGKWQLFIQQAHPFP
1172   APA_11650   1222482   1224173   +   MSYSTQPALPVGRYAYDDVDRTFLKQRVEQFRDQVQRRIAGELTEE
1173   APA_11660   1224160   1224648   +   MPLFENGQIIEDTWLIAQDDQPLPEGDVLVPLARLAEGLGRNGNGRL
1174   APA_11670   1224664   1226685   +   MLRALKTDCKNVARKAGVWSLRQYLGFALKTTRWTFRVNEQAWPL
1175   APA_11680   1226679   1227674   +   MVRLRAPAFWSQPSAKIRPLLLSPFSAIVAAITARKQRQMGWTAPVP
1176   APA_11690   1227671   1228594   +   MSNKALTTALMQAEALLASGLLKFLTWLGPSTASNVAGGVCRFVGP
1177   APA_11700   1228687   1229514   +   MPYFIRSYSNMSSPSPALATRLEAARAVVHDAAQMAMAMRPPPGGP
1178   APA_11710   1229606   1230451   +   MRLVTHLSSASLALAAAFSLCVAAPAQAADKPQALVDKAALSVQDV
1179   APA_11720   1231539   1230505   -   VASKPKKQPAKQPAQKGRAALKWLGGLFLLSTLAGGGTGFFAWYSY
1180   APA_11730   1232839   1231529   -   VQNRERAGLLQSAGVNSGRRRVVVTGMGIVGPLGLGVENVWSRLIA
1181   APA_11740   1233143   1232904   -   MSEIADKVKKIVVEHLGVEESKVTPDASFIDDLGADSLDTVELVMAF
1182   APA_11750   1234191   1233448   -   MFKLDGKTALVTGATGGIGSAIARLLHAQGAKVVLSGTREAVLQKQ
1183   APA_11760   1235158   1234214   -   MAVYAFIFPGQGSQSVGMGQELAEAFPAARSVFEEVDDALGEKLSKI
1184   APA_11770   1235848   1235333   -   MSALPVIIFGAALNPDGSPSVALLNRVHSALVFGAAHGPVVYIPTGGV
1185   APA_11780   1237137   1235878   -   MTDQSPADTRDSSLAAQYEAYPYPERNPQDEAKRLLIGSPSHLREIDY
1186   APA_11790   1237904   1237155   -   MTSLTLAYPETTVHEATAAAIIRVLEANDVEPDIVTGPKDVLTDMLK
1187   APA_11800   1238817   1238224   -   MTHILIGYARCSTDKQDLAVQKQELLKLGVSADRIYTDKGFTGTNRD
1188   APA_11810   1238936   1240435   +   MILYRTGAITMADDRVLGTDSTEVAMRMAVLRPYLIDNVPLTKIAVD
1189   APA_11820   1241652   1241068   -   MSRTSTSSQQHTCQIIPFQMEITSRQQAYLTRWVQAAQPMGICDADV
1190   APA_11830   1242928   1241867   -   MPVVLKRLRARRLALASLMLAGASVCSLSSAKATPASDNKGTWTLQ
1191   APA_11840   1243308   1243985   +   LKSNRTDRSSRFPRRGGFDDDYMSMPSFGERPAFGGGDRGGFAPRRG
1192   APA_11850   1244596   1244090   -                                 smpB
                                           MSSKSGKSAKSSMISHGMVAQNRKARFNYNILETIEAGLVLKGAEVK
1193   APA_11860   1245486   1244596   -   MSDTFFSGSITALITPMNRDGSLDFASFEKLVDWQIREGTAALCAVGT
1194   APA_11870   1246384   1245497   -   MTQKVIAFQGTPGAYSDLACRNAKPGWETLPCRTFADAIDAVHQGR
1195   APA_11880   1247126   1246392   -   MVSSLVVIPARLASTRLPGKPLADIAGRPMVLRVWDAAMAANIGPV
1196   APA_11890   1247235   1247753   +   MDGRFLNRIAVSAVLSAAVLATCVFAARSTVPDTAPARPAFSLPGLE
1197   APA_11900   1247750   1248547   +   MTHSEELGLFTDVATMMADAARTVVRPWFRRDVAVDDKKDASPVT
1198   APA_11910   1248651   1249910   +   MSTSTHLSLPKDKIRILLLEGIHDSAVALLKASGYENVVRHKGALEGD
1199   APA_11920   1249913   1251424   +   VSIGAGILNSRIRSFAFCGIEARPVWVEVQISSGLPAFLMVGLPDKAVA
1200   APA_11930   1252656   1251448   -   MTDENKVSAGWLKLASSLSHVARPQATEAGTYVNLPLERGSTVVFP
1201   APA_11940   1253594   1252653   -   MPHHDVLFASQTGLCDLCRRIFKITVGQAADMSPLISTQKLAEMLGT
1202   APA_11950   1253664   1254755   +   MATGQPASTERIMRLLLLGGITYGCVLVLAPFSSALLWAGVLAYTTW
1203   APA_11960   1254752   1255435   +   MRRPLSRLVEFARRKSAHSFVACDMEGVRVISWNLLRRTGATVHDIA
1204   APA_11970   1256865   1257314   +   MVGKMLTQNGLGYKIPNKVAAKQGPAFLQKQRNGSVAYTQGVAAE
1205   APA_11980   1256866   1255439   -   MLPDLSISPFTLVLTVIRFVLVVSVGLHILLTKRNTASAIGWIGACVFM
1206   APA_11990   1257692   1257375   -   MKRVAVVRGALALTALGVGLVTTSSSARAERIISDLEASKLTFAALTA
1207   APA_12000   1258103   1257765   -   MTDTAQQRIKQDIEANPVMLFMKGDADFPQCGFSARVVQILQHLGV
1208   APA_12010   1258360   1258130   -   MAMSATELETYIRQAFPDAQIKIDDLAGDGDHYACSVVSEAFRGLSR
1209   APA_12020   1260592   1258388   -   VNKPVTVDESLAREFGLTSEEYGRVLSIMGRTPSLTELGVFSVMWSE
1210   APA_12030   1261290   1260589   -   MKAAIIVFPGTNRERDMAIALKRVTGQAPRMIWHHETDLGDTDLVV
1211   APA_12040   1261658   1261287   -   MKRTLLVTLALACAAPGFAHAQRIAPMKAGNFARLCTRATSAGICDA
1212   APA_12050   1261897   1261655   -                                 purS
                                           MKVRVTVMLKDGVLDPQGKAISHALQTLGFDGVQDVRVGKVIELD
1213   APA_12060   1262693   1261926   -   MARRRQLYEGKAKILFEGPEPGTLVQYFKDDATAGNGAKSGVITGK
1214   APA_12070   1264196   1262847   -   MVPRYTRPVMAAIWSPTNRYRIWFEIEALACEAMAEYGTVPKEAAK
1215   APA_12080   1264368   1264979   +                                 terC
                                           VNGFLDSFSLTAFVAFLQVVLIDVTLAGDNAVVIGMAVRSLSGAQRR
1216   APA_12090   1265038   1267014   +   MRRFAISYRYHLVAAVSLACVGLSACSSSSPEQQGASENRLAWPTEQ
1217   APA_12100   1267016   1267492   +   MDMARLIATFGGCGLSPRAPGTVGSLAALVVGLPLLKRPRLLVAGIA
1218   APA_12110   1267509   1268021   +   MSAPHAGFSELSVLAAAERTLTRLRQVDGHVVTAESCTGGLVAAML
1219   APA_12120   1268504   1268079   -   MKKLFAAALLASSATLAVAPAMAAETATHHGMHAHHHHEHCLKGK
1220   APA_12130   1269142   1268654   -   MPQHAEKRVLPYRPDQIFDLVADVGQYPKFLPWCVAAKVRTRTTTE
1221   APA_12140   1270122   1269142   -   MSIRVVIDHRTGGSSPNKLRHPEKAHRPDNPIARKPDWIRVKAPNHP
1222   APA_12150   1271662   1270244   -   MSQTDFDIIVIGGGPGGYVAALRAAQLKLSVAVVEANHLGGICLNWG
1223   APA_12160   1272937   1271693   -   MATEILMPALSPTMTEGKLARWLKKEGDTVNSGDVLAEIETDKATM
1224   APA_12170   1274304   1272949   -   MATEILMPALSPTMTEGKLARWLKKEGDTVNSGDVLAEIETDKATM
1225   APA_12180   1275323   1274313   -   MGTNAKQVGKAGNNGPSLTRDQFLKAYYDMLLIRRFEEKAGQLYG
1226   APA_12190   1275927   1275451   -                                 moaC
                                           VPSPALTHLDAAGHAHMVDVSAKAATRRKAVATGAIIMQPQTLEMI
1227   APA_12200   1276795   1275929   -   MNDTPLASSAASASDTLASKIDELPDVLSRICARTKLEVEHRSTLMSL
1228   APA_12210   1277925   1276813   -   MSVTTQETTSQQAGEQFFSSILARVAEGQALSAAEAEAAFGVIMDGL
1229   APA_12220   1278521   1277925   -   MILLIDNYDSFTFNLVHYLGELGVQCDVRRNDTLSVEDALALKPEAIV
1230   APA_12230   1280121   1278580   -   MSITARIAPSPSQQECEAAWAQGQPSVVFSVEAADLLTPVSAYLRLA
1231   APA_12240   1282037   1280118   -   MISYLRRVFVESWLGRVTAIVIFLAFVGWGIGDVMGYMGEETDVVA
1232   APA_12250   1282285   1283025   +   MTRQIIVGNWKMNGLSRDSQELVKAITSGLPANSADVVVCPPFTQLG
1233   APA_12260   1283052   1283396   +                                  secG
                                           MTTALLILHFCVTIALIGVVLIQRSEGGGLGIGSSQGMGAFMSGRGTA
1234   APA_12270   1283538   1285172   +   MTRFVFITGGVVSSLGKGIASAALAALLQTRGYKVRLRKLDPYLNVD
1235   APA_12280   1285169   1286002   +   MTQALGSDFQLGSLYIGNDQPFVLIAGPCQIESAAHAMETATALKEIC
1236   APA_12290   1288552   1286114   -   MTDLSQPTPSAVSEEYDAASISVLKGLDAVRKRPGMYIGDTDDGSGL
1237   APA_12300   1289791   1288643   -                                  recF
                                           MQAGQQKQRGMPRLLKLTLSNFRNYERLAWSPDASLLVLTGENGSG
1238   APA_12310   1290961   1289837   -   MKFSAERATLLKALAHIQSVAEKRNTIPILANVLIQAANGQLSLKATD
1239   APA_12320   1292510   1291077   -                                  dnaA
                                           MTIGVDDDESAFSRLEDGKGLEESWLRICARLKGEVGEVEYRTWLTK
1240   APA_12330   1293120   1292851   -   MANIASARKRIRQTAKRTARNTARKSRMRTFIKKVETAVEAGDHGA
1241   APA_12340   1294097   1293258   -   MPELPEVETVMRGMQIALQNGTIKEAIVRRHDLRWRIPADFSQTIKG
1242   APA_12350   1294127   1294909   +                                  ubiE
                                           MTDNSFTPSPASSDATVEETDFGFRSVRKEEKKNLVRDVFDSVAGKY
1243   APA_12360   1294921   1296150   +   MDVVLPSRSILLIVGGSIAAFKAPELIRLLKGAGMQVRCVLTEGGSQF
1244   APA_12370   1296186   1296665   +   MSAPISPSADLSVQVQRLPHAQGLPLPTYATAGAAGMDLLAAVAEPV
1245   APA_12380   1296662   1298410   +   MNRSWMNLVPRPQGSSSLPLRYLNSADALLLLCLAAAAIALGAAVR
1246   APA_12390   1298426   1299781   +   MASGPEKKTFPSGSVLAEARNVSRFYHKDSAADVQVLDNISLTLHAG
1247   APA_12400   1300330   1299794   -   METAILGGGCFWCLEAVYRGMKGILSIAPGYAGGTVQHPTYQQVCT
1248   APA_12410   1303102   1300409   -   MLNKSFEPAQIETRLYELWESRKAFSAQPDSGKKPFTIMIPPPNVTGT
1249   APA_12420   1303885   1303244   -   MASSQDPSEGTGKSVADVLSSIRQTLHDEHLAAMAPPSSDTDSAEGD
1250   APA_12430   1305361   1303922   -                                  tolC
                                           MRRICGAGVGMAVLLCSSTAWGQKYDGSGSPTFVPHTLQEALAAAY
1251   APA_12440   1306159   1305482   -   MPYPKDKDMETARNLMVDDQLRPSEITNLSLLSVMRELPRECCVMP
1253   APA_12460   1306844   1308256   +   MMSSNDVELNDVAFYDAIPISEITENSDGTFTATPSPSGLSEDIYFPVY
1254   APA_12470   1308403   1308750   +   VVWGAGRSVASCGCCVHIPAVIILQRNTLVSNDTTAQNGVLRSVKVQ
1255   APA_12480   1308781   1309113   +   VLLPTYLGLRFAVPGINISQERAWLVQKKFADVFLEKVEQINAGRTIY
1256   APA_12490   1310022   1309180   -   VGDALLRSIGKGKSVKVVANGKHTARSVLLTGATGGIGMELAKRYA
1257   APA_12500   1310054   1311202   +   MSSPTQITVTPVSGSRQLSLFIKLPRLLYDGLPSYVPPLDMEQRDIFSP
1258   APA_12510   1312216   1311227   -   MIQNKPSSQTDLPQEFAFIRQHFSALAGAAALELRDDAAVFTPPEGRE
1259   APA_12520   1312709   1312185   -                                  nusB
                                           MTELQDEPRLKGAQRPRTAARVAAVQALFQIDQNGDRPENVIEQFLV
1260   APA_12530   1313251   1312775   -   MRCPFCGNPDSQVKDSRPNEEGLAIRRRRACLSCGQRFTTVERVQLR
1261   APA_12540   1313390   1313908   +   MKRSHFAVLFCAALSCSAYAAPQAWADNQPPLPVLPEQADAQKDIT
1262   APA_12550   1315471   1313972   -                                  glpK
                                           MSKQDCVLAIDQGTTSTRSIVFDRDAQELAAAREEFAQHYPKAGWV
1264   APA_12560   1316329   1315499   -   MRKVMEKTGKALLGEMIAECLAVMIIVTIGDSVAAMFSLYDPSPYKQ
1265   APA_12570   1317895   1316375   -   MTTPTASPARIYDLLIVGGGVNGAGIARDAVGRGASVLLVEQDDLAS
1266   APA_12580   1318806   1318036   -                                  deoR
                                           MTQAVQQRRFRILKLVQQHGYATSEDLARELNVTVQTVRRDVNTM
1267   APA_12590   1320683   1318803   -                                  recQ
                                           MIETGSISTPSQFSHSRLERDRFAGKPPQEVLQAVFGFPGFRSLQAQAV
1268   APA_12600   1321065   1320688   -   MRRLLPVAGLCLLAACAGNAPRKYVVFFSAGSTELDDNARNVLLQV
1269   APA_12610   1322838   1321144   -   MTSLPNPRPTGELTDWQAIRTIFALWRKQGVRLAGGIVLALLALAFG
1270   APA_12620   1324562   1322841   -   MSNEKAAIRNWTRTQSRLGRQAARSVVGAGLLSSLVGIGQVWCVAV
1271   APA_12630   1326337   1324655   -   MRLLICLSAVPVIAIGAVLALHNYREVTLGSAQRAGNAIMRLDLQFRH
1272   APA_12640   1326720   1326439   -   MAYDTDVRDPKPAESCKHSTQQAMPGWMAWQKPEFRMGKRRDDA
1273   APA_12650   1327319   1326726   -                                  rpoE
                                           MTASFHDQVIAILPKLRVQALALTRNRSVAEDLVQDTVCNALAAQD
1274   APA_12660   1327839   1327426   -                                  rpoE
                                           VQDTIVRALDKADGFTPGTNLRAWCFAILRNLFLEQHRRGRRERIAL
1275   APA_12670   1328060   1328809   +   MSESLRDGLIRALPYGRRYARALTGSQPEGDLLVAESLRGLSAQRLK
1276   APA_12680   1328867   1330675   +   MAHPPLLHLQDITLTLGGNPLLDGAGFAVGRGERLCLVGRNGSGKST
1277   APA_12690   1330741   1332792   +   MPCFTGSLYKRTLPVCSVALLALLTAAPVAYAQDTPAAADAEGAQP
1278   APA_12700   1333923   1332808   -   MKSRAAVAFKPGQPLEIVEIDVAPPQAGEVLVKILNTGVCHTDAFTL
1279   APA_12710   1334138   1334479   +                                  phnA
                                           MKCPSCGSEYPYHDGNLWVCPECAHEWNEETQADTAGAEDSSVVR
1280   APA_12720   1335845   1334541   -   MQPPDTRTLNAGTDALSPQQWKEATRFDGTDIGWIVMSIGMAIGAG
1281   APA_12730   1336023   1336994   +                                  apbA
                                           MEHFLATTPSSIVFIKMSTQLFSNTRTIALIGAGSVGLCLGAAFASAGW
1282   APA_12740   1337002   1337877   +                                  phzCF
                                           MKRAYKVVDVFTKTPLLGNPVAVVLDADGLDTKTMQAIASWTNLS
1283   APA_12750   1339278   1337908   -   MNDLVIRNASGILTGLKGLQERRTGDIRIRAGRIVSIGHIPEQAGDTVL
1284   APA_12760   1340288   1339275   -   MPVQEFGMSLTRRTLLSAAAASSVAAFTPFKRAQAATPVRLLLSWFA
1285   APA_12770   1340437   1340967   +   MQECYMPRLSAFSSPVAISRLAKTVMVGALGTFGLIVALNNVTDYNS
1286   APA_12780   1341004   1341795   +   MQETVISIQSAEKTFPNGVQGLAPITLDIHPKERIGLIGPSGCGKSTLLK
1287   APA_12790   1341799   1342566   +   MSARLISIFAPLAVGILFLLLWQGICYFWHIPPYLMPAPSDIARSLFSNI
1288   APA_12800   1342679   1343809   +   MLVLFSMGEALAAKKHAFPHAGLHQLLRPMGQFAICVRNAMTLNTK
1289   APA_12810   1345203   1343830   -   MMSRRYLLKNALCLVTMDDARQELKNGWIVTEGRRIVALGGMEDP
1290   APA_12820   1347605   1345266   -   MSFRIIAPARPVLSRLTYRQHLATLSCLVSAVGFCASLSTAEAQTATA
1291   APA_12830   1347935   1349260   +   MVRDVAFLIDLLTLEARMQTQPNVLCVADASGKRAVQRCDFLAHPP
1292   APA_12840   1349263   1350504   +   MEQTRMISPMFKQIDPPQRFLMGPGPINAHPRVLRAMSADMLGQFDP
1293   APA_12850   1350522   1350926   +   MELNNPETLRQVEACSDLYERALAENDVQVLDDLFWNGPEVVRYG
1294   APA_12860   1350939   1351127   +   MTAPSSDQENLVRARATTIGLDLSPTCLPGVISNSALLAHYAKLVEQH
1295   APA_12870   1351124   1352479   +   MTRFSSAHAIAEAIRSGKKSAVSIIQETLNTLRTQDHGIQSVTHLFADE
1296   APA_12880   1353299   1352484   -                                  xdhC
                                           MREVARVLQHWHRHPEQLILVRVTEAKGSTPRETGAFMLVGTSLLA
1297   APA_12890   1355658   1353313   -                                  xdhB
                                           MLKKHINAPTTVPGGATQSLKHESGRLHVSGKATYIDDIPTPANVVH
1298   APA_12900   1357132   1355651   -                                  xdhA
                                           MRHHIRFYLGQTLHEVSDLSPTHTVLDWLRDQKGLTGTKEGCNEGD
1299   APA_12910   1358629   1357169   -   MKAARNVPQAVHPVDEFLPFWQLGVYGLQHVLTFYAASVIVPILLA
1300   APA_12920   1358965   1358633   -   MSSLSTHVLNTVSGRPASGVQIRLFAGDTLVFTGLTNADGRCAELRS
1301   APA_12930   1359471   1358962   -   MMLLQDVNTLSPQQFIETFGGIYEHSPWVAEAAAKQRPFASMQQMK
1302   APA_12940   1360361   1359468   -   MQNYPRDMVGYGACPPDPHWPNAARIAVQFVVNYEEGAENSVLHG
1303   APA_12950   1361807   1360389   -   MEQLNKRVRDDLAKIQYATGNWCIPHKHDGEDVLDVAIIGGGQGGL
1304   APA_12960   1361964   1362866   +   MPVFSRFLRYFMAVAQHGSIRKASDELHIAASAIDRQILQGEKLLGTL
1305   APA_12970   1362871   1364193   +   MSVSSAKTAIRGCYITFKDNPFMVAPEESLSIEEDGLIIMEAGRITDCG
1306   APA_12980   1365782   1364190   -   MQHTFQSGRGMVTSPHHLASQSGLSILKQGGTALEAVVAMASTLCA
1307   APA_12990   1366309   1365869   -   MGMNVGSESTTEDEGIVDINTTPLIDVMLVLLIMLIITIPLQTQAVSID
1308   APA_13000   1366783   1366364   -   MGMQVGDSGGEDDVVSAINTTPLVDVMLVLLIIFLITIPVATHTVKV
1309   APA_13010   1367830   1366817   -   MMRIMRKMTRLPRSFVSGLAAPALALLMSTAAPVAALAQDAAPAAP
1310   APA_13020   1368610   1367900   -   MQDNSQQTEGKERYVLRAGGAVGAGALIAVLLLHGAGVWGLMYG
1311   APA_13030   1369849   1370868   +   MCCDPFFLARFIVKAPAKIAIIALSLFAVAGGAFAWHEHQVAQSVPDG
1312   APA_13040   1370868   1373603   +   MGASASEIRVEGVSHAYGGRNVLHDISLTLPAGQTIAFIGPDGVGKST
1313   APA_13050   1373603   1374730   +   MLRWLINVGLLCRKEFHSLMRDFVLMGLIVFAFSAAIVLVAHGVRVD
1314   APA_13060   1374731   1376182   +   MLMSLSSSYTRLLFSTLLCTGLVACSPFHTKLPPSQVAVPAQFSATPQ
1315   APA_13070   1377107   1376208   -   MKSGMTLEQLRFFIAVAEREHVTAASKALHVTQSAVSAAIATLEEQH
1316   APA_13080   1377162   1378259   +   MKCLSLMFCKERDIAMLTTSQAQPLFKQRILDVISHNLPGILLCLAITG
1317   APA_13090   1378288   1378986   +   LRNLDFSSWHSFLFTMIGLSLITLIGVGIRLLMMVLIQQRRERMNRQIN
1318   APA_13100   1381225   1379063   -   MNMASRFSLKKILRSGSDTQGTNVNTLIQSGTSDIVRQKPAPQEPADL
1319   APA_13110   1381835   1381281   -                                  tetR
                                           MGRRRTIDRESVLDSAELLVQKGGATALTLDAVAKAAGITKGGLQY
1320   APA_13120   1382587   1382006   -                                  tetR
                                           MAQPVQAKKAYHHGDLRAALLRSARTILEEQGIAALGLRAITRHTGV
1321   APA_13130   1382724   1383908   +   LRFLPSVYHVSRLVAGFCLMGVSSGAIAATASPSGTAGTLTSSQSLPD
1322   APA_13140   1384009   1385241   +                                  nhaA
                                           MTETSTAYVHRIHHFLQSPAGGATALLLASLAGFALANSAWCGGYE
1323   APA_13150   1386683   1385313   -   MITYQTLNPTTESVERTFELHTPEQMQAIIDRADHIWRTDWKKRSIAE
1324   APA_13160   1387816   1386680   -   MTSISLFNPITLGDLPLENRIFLPPLTRCRSTQPGDIPNALMAEYYAQR
1325   APA_13170   1387930   1388286   +                                  marR
                                           MPRIRHTTLTCSPGCTVEATLELFGGKWKALILYHLFEDGVLRFSEFR
1326   APA_13180   1390481   1388346   -   MVVKKNTPSKAAKNGLKANKDKIEPSYTEQQGNGGETHQQAGGDIA
1327   APA_13190   1390643   1391083   +   MCYVGLMAISILPNISLADSELEVSYILASGPGGQNVNKVATAAQLRF
1328   APA_13200   1391324   1391527   +   MRTPFVKNQASSAVSKTEKKVADDKAVGEDSLPENKKSQNKMVKN
1329   APA_13210   1391579   1395874   +   MRTEHPSDTGPKSASRSFLRGLFGGHGPVNIQDDHFPIKSEIFGIERLE
1330   APA_13220   1395904   1400136   +   VVAPYATLLASMVDPQKAVANLSVLEKTGAHGRYGFYEALDYTPER
1331   APA_13230   1400202   1401542   +   MRRMFFITTALFITTPALAASAPPVALTHVRIVDGTGAPPIEDATLVM
1332   APA_13240   1402190   1401648   -   MNKSDFTIRKTCIEDVPVLALIEQSAAQIFRQIPSLSWIADHTVLPVDIH
1333   APA_13250   1402517   1403347   +   MFLRKGNCPTMIANVLSIAGTDPTGGAGIHADIKAFSAMGAYGMAA
1334   APA_13260   1403701   1403399   -   MSAYSILRTAIEQKKAVAFTLHDKPQVASPHALGKGDGVEKVLMYR
1335   APA_13270   1404029   1404469   +   MRLFASRWLVAICVMVGLVGQLFLQSHAQLGEMPRATLERLTGLHI
1336   APA_13280   1404529   1405950   +   MREPAIRAGYINLPCQPLCVTLSGQIGMSRIFRTLPCFGVMIGGLTLIC
1337   APA_13290   1405916   1406857   +   MLLKKPAASCFNYATNADGWGTDDYAYQWGFYGQLRFELTKKLSL
1338   APA_13300   1406787   1408547   +   VVYGSSTFPRLLAISWQRFVLRTDKPSSSHSLSDWKILFPFWVSAEKW
1339   APA_13310   1408577   1409332   +   MPVRIGVAGWSVPTQLAAEFPSTGTHLERYGTRFSAVEINSSFYRPHQ
1340   APA_13320   1409353   1410000   +   MCNLYSMTSNPQAIRKAAKVVVDNAGNLQPLPDIYPNTMAPIVRNT
1341   APA_13330   1410046   1411362   +                                  dnaK
                                           MDSMASGHYFPPAMTISARPIQIGIDFGTTNSVIVIARPDRTIQTISFPL
1342   APA_13340   1412830   1411382   -   MFIFSTSQKNRIALLLSAMLLGACSLQPKTSLPTVALPQTWENAPAQQ
1343   APA_13350   1415874   1412830   -                                  czcA
                                           MMPQKFNPSRWAVEHPQLIGFLMVISLIAGGWQFANLGRAEDPNFTL
1344   APA_13360   1416965   1415871   -                                  hlyD
                                           MYYQIKKTNALYKSLLVVSFLFINSCKAKHPEDVVLQQKPIEAVQVV
1345   APA_13370   1417342   1417013   -                                  emrE
                                           MKGFLYIFFTVISEVVGTAALKETQNFTKPLPICVMSIGYVLSFLFLSL
1346   APA_13380   1417920   1417339   -                                  tetR
                                           MTSHKTRTNNPESVKSNLLDAAAEILIHESAQKLTLNLVAKKAGVSK
1347   APA_13390   1419524   1418094   -   MTSAHSAQVASLIPRALRHAKGVKLRKIAPRTQQAEWHPPKKRMDP
1348   APA_13400   1419829   1421976   +                                  asmA
                                           MTETPPQTPAKSHPVLVGFGSFLLAVILLIVFWSWDWFVPLVNSRAT
1349   APA_13410   1423165   1422071   -   VAHQPSLCRSFGNDHALVFLPWRVGSRYSGGSVWPCKAPSSQYSVV
1350   APA_13420   1424263   1423382   -                                  gntR
                                           MSISALPVTANCPAPFSTLHHPNFVVPDFACDTHAHVIAEDTARYPFT
1351   APA_13430   1424764   1427070   +   MSDISQDTTIGGGSGNATELNGGTVLSGVGLFVSSGGIASNVTVGSGG
1352   APA_13440   1427517   1427131   -   MTHEQIIRDMFSTFTNFDADLDALLGFMTPDYRQCVDGHAMTLSAF
1353   APA_13450   1427610   1428407   +                                  araC
                                           MHANFSHDSSAKPYFTAHSSWLFGGRVKQNARRTTVPHVHNNGQIF
1354   APA_13460   1428889   1428428   -   MSRESVQAFFKTHAPDIEPVVLVDSTATVAEAAQALGVQEGQIAKTL
1355   APA_13470   1429013   1430395   +   MASAYSSQYRVKETVSYICSLIHKHVVMNNNNAQSLCQRSYCIGLLS
1356   APA_13480   1430932   1430417   -                                  fur
                                           MLAFSGYRRSPPALKQIRPGMGANRSAVRWLEERCENAGIRMTDLR
1357   APA_13490   1431836   1430979   -   MSGIADMAQPTEGAISFADWQRSELRRAQRDDALRWGLSLLAVLTV
1358   APA_13500   1432306   1431833   -   MIRIRHTDESPHEASEINVTPFIDVMLVLLVIFMVTAPLTTVNVPVDLP
1359   APA_13510   1433061   1432312   -   MTDLAPISFSPWEMFLNAGPVVRCVMVLLAVAALLTWTIFIAKSVEL
1360   APA_13520   1433309   1433058   -   MNAVSHQAPVISSHSTDSRPSVPVWPWPVALGLLTIFGLLSALLGQH
1361   APA_13530   1433977   1433306   -   MKRLPFGSIRRGRATRLTWLDLHNLLGVATLMWATVVGFTGLVNEL
1362   APA_13540   1434108   1434479   +   MRRYSLRDDQWERIKDLLPGREGYVGGTAVNNRLFVEAVLYRYRA
1363   APA_13550   1434521   1434862   +   VELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQRGIT
1364   APA_13560   1435409   1434855   -   MTTRALRRWFVVHKWTSLICTLFLLIVCITGLPLLFSEQIWNTFVGDD
1365   APA_13570   1437286   1435811   -   LPLGRTSSIRGSQIAHVSSVKVPVLSPSSIPTIWEEIQDLTGPNRFLNFS
1366   APA_13580   1437383   1437994   +   VVAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQGSP
1367   APA_13590   1439280   1437991   -   MMEHSRVTSETGARPTMGRKDNNTTPYTCLLLATTAATFLTFAGSA
1368   APA_13600   1440470   1439445   -                                  fecR
                                           MSLSPDAGPIALRRKAFMTVIDDPVRQQASREATQWLILLQEEPDDP
1369   APA_13610   1441073   1440540   -                                  rpoE
                                           VWERYENLEQKGSLLVLYSAHRRDLLKYANGLVADHSEAEDIVQEA
1370   APA_13620   1443728   1441269   -   MARNGNVSGRGVAALFFVVTTTALTPLACKPAEAQAELSQHKILFHI
1371   APA_13630   1444832   1443855   -                                  fecR
                                           MDESQKAEAEAIDWSLLLNEEPDDQALRHEFEKWLSEKPAHAIAWQ
1372   APA_13640   1445090   1445506   +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
1373   APA_13650   1445485   1446528   +   LAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPA
1374   APA_13660   1447036   1446671   -                                  rpoE
                                           VHDAWLLFHRQNSAEILAPLSYLKTIIRNLLFDRRRRSTFESTTEAPFE
1375   APA_13670   1448270   1447320   -   MLSRRKFGKNILSQLVGISLASTLGGRAFAQQQSIRIGYQKYGTLALL
1376   APA_13680   1449068   1448322   -   MNIMAPAQTFSTKNTAPVVQVRGLSRRYGKGPVILDHLDLEIGAGEF
1377   APA_13690   1449841   1449065   -   MIQKILGYFTRYFSLILLVAIWQGVCSAGLISPHVLASPVAVVRTAETL
1378   APA_13700   1451167   1449872   -   VAWYLRKSTYKQKHFALYAAGIMVFYANAITASCAFSAEALLPQQE
1379   APA_13710   1452133   1451189   -   MSLSSHHLDISRISSPVLQGEGPNIEVERVHATPLSPAIGAIVSGVNLAQ
1380   APA_13720   1454023   1452368   -   MEGLTIRLIGDYTHLRESCCITPMTTALSTYSNGEAISGNYWDRAAYA
1381   APA_13730   1455438   1454188   -   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
1382   APA_13740   1455838   1455497   -   VELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQRGIT
1383   APA_13750   1456251   1455880   -   MRRYSLRDDQWERIKDLLPGREGYVGGTAVNNRLFVEAVLYRYRA
1384   APA_13760   1457194   1456325   -   MSAVRTPAFKFVADRSSLDLLSRRFLFCSALLILAPSWLEKTASARTN
1385   APA_13770   1457534   1458889   +   MNASHAGSACVETPRNQIKIEESMPNIPITESIVVNKVAWRILPLVTAC
1386   APA_13780   1460391   1458955   -   LLHQGPWGVFNTNSGAAAGFGTVAYYAVARWAEDWSNLRDKRNH
1387   APA_13790   1460651   1462036   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
1388   APA_13800   1463382   1462555   -   MGWVTQRLGWEYIFAMMGLLGVLLAILWLVTMRPPAKHPAVSNAE
1389   APA_13810   1463426   1464865   +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
1390   APA_13820   1465591   1465031   -   VNITKGSLETPPAGFPSDIARSERRTVVRYFVLAFLFTITAINYGDRAT
1391   APA_13830   1466654   1465746   -   MLQLTQVRCFVAVAEELHFGRAAARLNMTQPPLSRQIQLLEHSLGVE
1392   APA_13840   1466782   1468569   +   MRMTEDDRISSAAVTPEQAGRRKLRSERWFGPADLRSFGHRSRAMQ
1393   APA_13850   1468622   1469446   +   MSPHKNPIRRIWAEKRAVLNGWLSISSPFSAEIMASAGYDCITIDLQH
1394   APA_13860   1469676   1470125   +   MADIICRNSILFDGSGKSPIIADVAITDGKITAIGSQLDGIHGATEIDCQ
1395   APA_13870   1470160   1471134   +   VEGSIMGQIRHGSATTTHAVRAAIQRSQASLAALSEEFGINPKTVAKW
1396   APA_13880   1471068   1472582   +   MDFRARKIHHQSNPSNPGTKHLGPNVVPLIPHSMLRIEVMGLAASISR
1397   APA_13890   1473484   1472588   -   MKRTLDWRNLQFFVAVARSGSLSEAGRLMGVDHATVGRHIVALERS
1398   APA_13900   1473649   1474806   +   MTALYLPSLIRIGGGALNELPAALKQAGLSKPFIITDNFMAKTGLLGR
1399   APA_13910   1474852   1476213   +   MKPHVEKERSMRSLVMASSVGTVIEWYDFFLYGSLAIFFARLFYPPG
1400   APA_13920   1476240   1477733   +   MNTIHHVINGQHINGHSTRYGDVFNPATGESSKKVVLGTDEDLNAAV
1401   APA_13930   1478038   1479030   +   MRLLSPLRKALLAGVCAAATFVSASASAATLKIGYSDWPGWVAWQV
1402   APA_13940   1479051   1480013   +   MPSLAASWRLYGRTDRTARGVFGILAVLLPLLTWSAVSYLPFVWHP
1403   APA_13950   1480013   1480927   +   MPQNSLPDYCILPPDVAERMAHIKQRECVLKIDHVGKVFTQKRHQTV
1404   APA_13960   1480939   1481418   +                                  copG
                                           MSSRETKEQVSRISVSLPPGILHELDAMVAEKGYASRSQAIQNILHQE
1405   APA_13970   1481460   1482263   +   MQIDQQTPEWYRARYNQLRDQALLKESSARPASAPIEMTESSILHRET
1406   APA_13980   1482280   1482924   +   MPEYDISKVFSAITLDQVVPARVPWSGVVRKGQVLRIIDLESQQAVD
1407   APA_13990   1482943   1486482   +   MFTKVLIANRGEIVRRVSRTLRRMNIASVAVCSEADRFTPPVLEADEA
1408   APA_14000   1486488   1488323   +   MCPNADRTGKNMSLPNMLQITPLLSAYRTGTLTPTNMVHDVIARIDS
1409   APA_14010   1488559   1489503   +   MTTLGLVDAEQRDMIASFPSFDPEQDDLMEFRRGLVEGSTALLNSGS
1410   APA_14020   1489808   1495834   +   MEDRGEFSVDTEQKQISEDTDHPLPIETPSLQIALQEAVNASLWENSV
1411   APA_14030   1496173   1497324   +   MSIDLHTAHDAIEAASHLKQQLASRAAHHDRTGIFAQENIDDLRQAG
1412   APA_14040   1499149   1497515   -   MEQVKQHCLIRRLPHAIKTRSFCFRVVIRTGAKLATAVILTDMAEHV
1413   APA_14050   1500732   1499410   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
1414   APA_14060   1501492   1500749   -   MITQPLFCRVMRYRMLATTALAYACVTPVFAATTESVSPKVETSTQA
1415   APA_14070   1501652   1501954   +   MTKTSAPLSLYLKEATHTFHEDLDKSIMAHGLFASADKYKNFVQLQY
1416   APA_14080   1501969   1503219   +   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
1417   APA_14090   1503399   1503845   +   MSDLFWLTDDQMERLRPFFPKSYGKPRVDDRRVLSGIIFVNRNGLRW
1418   APA_14100   1505513   1504209   -   MGKGQALSVKEKIAYGCGDAASNMMWGMTSSYLMYYYTDIYGLP
1419   APA_14110   1507309   1505963   -   MKEIRLNAFDMNCVSHQASGLWRHPRDQSDQYHTLQYWTNLARTL
1420   APA_14120   1509615   1507342   -   MLRIPVNLLSSRYFSRSCFLSHRTTLVVSSYLLGFTPAAWAADRTPLN
1421   APA_14130   1510277   1509738   -   MTNIVAPFGYNPPDEETVSADIFRNGMAALSSAVTVVTTDGPHGPHG
1422   APA_14140   1511774   1510284   -   MAQANQDRPIVRDADDISALVNAGPQAGSHARMVVALALGGVFLD
1423   APA_14150   1513228   1511780   -   MAIMNTSSHIPHVAIIGGGFSGAALAWHLTRNSNRPKRITVFEPRPFLG
1424   APA_14160   1514399   1513236   -   MSYAVPDKINVLWFLPTHGDSRYLGTQKGGRPVDLPYLQQVAKAAD
1425   APA_14170   1515832   1514402   -   MTTHLKQLHVNLFEMACVSHIVHGMWRAPGNNRHRFGDMSYWLE
1426   APA_14180   1517109   1515829   -   MTNQAHSTQNFSPRIDALAQRLRPIFARIADEAIDREENRILAHEAVK
1427   APA_14190   1517535   1518083   +   MAIDLQTARSAIEVATHLKQQFATRAAHHDRTGIFAQENIDDLRQAG
1428   APA_14200   1518080   1518700   +   MTTAPNRAPDSSVLPVILNRWSPRAFLPEAISKEELLALIDAGRWAPS
1429   APA_14210   1520701   1519658   -   LAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPA
1430   APA_14220   1521096   1520680   -   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
1431   APA_14230   1521169   1521261   +   VRKERAEIKTELAKLEAQMDAYLKELGYAS
1432   APA_14240   1523113   1521728   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
1433   APA_14250   1523493   1524077   +   MEQLLTGKKRLPGFSEEWKILPFKKIAQLTKGSQLNRLDCVSNGIFPV
1434   APA_14260   1524107   1525906   +   MAPAPKFQEEYSAKLPALALLSTLGWRFLPPSEALALRGGKQSAVVL
1435   APA_14270   1527434   1526049   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
1436   APA_14280   1527537   1529072   +   MLACDSKLSAIRYKRYLDEVGLFESAIVMSPPDTREGHTEVDERKQP
1437   APA_14290   1529075   1529812   +   MGDKDHRILTYGDEHIRVELLPRARPGTTLRIKVHPDLTVQVVVPED
1438   APA_14300   1530008   1531318   +   MQPTNPEAFMLTALHPEVRSLVGQFAGGLMPIRLRTDEKYSLIIKTQK
1439   APA_14310   1531360   1531797   +   MTERSDQNDACVAATFAATASRALHPVIEIVGERRRAYDDAFRRRVV
1440   APA_14320   1531794   1532141   +   MIPLPSGLKIWLAAGATDMRLGMPGLALRVQQFLGRDPYAGDVFVF
1441   APA_14330   1532207   1533157   +   MTGSMDDITALRAALAAAETRARAAETRATDAEARAVSAEAQITHL
1442   APA_14340   1533161   1534600   +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
1443   APA_14350   1535969   1535142   -   MKRPAQRRELAAQAVAHHGVSIALACRILGISETCFRYRPRLAAEND
1444   APA_14360   1536229   1535966   -   MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
1451   APA_14430   1544575   1542062   -                                  uvrA
                                           MNTQLSASNPADMICVRGAREHNLKNVSVSVPRDKFVVMTGVSGSG
1452   APA_14440   1545953   1544697   -   MAAVASPTNTKRRTYAILIALVLGILCGLAVHDLFPAYISAAHQVAAL
1453   APA_14450   1546767   1546126   -   MDAQFWNMKWQKNQIGFHLAAVNPLLVKYFPVMGLKEGARVFVP
1454   APA_14460   1546892   1547536   +   MRKLYVYDHCPFCIKARMIFGIKNIPVELVVLQNDDEATPIGMIGQKM
1455   APA_14470   1548054   1549583   +   LAFTIQARTSPEPYFSTRFRSERPFGITRRIAVSQHIPHFGGISRQNDGC
1456   APA_14480   1549685   1550758   +                                  cbiD
                                           MAPNTHPLRRGWTTGSCATAAAKAAWLMLNGHSAPACVNITLPAG
1457   APA_14490   1551521   1550763   -   MTVHFIGAGPGAADLLTIRGRDILASCPVCLYAGSIVPPEMLQFCPPD
1458   APA_14500   1551896   1551522   -                                  cbiG
                                           MIFLGLGWNSRASLAQAQACIAQALAQQSGKKLSALAVPAFRHTENL
1459   APA_14510   1553137   1551893   -   MTEQPQHEPQTPWLTLIGIGEDGVEGLSAVARAILARADFVVGGARH
1460   APA_14520   1553226   1554029   +   MPSSSNNFRILVLGGTTEASALCRDLEKEPFISATLSLAGVTKQPHLPT
1461   APA_14530   1554757   1553999   -   MKGSVTIVGLGPGNSLQRTPQADQALAKATDLVGYGPYVNRVEAPP
1462   APA_14540   1555479   1554754   -   MTRGRLQVVGVGPGDPELMTVRAVRLVQAAKVVAYFCRHDRPGHA
1463   APA_14550   1556109   1555480   -                                  cobH
                                           MAAYEYIKDGAAIYERSFATIRAEADLSAFTPEEAQVVVRIIHACGMV
1464   APA_14560   1557328   1556096   -                                  cobG
                                           VTQRFTPPEVKGWCPGLFAPMQAKDGWLVRVRPAFGRITAAQAIFL
1465   APA_14570   1557498   1558037   +   MTIIPSSLIRLSLIAGLLCVGPSIYFTDAYANETIPQDTAAQATHALVKQ
1466   APA_14580   1559527   1558079   -   MSDNPQIRFCPVGIQATGVRQERDSMGTIDVPADKYWGAQTQRSLV
1467   APA_14590   1559856   1561790   +   MHDSIKNYHANNFIVKWYSIQRAHTVENMRKLLLTGSVLTCAILLSA
1468   APA_14600   1562765   1561797   -                                  fis
                                           MSLSDMVEPPAMNTRPFSQRIDSKAESPAETVQKSWIRCETSYQLDP
1469   APA_14610   1563784   1562891   -   MRLIEGGERLLSLVRFVMPTVIVCHVVPARAADITLGIIGPHEYDLPV
1470   APA_14620   1566328   1563872   -   MRESQARLFSLITSILLAIVGLFLFFGGAELLFLGGSWFYIIAGGVMLG
1471   APA_14630   1568165   1566669   -   MRQTLTDRSAFKFVLLSCCAAFLCETGTPTAHAQTSAPAQVQVGDIA
1472   APA_14640   1568616   1569959   +   MFLIRVPLLFILNLCTRNISFHSDMRNLHTIMVFDYKGSVFNNKGRND
1473   APA_14650   1571503   1570052   -   MKIRTDIVQMYRDIHSWVGILAGLFLFVAFYAGGISVFEVPLQNWLT
1474   APA_14660   1571847   1571500   -   MASLPHCCCCVKATLSIMRKYTYTSQNWFAKVTAAVVPGNILTFGL
1475   APA_14670   1572420   1572797   +   MSLIKKCIFPTLKATAIGLSAAWTAMAACSKDKELDGQEKSVHLATM
1476   APA_14680   1573953   1572871   -   MIPETSASEQKPELTTGTRPVLVALFACTLVLGAVWILEPFIPALIWAG
1477   APA_14690   1575827   1573953   -   MPRWVWLAGSVLAVSAVAAGVLVAGLPHYNLAHIASDKLSASLGR
1478   APA_14700   1577129   1575927   -   VQDVVVVFNSGSSSLKLTIYAFSGKVDPQVLLHGEIEEFPDHSQFTAK
1479   APA_14710   1578176   1577160   -   MNDINNILSSKAQISQYTQDTAEMPGSSVSTSHQAFEQLVSRAVQLPG
1480   APA_14720   1579195   1578185   -   MAMDMRTNYLGLELAHPVVASASPLTADLEGILRVADAGASAIVMA
1481   APA_14730   1582800   1579213   -   MENVMTEQLQTMDGNTSVAHIAYRVNEVCAIYPITPSSPMAELADTW
1482   APA_14740   1584556   1582802   -   MRVACVRPVQWLRGRGKAYMTIKLHDMTQVMQDTTRRGVGSSRW
1483   APA_14750   1584854   1585279   +   MQTDISAKRKHHLTFPKYLDFPVFLNANFRNDFLRKIFVFSVIIFNVHP
1484   APA_14760   1585498   1586172   +                                  tetR
                                           LTEHPQKPVTKAKPTTTRPKKSYRASQKREMTRAFKQDAFESAAWK
1485   APA_14770   1586772   1586182   -   MTGIFTLGILGLSLSVDAFAAAVGKGASAKNARWNDALCIGAVFGFF
1486   APA_14780   1587138   1587749   +   MIKLYYTPGACSLASHIILNETRLPFGLEKVNLKTKTLEDGRDYLKIN
1487   APA_14790   1588613   1587783   -                                  fdhD
                                           MTEDISFSVALPCDAERISWPQGHENTDITREHNTFLVAEEAPLALVY
1488   APA_14800   1589242   1588613   -   MKIAGLVLAGGKASRMHGQDKAFLDTGKGLCLDHVFARLQQECSA
1489   APA_14810   1589340   1589864   +   MMSQRTQLIFGIIGRSGSGKTHLISRLLPAFCHLGLRVSTIKHTHHGVD
1490   APA_14820   1591125   1589866   -                                  moeA
                                           MVGSLLASAVSEQTYRAPDMVAYDEAQALLAACMQNIPLLATEFVS
1491   APA_14830   1592053   1591133   -                                  fdhE
                                           MRSETDIVPLDKRTPGVQAIEPLIFPVLDAVYTRREKRLRLLAEQLGE
1492   APA_14840   1592706   1592053   -   MDTKNLVLRTKFMDRLCHWTMVACFFLVALSGISWFFPSLNWLGYV
1493   APA_14850   1593641   1592706   -   MSMQSQDIIRRSATNGLTPSPQARRHEQEVAKLIDVSLCTGCKGCQV
1494   APA_14860   1596704   1593651   -   MALGRREFLRNTGACVAGASAVALGFVPPVKALAQETRQYKLLRAK
1496   APA_14880   1597235   1598479   +   VRNPFFQKNFHFVTYLSCSLRVRAQNKKQYGLTPCLRTGQMDRPPSW
1497   APA_14890   1598476   1599267   +                                  ftsJ
                                           MTEKKNRPTGSSTLRVPGRARKSSATPGSRLVQNDSDAPQKMRAQS
1498   APA_14900   1600189   1599296   -   MSDYRLGIDIGGTKIEIVALDAEGQVVLRHRVGNPGTYKGLLSDVKK
1499   APA_14910   1600304   1600555   +                                  sirA
                                           MNETVLDARGLNCPLPVLKANRVLRTMQPGERLRILATDRASITDFQ
1500   APA_14920   1600627   1600881   +   MTDRNPRAMSDNIKSLSFEDALSELEKIVRGLEGGQLKLEDAITAYER
1501   APA_14930   1600883   1601821   +   MSMTNPTHPSINRASDNGALLKQDMGARARVIEHTIDTLLPLTTGGD
1502   APA_14940   1601826   1603814   +   MTNQPHTSPIPTLGRFPALDRVEYPADLRNLSVEQLKQVADELRAET
1503   APA_14950   1603821   1604558   +                                  hlyA
                                           MARRRVDQLLVDRGLVESHTKAQALIMAGLVFSGEKRVAKAGDQV
1504   APA_14960   1604696   1605277   +   MRKIAGLFGVACLAFTSSHALAAPVFHSASHASASAQNMQATEVGN
1505   APA_14970   1605399   1606625   +   MSSRTYTSTSADANSSALTDLNAEERSRILAKAALFSPPSATLSDGRR
1506   APA_14980   1606736   1607977   +   MGPTSARKDVKKVVLAYSGGLDTSVILRWLQNTYGCEVVTFTADLG
1507   APA_14990   1608023   1608520   +   MIRRFSLIPCMLAASLAVSLTACGSHKEEQELTPAQQMEKLRSAPGV
1508   APA_15000   1608581   1609045   +   MLSSRFAYRLLCGGMLLFVAACSPKSGSSLYGTNCGICHHGGDGMPG
1509   APA_15010   1609079   1610074   +   MQRIFSGIQPSGIPQLGNYLGAIRNWVNLQANYECIFCLVDMHAITVW
1510   APA_15020   1610819   1610088   -   MLLREKSQRSFQMNRQLGSSLAVVAGAVNVLGFLQFGYYCANMTG
1512   APA_15040   1612309   1611587   -   MTGARPILVVDDDQVIRRTLAEQLQLDGEFQVLEAATLAEARQKLKE
1513   APA_15050   1612456   1612971   +   MMIHVWPTVNSNMDAQLHCRHKSMSAIIGKNGVTHHKREGDLATP
1514   APA_15060   1614785   1612968   -   MTESVILFVFLVLGGGMLAQWTAWRFRLPAIVLLFSLGLLLGPGLQIM
1515   APA_15070   1616194   1614881   -                                  nol1
                                           MTPSARLAAAIDLLAAMEAAPRKPADAVANSFFRERRYMGGGDRRA
1516   APA_15080   1617682   1616204   -   MTSSPYSRVTEALAFDDVLVVPAASDVVPSQTTVRTHLTRSIELNIPL
1517   APA_15090   1617896   1619557   +   MKRVLPLLLGCMLSPVAAHAAEAPKTGGTLRILVSSAAGTLDPQISY
1518   APA_15100   1619554   1620573   +                                  oppC
                                           MTDPAPSPVQDTKPPGPWRMALRSLSHNRSALFSFAVLVFLAVASVL
1519   APA_15110   1620586   1621560   +                                  oppB
                                           MLMAALRRLGQTVFVLFGISALVFTVFFATPGADPTARIAGKNASPQ
1520   APA_15120   1621562   1622593   +                                  oppD
                                           MPPNTLLEVRDLRVSFPARGQMIPIVDGVSFALNHQEILGLVGESGSG
1521   APA_15130   1622590   1623570   +                                  oppF
                                           MKTSATSSPILEVRDLYKTYRLPRRQELKAVDGVSFSVMPGEVLGVV
1522   APA_15140   1624659   1623565   -                                  npd
                                           MPNDTFVEQLGLALPVIQAPMAGISTAEMVVAASNAGFLGSLGAGM
1523   APA_15150   1624808   1625578   +   MRFRNAFFYAASLSLASSLFGYTAQAQQFTLPDGRAFLPPPPQAEEPA
1524   APA_15160   1625615   1626445   +   MSCRLPALPFLLLLALAGCAQHSLLITSQAPAPLTIQAPYHGDFKHYT
1525   APA_15170   1626447   1627562   +   MHHSFPNKHGIRSLISAGITFSLLASFLGTIVPAKAEEPKIPVRVVVVT
1526   APA_15180   1627593   1630082   +   MTTRRNFLKYAFLSGAAGSAGMLPSAISRAFAISPDPGTTYQDAEHIV
1527   APA_15190   1630350   1632791   +   MPSCFRKSLVCTTLVGIAIPYAWEANIPTAKAETSTVKASQHTKAASK
1528   APA_15200   1633396   1632878   -   MLAGLTAFVVPAWAHRLDEYLQATVIDVSRQEIDVVLRLTPGVDVA
1529   APA_15210   1634616   1633420   -   MRKFFGIVGGLLSVMPAMAQTSAPPVSPALVRADESATAQQTHAVV
1530   APA_15220   1634775   1636424   +   MAPYYCVTFSAGFLMPYPQPLSALLTALPRRFSLCVTGATLAALMLP
1531   APA_15230   1637986   1636478   -                                  emrB
                                           VQSSSAAEPSSAYSPTTRILVFIGLIMTMIMGALDQSIVSTALPTIVSDL
1532   APA_15240   1638917   1638138   -   MTTQNVFSGAPNAPEIQRVRHELHRRSLEVVKVERLTPHMIRVTLAG
1533   APA_15250   1639571   1638948   -   MIMDDKIQAVLTLYHERMQQERSQPRVEAPGGRDGGHDQRMRSIGP
1534   APA_15260   1640193   1639603   -                                  padR
                                           MKHRHKHAGGRNRQVFSPEGTAGSGGKHRHQHGRGGGRRGGRSRL
1535   APA_15270   1640494   1642854   +   MKKFLILSTVCLFAQNTATVAKASSNPDKHKNHAPLAAKKSAKLPK
1536   APA_15280   1643402   1644478   +   MGLCVWAGLMQHVRISGKKPLGILIAVTCIGAATLLGVVVAHKSNK
1537   APA_15290   1644459   1646285   +   MVPPATDLPPQQGEQDRKNFPKLTLSRIWALVCNPAPGRLGYALRM
1538   APA_15300   1646282   1647907   +   MTHASFRLVACCAVMMLCGCATQELETAPSQPNTPWEPNLSANGEI
1539   APA_15310   1649537   1647930   -   VTTDSCKVLMIFPLFNASSFWNYKEACDLAGARYPAAPLGLITVAAL
1540   APA_15320   1650405   1649884   -   MKKMYFLVAALCVAAPAFAESLPERTGINSAMGIAPKTDDFIQGAVW
1541   APA_15330   1652968   1650692   -                                  fcuA
                                           MSFRVFCLNTLCVSSLLAGIGEGVFFPDYAQAEGVASSQKAVRAPLS
1542   APA_15340   1653988   1653170   -                                  mscS
                                           MIMENQVHSIWAQLSGLLPVLLGYVSQFVLALIVLFVGWKVVNAVT
1543   APA_15350   1655350   1654313   -   VAESNSPKTDVKTVKSRIAGFVMGKAGAGDASPNRIILLRDTSGNGT
1544   APA_15360   1655653   1655408   -   MKTWVYWSGVGVLSLAVISAAGWKLLLHPEAAVLPVASGFGPSPDL
1545   APA_15370   1656193   1655999   -   MTKLLRLAGLAVVLVVSLLFAVFVGDLGPWYFAWVIGTVMIILISGA
1546   APA_15380   1657346   1656207   -   MELYAILKIVWAVMLSVLFIGLGTMVGMDMGVGTLLRFVGRNDAE
1547   APA_15390   1658974   1657361   -   VEFIDPNVVDLSRFQFALTALYHFMFVPLTLGLTFMLAAMETVYVVT
1548   APA_15400   1660730   1659039   -                                  cydC
                                           MSTFSRLAVLMKPIQREMLVGLALAVLASLANFGLLFLSGWLLAAAA
1549   APA_15410   1662415   1660727   -                                  cydD
                                           MKVMMQSSGNKTLAGFTRRISLWLGVAVLLGGVGAVLLVLQLTVF
1550   APA_15420   1662517   1662705   +   MEKDIFENMIYMKMEYLRIWDSASINLHIFVNYFRDAISITETIGSTGI
1551   APA_15430   1663595   1662906   -   MALCIPSVLTDDELAYCRMKLEAAEWIDGRETAGAQSAKSKNNLQL
1552   APA_15440   1666136   1663698   -   MTDSSSSRQIPTSSLMFGLAMGWGTLSLLAGNASAASIAADEPSLKK
1553   APA_15450   1666850   1666287   -   MAAQAGYGPAHNMLGRCYYFGWGCAQNYQQAIAHYTLAAELNDD
1554   APA_15460   1667128   1667739   +   VVAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQGSP
1555   APA_15470   1669109   1668120   -   MRARLKQWAYAGSRVSVKKAFACFLASTGSFASAHADQWYTGSLV
1556   APA_15480   1670241   1669141   -   MVSVRGLPILAAILGVASVMPVFSHAEGASAPLAAHQQVSLPRVLVL
1557   APA_15490   1671947   1670358   -   MTLDYSKFRDLSPFELKDTLISLASSKADRVMLNAGRGNPNFLATLP
1558   APA_15500   1673664   1671973   -   LHAFTALLSGLFGACPEMALFLALVIGCWIGRFRFGSFQLGGVAGSLL
1559   APA_15510   1674378   1675514   +   MSSEDPDNRTLCIPYIAYRQNVFWKKQRIVVIPACNEENHIIPCLLALA
1560   APA_15520   1676744   1676013   -   MKVQQIIEHFSTLPMASFNTIAPGTSLILAPHSDDESLGCAGLIATAVR
1561   APA_15530   1677874   1676741   -   MLVLGTERVENDLFTFQMDLKNLFDRWKSVSPMPAENIFPIDLLNSL
1562   APA_15540   1679778   1678393   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
1563   APA_15550   1679875   1680183   +   MCATTRARALFTLASFIVRCASVFMALLTRFNVLFVCSAPCAGAMFT
1564   APA_15560   1682095   1680473   -   MIRLDTISKYNGHRVIFVDASAALQKGEKIGLVGPNGAGKTTLFRLIT
1565   APA_15570   1683206   1682262   -   MMKVAKLPDLRIHMKLRHFRLVEMLVATKSIRLAAERLNITPAAVSK
1566   APA_15580   1683453   1683650   +   MTGVTSGVLSIDGYVGGASTIPSGPSNSYYGATFSSVIIKSGGTWTGT
1567   APA_15590   1685178   1683793   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
1568   APA_15600   1685503   1687743   +   VVLQSGNSLVVSSGGTLNGTTTINAGATATFSAGAKESGVTLNGGTI
1569   APA_15610   1688221   1690734   +   MARPANITRPLFLGTTSVLCLLAEPVHAQNASSSLPKQHQTTGKKSPA
1570   APA_15620   1691904   1690834   -   MFTCVGYAASSATTPLAPFTFQRRDCGPLDVQIDITHCGICHSDIHTA
1571   APA_15630   1692056   1693495   +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
1572   APA_15640   1693945   1694409   +   MSRPPFPPFDIESATRKVRLAEDAWNSQNPEQVAQAYTVDSQWRNR
1573   APA_15650   1695021   1694518   -   MGLFFKPIKTLDDLFVHTLQDIYYAENQIVKNLPTMVETASDPELKA
1574   APA_15660   1695221   1695790   +   MISSNIILIRHAKKPEESQHEPGIDSNGREDPYSLSLEGWQQAKQLAEL
1575   APA_15670   1696468   1695755   -                                  mgtC
                                           MMVTLHWSDVVLRLVATLAAGIAFGLNRDEHGRPAGLRTTTLVCLA
1576   APA_15680   1697682   1696966   -   MTPDLTQPSTLPACPAAPLSVLLRRVVALTFVVAFVEVTVYMDVGR
1577   APA_15690   1698851   1697679   -   MMTETTAAKAKGPFDGLLVIDLTHVLNGPFGTTILTDLGARTIKVEP
1578   APA_15700   1698977   1698858   -   MINCVIDPHVGTESGHLSKLNPQSAVKAGTATSTTKAAK
1579   APA_15710   1699110   1700549   +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
1580   APA_15720   1702263   1700692   -   MTDQTAPSTLTDGFHLVIEALKLNNISTMFGVVGIPITDLARLSQAEG
1581   APA_15730   1703649   1702372   -   MALRLLILGGVQSVPSAAQLLAWYGADVIKIERVGVGDITRNQLRDI
1582   APA_15740   1704209   1704730   +   MLFYGTNLLMQGRFTINTITNISRLAFCVASIFLIILATLLIVSGTIGLVS
1583   APA_15750   1704849   1705562   +   MTEFSGKKVLVIGGSRGIGAAIVRHLTSDGASVRFTWAGSGSKSEELV
1584   APA_15760   1705625   1706257   +                                  tetR
                                           MARTGRPREFDRDKALDAALTLFWMQGYEPTSLNQLKACMGNISPA
1585   APA_15770   1706417   1707178   +   MNQKYVALITGANRGVGYSIAKHLIAAGIDVIGTYYTNEAEAQAAKT
1586   APA_15780   1707208   1707648   +   MIEVMASSVLNAPIASVWPLVRDFGSIGQWLPGVKSCRIEGNEPGDR
1587   APA_15790   1707746   1708192   +   MQHNGVYTEYIDKRTDYRMKIIRISAAIAIIASTSACTSTGDASIKHTT
1588   APA_15800   1708396   1709772   +   MNNQPVSDTQRRLVMLCAVLGIVLGGLDGAIANIALPTIAKDLSCSE
1589   APA_15810   1709955   1711622   +                                  mrsA
                                           MPSISPFAGKPVDPAHLVNIDALLDAYYTRKPDPAIATQRVAFGTSGH
1590   APA_15820   1712389   1711847   -   MMPHRSEKQKMLASDLYLASDPELQHDMAQCAQWLARYNNRNGN
1591   APA_15830   1713090   1712386   -   MLAVSEKTEKNCPPSMTRRTVIAAGAMAGGMALGGKAHAGNSSPW
1592   APA_15840   1714802   1713459   -   VGGTISLPGDSNGGLTISGLENGGTVSTVIDNWSGNGPGDSDSIDLAG
1593   APA_15850   1715801   1714974   -   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
1594   APA_15860   1716061   1715798   -   MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
1595   APA_15870   1717372   1716407   -                                  fecR
                                           MTERKTPAQAAAGWYLYLREDPDDEGLKNRFKEWLESDPAHKQAW
1596   APA_15880   1717829   1717527   -                                  rpoE
                                           VRKEGVENTAGSDFEAVTAEIADDQVSPEENVASREAMKRIVDAIAA
1597   APA_15890   1718658   1718533   -   MGLSEDLIRIFSGQIWGWGRKLDYDVLNDIGTDQSDPSASA
1598   APA_15900   1719561   1718857   -                                  duf125
                                           MGNNILNSQKETHATSRLGWLRAAVLGANDGILSTSSLIMGVASAHA
1599   APA_15910   1721047   1719695   -   MKNWSLATRIVSGVLCVVTLSLLALSIAVAGFTRYEITERLDNSLQEV
1600   APA_15920   1721715   1721044   -                                  kdpE
                                           MRILIVEDEHDLGAAVQERVRQDGHAVDWFMTLEDARAAVATVDY
1601   APA_15930   1724789   1721715   -   MARKYLEALLRARMLVLGGLALILAAGMMAVLELPVEAVPDISPKQ
1602   APA_15940   1725943   1724789   -                                  czcB
                                           MKGRILAYFAVCFCMSPLANAEDQILPSVVALDMAAIKNEGITVTFA
1603   APA_15950   1727175   1725940   -                                  czcC
                                           MREILLLSIVTFSFGIFSANAQNMPEKIDFHRAVNMAWAVDPVRTELQ
1604   APA_15960   1727664   1727194   -   MQRVIRYGLSILITLSLCGCVSYTETESICKGTEEGILLHIDGSYAGYPH
1611   APA_16030   1735354   1736484   +   MRILFPYIAQPHQTLHSLPIAMEIASRHPEAEVHLACTTQSHLDYVRS
1612   APA_16040   1736484   1738250   +   MNSMNPASAISLDETLQPVSTASGQPRRYGDFATFPEALDYAAQGEA
1613   APA_16050   1738382   1738633   +   MSETVESVSALIIQKLLANPKVPRDIDGNCKIMEDLAFDSLAVMNFVM
1614   APA_16060   1738640   1739854   +   MTSLFSKFEGTAGALGSVVAVGGRNPFAVVIEKPVSSTVGIIEGRETL
1615   APA_16070   1740813   1739860   -   MKGIRPGQKEIFTLTEQELHTPVSPLVTEFVHNLLGDAQPLGVLFYGS
1616   APA_16080   1741818   1740838   -   MSDRFALIYNPRSRRNLKADPKYLELAGKMLGPLFCSPRTHAALRQQ
1617   APA_16090   1741914   1742864   +   VGPYPVIGDVFFLSCVHIAHLSDPHLPLVGLPSLKEIRFKRILSLLSWQ
1618   APA_16100   1742861   1744060   +                                  yjgPQ
                                           MTARMLNVPFLRRIVASLRPGTLDRYLIAQVMPPFLVALSVVMIALIL
1619   APA_16110   1744057   1745151   +                                  yjgPQ
                                           MSQSSSMPRHVLLRYLSMALLTRVIFCGAVLVGLLEILALLEQTTPILQ
1620   APA_16120   1745148   1745936   +   MSGTLNNSSLKTGRSFDLGKMNLRQLWVAYLTYPTILLYFALVIASA
1621   APA_16130   1745933   1746739   +   MTASSQGITAFILAGSRPGKPDPVALAGGVSHKALLPIGGVPMLLRVI
1622   APA_16140   1747451   1746753   -   MSTPRLAVFDMDGTLLDSVPDLAACSRELLEICHLPPLTDTEVRTMIG
1623   APA_16150   1747534   1748910   +                                  glmU
                                           MPELGLPHALMTSISAPRPATAVLLAAGLGTRMKSSRPKAMQSLGGR
1624   APA_16160   1748910   1750733   +   MCGICGVVGRRHATPIVFEGLRRLEYRGYDSAGIATLVDGRVERRRA
1625   APA_16170   1752148   1750898   -   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
1626   APA_16180   1752469   1753032   +   MGAAARTGSGTTGSGIRNDFSGWHEHQGSPQSGGSPKKGASFEERD
1627   APA_16190   1753884   1753657   -   MRERIWDMGARPAIPAKRRDGPVACPKWAYRCRHLVENLWARLKE
1628   APA_16200   1754041   1755426   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVIVVKQADDILG
1629   APA_16210   1755889   1755569   -   MGAAARTGSGTTGSGIRNDFSGWHKHQGSPQSGGSPKKGASFEERD
1630   APA_16220   1756994   1756161   -   MSFLHLLFKHRFAKACAVGLLLGAGGVMATPFAGAVSAPQTVVRYF
1631   APA_16230   1757813   1757016   -   MSKSQDTVPALRRAVRILDMVKASSRPPLAADVARQLDLPRSTVHG
1632   APA_16240   1758086   1758574   +   MNLTCIYDFKLPALNGSTLDLSAYRGKPVLVVNTASKCGFTPQYEGL
1633   APA_16250   1759300   1758578   -                                 lolD
                                           MNNQLVLSLKHVRKAYRSGDEGVLPVLQDINFSLHAGEIVGLVAPSG
1634   APA_16260   1760540   1759293   -                                 lolCE
                                           MFGPFERAVAGRYLRARRGERFVSVIAIFSLVGIALGVATLIIVMAVM
1635   APA_16270   1761862   1760546   -   MRLSRSFLPTLKENPAEAQIVSHRLMLRAGLIRQTASGIYAWLPAGLK
1636   APA_16280   1763651   1762008   -   MTEQNGDLAFLPLGGTGEIGMNLNLYRLGDTWLAIDCGIGFSGNDTP
1637   APA_16290   1764470   1763661   -                                 baf
                                           VLLVIDAGNTNVVFAVHDGERWRGVWRITMQAQRTSDEYAVWLNA
1638   APA_16300   1765217   1764474   -   MKDQPSPWRLECFAELGSTSDFCLEQAREGADSGLAVLAYRQTQGR
1639   APA_16310   1766656   1765214   -   MSMTSFNWTIAVPEIVLALSGIVILVAGVLQRKGEGFFSSAMLSIAAF
1640   APA_16320   1768669   1766729   -   MQPDLNLFSAAVLTPLVGATVAGLGGRFMGDTLAKAVTLLCMGIAT
1641   APA_16330   1768999   1768676   -   MTSAIAPIGIGPYLFVSAALLVLGVFGIFLNRKNVIILLMSMELILLSAN
1642   APA_16340   1769727   1768996   -   MAGGWPMMAQLVFYVFATVLLFSAVMVISARNPVHSVLFLILAFFN
1643   APA_16350   1770234   1769746   -   MSALGNTLRSFLLKELVGGMSSTFRMMFRPKVTLNYPYEKGPLSPRF
1644   APA_16360   1771262   1770234   -   MGQFFYHTLAGQIILMLLETLAVLVPLLIAVAYLTLMERKVMAAMQ
1645   APA_16370   1773346   1771268   -   MVKVIVDGTPVDVPAGFSALQACEAAGKEIPRFCYHERLSVAGNCRM
1646   APA_16380   1774680   1773352   -   MLQDKDRIFTNLYGQDDWRLPAARKRGDWENTAAIIAKGRDAVVA
1647   APA_16390   1775333   1774692   -   MNTTWAPAEQPESFAFDDESEAEIVNVLKKYPEERKASAVMPLLYIA
1648   APA_16400   1776610   1775330   -   MTELKNTFIETADTVLRQDVPESLVPEKVAEEEPRKVVEIDSHALNFG
1649   APA_16410   1777269   1776610   -   VAELPVNPRQGRLEGRLSAMAFTFMATVPAVSYAAVEKGELVVRIE
1650   APA_16420   1777822   1777262   -   MTTNQQDAVLWNREALPPGPEQDAVVRGITGVLAEKGFVVANLDK
1651   APA_16430   1778206   1777841   -   MQSVLGDYAPVLVFGGMSVIIAAAMLGMALLSGHQKPYSEKLTAYE
1654   APA_16460   1779225   1778938   -   MEKPLNKQELVSAVAEAVDLPKAKAGEVVDAVFGAIEKALSTKQEV
1655   APA_16470   1781893   1779371   -                                 lon
                                           MADNEKPVKRRRRTATKTKPEVVAEATPQTTPVAEAAAEPEVQEAK
1656   APA_16480   1783357   1782092   -                                 clpX
                                           MNTKSGDSKNTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIR
1657   APA_16490   1784140   1783478   -                                 clpP
                                           MSGMRDRDPVEIFSNALVPMVVEQTSRGERAFDIYSRLLQERIIFLTG
1658   APA_16500   1785649   1784315   -   MQVTETLSEGLKRGFTVTVPAAEIASKRDARLKEVAANLNLPGFRPG
1660   APA_16520   1787339   1785864   -   MAAIYPSLLSVYSPDEMGKIDHISAQTVPVSVLMENAGRAVARAILR
1661   APA_16530   1787498   1787953   +   MPHSILWSLVLTLHLVSIILWIGGGAYAVIILRPSLRLLDATQRNSVHL
1662   APA_16540   1788133   1790043   +   LTAKTPASPRKTTTRSRKKTATPAPVSAADATEDTGTATEAPAEKAV
1663   APA_16550   1790052   1791350   +   VTETYDTDVLYLATQGDGAVRTPDGRMAYIPETLAGEHIRLTKDSEG
1664   APA_16560   1791672   1791304   -                                 hesB
                                           MSQKTAAAPIKRELPPLMRVSQAAADRLQHLYATAHAGQLLRISVST
1665   APA_16570   1792187   1791699   -   MPTSEDVHAPVLPEVEKEAKTAEASADVLHADHAPAGDEAGKVESW
1666   APA_16580   1792626   1792174   -                                 nifU
                                           VTQTVPDSDALYDRVIVERARAPQYAGKLEAPSVQGEGKNPMCGDK
1667   APA_16590   1793870   1792623   -                                 sufS
                                           MSHPSITDTSGLDVAAIRKQFPILSEKVHDRPLVFLDSAASAQKPDAV
1668   APA_16600   1795132   1793870   -                                 sufD
                                           MSGPLSSFAQRLNDVEGAERQAAIGALLRTGLPDRHVEAWKYTSLRP
1669   APA_16610   1795920   1795150   -                                 sufC
                                           MSQFLEISGLCARIDADGQEKQILRGVDLTIPPGEVHAIMGPNGCGKS
1670   APA_16620   1797424   1795934   -                                 sufB
                                           MPAVTETREAVEKLGQSTYKWGFETDIQMDLAPKGLNEDIVRLISAR
1671   APA_16630   1797892   1797428   -   MLKLSRLADYAIVILVKLGEQEGVVTSPTLAAITGVPEPTVAKVLKV
1672   APA_16640   1799380   1798016   -   MFCMQPAHALLGVFAHSAIEWVMTSHPHQDADFAARQTLRRYKNA
1673   APA_16650   1799485   1802283   +   MTMDNTSSPSRLDSILASATAHPDAGTAAEGTNPVMGIALRLGEALS
1674   APA_16660   1803357   1802332   -   MAQKRNGKTSKMPKLFECATDETAQKTRVNRRALMQLALGGMASG
1675   APA_16670   1805581   1803494   -   VSATSDLSKIRNIGITAHIDAGKTTTTERMLYYTGVSHKIGEVHEGNT
1676   APA_16680   1806116   1805811   -   MSRRCQITGKGVLTGNNVSHANNKSRRRFLPNLQDASLVSETLGSAV
1677   APA_16690   1806527   1806234   -   MTETAGQTPEAGPNMDVPEDLARCDMVIQHAIEHLRNEKYPPLAVA
1678   APA_16700   1808375   1806624   -                                 hlyB
                                           LLPYLWPQENRALRWRVVLVLVVMLGGELATLGIPLVYSRVVDRFT
1679   APA_16710   1808557   1809429   +   MSSDITPFLRHLEQCNTAIIPGKRAPFSLAGKVAGWITPELFDRLEKEG
1680   APA_16720   1812424   1809434   -   MTPDPIQEQNSPLMPTPSVEPAAAQQSDMTMLATLTPEMLSACLTRE
1681   APA_16730   1815084   1812430   -                                 mutS
                                           MTRISSKGATPAMAQWFTLKAENPEALLFFRMGDFYELFFDDATAA
1682   APA_16740   1817008   1815125   -   VIPMQMDTQVESALVLLAHGNAEQALRVLQSCLQQNPHHAGALHGM
1683   APA_16750   1817084   1818589   +   MNKAYLSLERHFARLSSLNDAIGILCWDKEVIMPSGAAERRAENLAM
1684   APA_16760   1818736   1819887   +   MKHSFLRSVLPRRTVCRAMLAAALFSPFMGHPAWAVHMPKVPELPA
1685   APA_16770   1819955   1821355   +   MRYISTRGNAPVLSFADVLLTGLAEDGGLYLPETWPEFSLPDWESLR
1686   APA_16780   1821422   1822687   +   MTDPINITRLPSGLTVVTERMERVETVSFGAYVATGTRHETAEENGV
1687   APA_16790   1822684   1824024   +                                  pmbA
                                           MTEQTLDRISDLVARARKAGADAADAVFVRSVAAGAGVRNGVTEE
1688   APA_16800   1824051   1825022   +                                  tim44
                                           VKPRILAPVLTAFLSIGLIAGPLALHADARPGQGGSMGSRGSRTWSAP
1689   APA_16810   1825109   1825300   +   MLLLEIVTACSVTLAICFGVFFLFWQKRKLAELEADLTHLRTQGIDISK
1690   APA_16820   1826478   1825510   -   MSDSVATASLEATAERRPRFKADQVGTRARDWIQLLKPRVISLVVFT
1691   APA_16830   1827731   1826475   -   MMVAHNQSQQNETSGNGMRVARKGNGTGAAYVVLAALAALAGGG
1692   APA_16840   1828685   1827888   -   MPLHKGAFVVRALCRRGRPFVALEEMSTSRQREDMSDVLQNYPSGG
1693   APA_16850   1828736   1828912   +   MFQILLAIVSLAIWASIFIYYFRDPIYEWLDNRFGKDTPLADLEATDKQ
1694   APA_16860   1829911   1828916   -   MASSLQVAVQMDPLEHVNIHGDSTFALMLEAQKRGHTLYVYEVNSL
1695   APA_16870   1831504   1830011   -   VIVKSANHTRGVWICLIALGLLTLLRLILAAWIPLSPDEAYYRLWALA
1696   APA_16880   1832619   1831501   -   MDHQAVSTETVVKGPDISVVVPCYNESANVAPLVKALEQALTGRRW
1697   APA_16890   1833134   1832619   -                                  asnC
                                           MPLVQDGSGNVTDLDAVDLRIVAELQNDGRMTNVELARRVGISAPP
1698   APA_16900   1833315   1834262   +   MAETITTDLLVIGAGPAGYTAAIYAARANLSPVLVAGLQPGGQLTITT
1699   APA_16910   1834379   1835260   +   VDWDKLRVFHAVAEAGSFTHAGDVLNLSQSAVSRQISALEDVLQVP
1700   APA_16920   1835720   1836226   +                                  mucR
                                           MECRYSHQIPIGFIMSENQDYSPLLDLVSEIVSAHVSNNQTDPALIPGM
1701   APA_16930   1836375   1836689   +   MTRSELITALMQKNPHLQLKEATRLVNIVFGTITSSLAEGSRVELRGF
1702   APA_16940   1837943   1836690   -   MVEIVLAHQVDLATWRAATRHYVQKQVLPESISWRVAGKGETPWK
1703   APA_16950   1839522   1837972   -                                  mviN
                                           MLKNFLTVGGWTMLSRVLGLVRDQLLAAFMGAGALQDAYQVAFRL
1704   APA_16960   1839697   1840869   +   MLKIKCYCGTRRRTHRNMPDSLPSQFLPDSPRCSLIKPSQRSRRGQEM
1708   APA_16984   1841868   1841050   -   MTDEAQTFSETGGESSSPTAENVSTNSAPSEKGPFAFRTISEVADELH
1711   APA_16990   1842181   1841861   -   METVTRASLIEQIYQQVGLSRKESSVLLEDVLETVMDALERGESVKIS
1712   APA_17000   1843234   1842254   -   MKERFMAKRSLLVGFGGFLPDRVVSNAELAERLETSDEWIKTRTGIT
1713   APA_17010   1844405   1843299   -                                  plsX
                                           MNKTEIPDNSLSEQDEVFSLAVDGMGGDGAPEVVVAGLAAAAERHR
1714   APA_17020   1844696   1844493   -   MAVPKKKTSPSRRGMRRSHEALNVEAFAECSNCGELKRPHHVCSHC
1715   APA_17030   1845416   1844862   -   MSEKPEFSRPMALRRIGGQETSVTVEATEQECAAIARRLGLPKITLFR
1716   APA_17040   1845663   1846220   +                                  smpA
                                           MKQPRQHKISRLRNTCGALAAVIALSGCAVFGPTPTPRGSLIEADDYN
1717   APA_17050   1847615   1846233   -                                  envZ
                                           MRRSGLKLFPSSFWKSRRVEKSMRRVLPRSLLARSLLIVLIPLLITQGI
1718   APA_17060   1848348   1847626   -                                  ompR
                                           MEHERESVEEDVAPHVIVVDDDPRLRRLLQRYLFEHGFRVSVAASAA
1719   APA_17070   1848859   1848338   -                                  marR
                                           MSLPHETAGADLLFLREEQLRLAQTLMFLASRDMAQAIEPVLEEDGL
1720   APA_17080   1849537   1848878   -   MSTGAGKISQAISLAVATLAAGIMPAPLERDPARDEILRKMAAVAGE
1721   APA_17090   1850065   1849541   -   MAVLAIARMGHPVLRQPAQEVPDPTAPDIQRLIADMRETLEESGGVG
1722   APA_17100   1850279   1850482   +   VHVLVRDNNVDQALKALKKKMQREGIFREMKLRRHFEKPSERKARE
1723   APA_17110   1851759   1850635   -   MMTAQNTAIKLLVLPGDGIGPEIMREVRHVIDWLESRRGLSFDITEDV
1724   APA_17120   1852398   1851775   -   MEKFTTLSAIAAALPEANIDTDKIIPARFLKTTQRTGLGKNAFDAMRY
1725   APA_17130   1853801   1852398   -   MGPRTLFDKIWDDHVVETLPDGTSILYIDRHLVHEVTSPQAFEGLRLA
1726   APA_17140   1854339   1853956   -   MNIIQQYEAAEIKRLTAERAVPEFEAGDTVRVSVKVQEGERTRLQAF
1727   APA_17150   1855106   1854354   -   MNWQATVLTLFPEMFPGPLGLSLAGRALEKGLWTCRTEDLRQHGLG
1728   APA_17160   1855645   1855103   -                                  rimM
                                           MCSNLILMGVVGKPHGVRGLVRVRAYAENPQTLEQCGALQDDQGR
1729   APA_17170   1856013   1855660   -   MSLKIRLARAGAKKRPYYHIVVADSRSPRDGRFIEKVGAYNPMLPSD
1730   APA_17180   1857479   1856076   -                                  srp54
                                           LFEALSGKLSGVFDGLAKQGALSEADVLEAMREVRLAMLDADVALP
1731   APA_17190   1858111   1857596   -   MKIKKTLLAAIVAAGVSVAGVSAHAEPGNGFNGNGFGPGIPGAGLNA
1732   APA_17200   1858982   1858215   -                                  atp12
                                           MKMASTEHNVSGNAPAGRKRFWKQADVVPEGQGFVVQLDGRSIRL
1733   APA_17210   1861135   1858979   -                                  asmA
                                           MRLKWKIGLLAGAAVLALGGGTIISATQDADWLKTRLADAVESSTG
1734   APA_17220   1862154   1861168   -   MSVVNRTVSEDEAGIRLDRYFRRHYPHLTQGALQKLCRTGQIRVEGK
1735   APA_17230   1863532   1862171   -   MAAEREPPIMGDDLFGLPPEQSQGRNADARKKPAPMQPLADRLRPQ
1736   APA_17240   1864332   1863637   -                                  lolA
                                           MLQMKETTFMKSIFRAILPAAMGLVLAGSQAYAQDDTGETAIPVASS
1737   APA_17250   1865256   1864339   -   VSVSSSHTDIRITGWIAHLPPALQAYALLARLDRPIGTWLLWLPGMW
1738   APA_17260   1865311   1866138   +   MPQSGNHLHLSAQTDPVTMVVTDASAHLPRLYNASEILGDAHTGLT
1739   APA_17270   1866207   1867616   +   MSNPGASDETPARTVAQLAEVLAQGCKPRDAWRIGTEHEKFGFLRP
1740   APA_17280   1869044   1867653   -   MTQLPTSQSAPVVDGLHGAARNMAMLAVALSVFLALLDYAIANVAL
1741   APA_17290   1869185   1869075   -   MAYKLACAVTAHTLAVQGGWQKQACVRSGFPEKAGM
1742   APA_17300   1870738   1869320   -                                  engA
                                           MRPPPPLPTGDMPVVVIAGRPNVGKSTLFNRLVGRRQALVADTPGVT
1743   APA_17310   1872149   1870752   -   MSSNKKSSATRRSGLSRRALLGGAALAPALAGCTMFESDRKPILAGH
1744   APA_17320   1872849   1872154   -   VAEDLFKEVDEEMQAERLRMAAKRYAGAGIGLIVAVLAGIGAWSW
1745   APA_17330   1873401   1873006   -   MIRKGFYLIAGLTAAQLCSSVAIPAQAADKMWTASACGAEPVAPSVE
1746   APA_17340   1873551   1874456   +   MRILFITATRLGDAVLSTGLLAYLHQRWPDARFTIACGPVAAGLFSAF
1747   APA_17350   1874453   1875514   +   MMDGTANRQNTQPLKVAHIMAGAPTGGAELFFERLCIAQAAAGLSV
1748   APA_17360   1875515   1877275   +   MCGIGGLIYTPGTQPCSESVLERMAQALGHRGPNGVHIARLGRADMV
1749   APA_17370   1877359   1878234   +   MPSPTHMTRLKNRTVLKLSGADRVRFLQGLVTADIAALEPGDATWS
1750   APA_17380   1878231   1878650   +   MTYIAPPAAELDAMLDVVKFDASGLVAAIAQQHDTGEVLMIAWMT
1751   APA_17390   1879844   1878657   -   MFSPSSSPLVWILAGEASGDVLGARLMHALRARVPNMRFAGVGGVR
1752   APA_17400   1880029   1881486   +   VTVKTYIHEWTDQPVRNVLAGMVGTFALIPEVIAFSYVAGVAPSVGL
1753   APA_17410   1882217   1881552   -   MKRLRCIKQWRAENPMPSPTSDQSRRFRLSPLTRQVLLYVLFMLPAV
1754   APA_17420   1882398   1883273   +   MTTQQTIGFIGFGAMASRMAAHLEKAGYATLAYTPSGKGGDGVTHF
1755   APA_17430   1884076   1883222   -   MNHAQVSRTSSHVRVREILGLMARQKHQPLVMEVQKAVQADPDRA
1756   APA_17440   1884272   1884880   +                                 sod
                                           MAFELPALPFAPTALAPRGMCPETLEYHHGKHHLAYVNTLNKLLED
1757   APA_17450   1885137   1887752   +                                 clpB
                                           MDIAKFTDRSRGFLQAAQTIALRDFNQQLTPEHLLKAMLDDNEGAAS
1758   APA_17460   1887842   1888474   +   MSEPVWLVWAREIQAIAQTGLTYVQDPFDKERYEMLRNLAAQMMA
1759   APA_17470   1889881   1888535   -                                 hflX
                                           MRRQTGTFLLATSFSEKKKKVATRAAVILPWERSAHGQDVRAAEAR
1760   APA_17480   1890119   1889835   -                                 hfq
                                           VEKESAYNVQDAFLNQIRRSRAAVTVFLVNGVKLQGFITWFDDEVV
1761   APA_17490   1891587   1890196   -                                 ntrX
                                           MAHEILIVDDEPDIRMLIEGILSDEGYETRVAASADTALAAFRARRPS
1762   APA_17500   1893841   1891577   -                                 ntrY
                                           MKQFLFSLRHLLSRTRLHWLLRSLERKTVAITLAALALCLGFATFVVL
1763   APA_17510   1895293   1893851   -                                 ntrC
                                           MTPLPTILVADDDRSIRTVLGQALGRAGYQVQTTPSVNTLWQWVQE
1764   APA_17520   1896459   1895350   -                                 ntrB
                                           VKPKAAHGANQPDAALVLDSLPVPVLEIGPQNTILAANMAAEEFFGM
1765   APA_17530   1897526   1896456   -                                 nifR3
                                           VHTQPTLRPINLGGIVLDTPVILAPMSGVTDLPFRRLARKLGAGLVVS
1766   APA_17540   1898765   1897611   -                                 ispDF
                                           MRVAAILLAAGTGSRYAATTGSSIPKQYVLLAGQPVIRHAAQALLPH
1767   APA_17550   1899801   1898827   -   LPSGFSPAFSVVVPCYNEQEVLPIFHQRLSAVMEGIGAPWEVVYVND
1768   APA_17560   1900080   1901906   +   MATQEILKENVKGAPMVLQNIIFPALQSVIPEELYFRALNEKVELFRA
1769   APA_17570   1904155   1901981   -   MSRNNSFVKNGFLAVFYALLVSCFVVGICEVRFPSFFTIDDSQNEYLG
1770   APA_17580   1904276   1904157   -   MQYICVGVFLCAFVKFIQFLLINLVLSVEKEKGIPFFLV
1771   APA_17590   1905461   1904310   -   MTFCVVGAGFSGAVIARHLAERGHKVVVVDERAHIGGNCYTERDTE
1772   APA_17600   1907375   1905600   -   MLTVLHRLILPTEGLEQCDAMYARPALPERVVEASPQAFRLKAGQAF
1774   APA_17620   1907881   1907576   -   MPARIYRQSKPAGQSGLAGTREWVFEYGQSAPHKQSALMGWTGSA
1776   APA_17640   1908526   1908044   -   MAVNYATVTWDQLHRDARALAEALMPKMPIKGIVAVTRGGLIPAAI
1777   APA_17650   1909971   1908586   -   MKRIWMDVEDLFAFAQAGARLTGIQRVVLEICAAFMADPHMADHV
1778   APA_17660   1910056   1910724   +   MIIEGCMTSHAVTPLPPLVLDHPLIKHKLTHLRRAETSTAGFRRLVRE
1779   APA_17670   1910764   1911015   +   MKLKSATVLAGLLLALTACHEQPASDSTPLFHDKAHQKAPPPIIEDED
1780   APA_17680   1911352   1911107   -   MSLSERIVFQPFVWRGTKLEGGAAILCRNPEDAHRRIEKVRAGILSVA
1781   APA_17690   1912831   1911491   -   MGELLVRIAMIGGGYVGLVSGACFAEFGLHVAVVETNPDRLSALREG
1782   APA_17700   1913117   1914334   +   MKVQRAHVVKLYPDAGQEEFLRQIGGATRFLWNLALYQRQIWGKR
1783   APA_17710   1914465   1914803   +   MKLVTAIIKPFKLDDVREALAPLGIQGLTVSEVKGFGRQRGQTEIYRG
1784   APA_17720   1915757   1914888   -   MDAATHDGAQAAVKASHFDEDSSICAPQLNVLWQQMTQQACVCHD
1785   APA_17730   1917010   1915760   -                                 ubiHF
                                           MHQTAHAEHAAAAHAQMPISDVDVCIIGAGPVGGTLACHLAQAGIK
1786   APA_17740   1917368   1917943   +   MMESMGLPLPAETCIITAALYSLKTHHLGIEGITAAAVLGAIIGDNLG
1787   APA_17750   1918059   1918571   +   MRWFRSRLICRLLGHKWSLWQRENSWGNKTEFLHRHCLRHGCLAT
1788   APA_17760   1918764   1919321   +   MALPSLIVTNLSRAKRLKRRGFNAVLTLEDPACLQRHQLRFHKKPAP
1789   APA_17770   1919449   1919327   -   MTTSYQTGFTKETPSLYFCNKAIWRYSYFFCHISCLLYDM
1790   APA_17780   1920158   1920538   +   MTEQSIDAGVPFRWVATNSIYGVSDEKHTLRHAGISYVLAIKGNHWF
1791   APA_17790   1922817   1922975   +   MYTSKKMFQIHGMDAEKRGVLSWRLSRHQMIGFFEKLLPTMISIEAC
1793   APA_17810   1923760   1924326   +   MKQQANLIRAGQVIEHDGRRWTVLKQQIITPGKGGAFIQVEMRDLK
1794   APA_17820   1924372   1925199   +   MRLSPVMMVMQTAAQKAAKRLLRDFNEVEQLQVSIKGPGDFVSQA
1795   APA_17830   1925311   1928289   +   MDHLVFIMQTSFPSAYDAPALVAYKGAYSLLTEDGEVLHLSAQDVR
1796   APA_17840   1928511   1928308   -   MPTGTVKWFNATKGYGFIAPDDGGKDVFVHITAVQAAGLRGLNDG
1797   APA_17850   1929323   1928655   -   MGHITTLQAADGHEFSAWETEGSHHPYTLVVLQEIFGVNHHIRQVCE
1798   APA_17860   1929456   1929827   +                                 groES
                                           MLRATKRMGLLSVKGTIPKMNVERSIMTKFRPLHDRVVVRRLEGEQ
1799   APA_17870   1929881   1931521   +                                 groEL
                                           MAAKDVKFGADARQRMLRGVDILADAVKVTLGPKGRNVVLDKSFG
1800   APA_17880   1931816   1934020   +                                 fkbH
                                           MTETKNFVGQSHVLSPPLTTGTWSFGPLNEPFLTNSLVLSPSGKIEGY
1801   APA_17890   1934262   1934621   +   MAQEILIGVERRRRWSDERKLAILAEVGVDGASVSDVARRHDLTRQH
1802   APA_17900   1934618   1934965   +   MIGVGNGVRVYLACGVTDMRKGISGLAALAQDVLRQNPTSGALFAF
1803   APA_17910   1935029   1936639   +   MTHAPAVLPDDPDILREMIVSLQTEVARLSASARAYEALVQSLKIRIA
1804   APA_17920   1937907   1936828   -   MKQSGFFDVEERLARLSGLGDQLEAFSRTVDFEAFRPDLEQALAYSD
1805   APA_17930   1938062   1939876   +   MTDFPEKCLRKIPFVLLTEDNKSSVAQREHFFEYQEFAFENYYDLKN
1807   APA_17940   1940842   1940015   -   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
1808   APA_17950   1941102   1940839   -   MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
1809   APA_17960   1941319   1942704   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
1810   APA_17970   1943506   1942847   -   VGLVTNLKHFPQTVDFEVFRPELNKALAYSDGSKGECPPFDPVLMFK
1811   APA_17980   1944536   1943805   -   MIVIPMAGLSRRFTEAGYKLPKYMLPVGKKTVFSLAVGSFEKYFTSE
1812   APA_17990   1946134   1944551   -   MTSFSLILSGAYVDQELAIEFGYIPPSFLPIGVTRLYETQINTLAQLGDV
1813   APA_18000   1946563   1946150   -   VIKCRKLTEALGNVKRLIIDLDDTLTITDASKSYPEKEPNRPLVQQLRR
1814   APA_18010   1947676   1948071   +   MRRYGLRNDQWERIKDLLPGREGYVGGIAADNRLFVEAVLYRYRAG
1815   APA_18020   1948068   1949507   +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
1816   APA_18030   1949713   1950099   +   LTTKIHAICDALGNPVEFGITSGQDADITQAEPLLENIDPNAFLADKAY
1817   APA_18040   1950878   1950423   -   MHHAFSRDENGFIVQNWKDEIPEVCKKYKYLGDRMRNSVLTSPNPIF
1818   APA_18050   1952347   1953732   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
1820   APA_18060   1956399   1954711   -   MTNSYLLSYHGFFLEYDADVGIYEQSIISSTKSINRFFCANLDSKEEVL
1821   APA_18070   1957289   1956426   -   MKGILLAGGSGTRLYPMTLAASKQLLPVYDKPMVYYPLSTLMLAGI
1822   APA_18080   1958374   1957316   -   MRILLTGGCGFIGSAVIRHIIHNTSHSVLNVDCMTYAASPEAVEDAPE
1823   APA_18090   1959426   1959797   +   MRRYSLRDDQWERIKDLLPGREGYVGGTAADNRLFVEAVLYRYRAG
1824   APA_18100   1959794   1960003   +   LTTKIHAICDALGNPVELGITPGQDADITQAEPLLENIDPEAFLADKAY
1825   APA_18110   1961189   1960146   -   LAGKSTLNRLERSGQQADRYCRIIADHEALATLFVTLFLDQHEHAPA
1826   APA_18120   1961530   1961168   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
1827   APA_18130   1961907   1963157   +   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
1828   APA_18140   1964570   1964442   -   MLAYAVMASVRYQANSLKPKKTQLRTRQSLSAGPFRRSGASS
1829   APA_18150   1966278   1964839   -   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
1830   APA_18160   1967809   1966508   -   MSSDGGVILVKQADDILGLSRRFAACFRDKRHPGFVEYRVEDLVRQR
1831   APA_18170   1969030   1967951   -   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
1832   APA_18180   1969704   1971194   +   MFLFRKILKIFTFCAILVLTASNFSFCQNIPEKSKHLNNGENYSPDMFP
1833   APA_18190   1971420   1972079   +   MGLVTNLKHFPQTVDFEVFRPELNKALAYSDGSKGECPPFDPVLMFK
1834   APA_18200   1973661   1972222   -   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
1835   APA_18210   1973746   1973859   +   MSGQILDATLVAAPKQRNTNGEKEDLREGRIPRNRPF
1836   APA_18220   1975480   1973870   -   MTHAPAVLPDDPDILREMIVSLQTEVARLSASARAYEALVQSLKIRIA
1837   APA_18230   1975891   1975544   -   MIGVGNGVRVYLACGVTDMRKGISGLAALAQDVLRQNPTSGALFAF
1838   APA_18240   1976247   1975888   -   MAQEILIGVERRRRWSDERKLAILAEVGVDGASVSDVARRHDLTRQH
1839   APA_18250   1976661   1976924   +   MEKHGFVSKVHRKKPHLKPMPRHIQKSNAGKSVIRSRVEHVFADQE
1840   APA_18260   1978688   1977297   -   MFSPTVRPEHLRQFHKACSSGKAKVMIMGDSIGAVATDPAESENYTY
1841   APA_18270   1980218   1978755   -   MRKVYDCFAFFNELDILDIRLRELNDVVDYFVICESALTFSGDQKPKY
1842   APA_18280   1980909   1982360   +                                  amtB
                                           LRCSSSRHSGERINMFVRPHPSARVSSKPCIPKSRLALSTCAITLGLGL
1843   APA_18290   1982496   1983026   +   MGVKNGIGSFFDSPLCMRFYFMNFSARTGLAALLLGCATALAAPSAH
1844   APA_18300   1984015   1983080   -   MKRQIIACTLIIGGGASVSLGGISAAYAADGCHKLVARVALRNDQGF
1845   APA_18310   1984998   1984012   -   MQNKEHTGMIQALRAPWPEIEPYAHGYLDTGEGHQIYWEQCGNPDG
1846   APA_18320   1985953   1985006   -                                  xerC
                                           MTAEEAVQKFLEWMAVEKQASPLTIEAYQGDLARFLGFMTTHLDGL
1847   APA_18330   1986037   1988307   +   MAQKPFPNIPMPDSGNLTASACSTTRISVLLPMPFAGPFDYRAPVDM
1848   APA_18340   1988700   1988335   -                                  yajC
                                           LMSNFLIPAAYAQSAGGAGGGSSLMSFLPFVAVFAIMYFLLIRPQQKQ
1849   APA_18350   1988848   1989717   +   MDTPTLPVLERIASALERLSPPPATLEGVDTADAFVWLPERGRLLPVP
1850   APA_18360   1989834   1990952   +   MDQTAQTDSSTQELAVEARKGKIDLRRVRSNPDYWYPVAWSRELKP
1851   APA_18370   1990945   1991937   +   MPDTAPTELEAPPYHLRPLCAQDAPALHHLVNDWEVVRMLSRLPFP
1852   APA_18380   1993482   1991983   -   LDEYFKNLMDLCMSGKKETATSVHVANAQEVVPVILSGGSGSRLWP
1853   APA_18390   1993767   1994975   +   MSDNKIAFSEAWRPATRQLHAGVERTEYGETSEAVFLTSGFVYDNA
1854   APA_18400   1995096   1995566   +                                  apaG
                                           MPDWATSPLLQDPEEAMNELFSSLPVYEAVTENVRVQVQVFWLPDQ
1855   APA_18410   1995610   1996221   +   MSVPPSDTSQRPTQAEAEQAVRTLLRWAGDNPDREGLHDTPARVAR
1856   APA_18420   1996863   1996285   -                                  pfpI
                                           MTDDVKLLMLAGDYVEDYEIMVPYQALLMVGYKVDVICPGKKAGD
1857   APA_18430   1997494   1996856   -   MDFLYKNRPLLRPYGAVLHQNYGDKILSMSKIDTNLPFLPVRIAVLTV
1858   APA_18440   1997629   1999095   +   MIKRLYLHFPFRALWPTCLLVLSLFVVLPAHAQLLTGGNSAVGLWPS
1859   APA_18450   2001784   1999079   -   VILTDIQLECVRRFTSPVRLEGLGKGLNVLAAPNEAGKSTLLMALRAA
1860   APA_18460   2002929   2001781   -   MKFIHTSDWQIGKTFSFADDDTLGALQAARVDVVRNIGALARQEGA
1861   APA_18470   2003243   2005327   +   MTTETPAAFRMGSWKTLFLPLPRSIFAHGWFLFCLRTWLSAVLALST
1862   APA_18480   2005329   2005529   +   MELRPVLDIGGLLVSSFVVHAGLAIATLLALNPVLSKVRARRVVWNL
1863   APA_18490   2005545   2006507   +   VFERARRVLQFITTGTILAIAAVVCFVLWDYYTAAPWTRNGQVRVQ
1864   APA_18500   2006550   2007314   +   MLYSFFRSEVCAATALCLAIFLPSVACGAEKNQSPTLNIAAPCLKSLH
1865   APA_18510   2007416   2007652   +   MSDTLPDRLSVNPESPFYNEDLLARGIGVRFKGVEKTNVEEYCISEGW
1866   APA_18520   2007754   2009013   +   MTQTENSTTPDLRYTVVVVGGGSAGIAVAARLLRERSTLDIAIIDPAT
1867   APA_18530   2011747   2009117   -   LGCDYFGILSFIMLFAPIGRFITFCARHAWAVVALFLVLSGAGVYAGM
1868   APA_18540   2012836   2011826   -   MKRVTLIAGIFGLGLTLWMLAQFGVSSIFSLVMTGGWGILAAIAFHSV
1869   APA_18550   2013391   2012906   -   MGTRSPVSLPDLKALSPAPRLAIIVSRFNEVVTGGLRDGAIAWLAEHN
1870   APA_18560   2014741   2013428   -   VAAKASARLLQAVEAVRAGRMVIMVDDEDRENEGDLVMAAEFMTP
1871   APA_18570   2015325   2014756   -   VAKAERSPQSLMLEVETGLHDVAEGESIAVNGVCLTAVEPSTTGLVR
1872   APA_18580   2016392   2015340   -                                  ribD
                                           VNSFSQISRQIMPERIGAAFHLAVAEAWSFVGRTAPNPPVGCVLLDAQ
1873   APA_18590   2016869   2018287   +   VRFASYVGRRNDFNLHALHISSEPWIPHIAFGYALPFLTATAEYGALS
1874   APA_18600   2018287   2019060   +   MRKHVFAGSLLATVTLATPVLANTPNKAPPHQKWSFEGATGTYDKA
1875   APA_18610   2019079   2019717   +   MTRETEETAATEQAPGRRDFLGIVTTAGTVTGLAACAVPFVQSLKPQ
1876   APA_18620   2019902   2020453   +   MSDIMVVYHSGFGHTRRVAEYVAKGANGTLLEIDQNGDLPESSWEA
1877   APA_18630   2020496   2021083   +   MLAIPFSASPSNAKTPPVSTANGDVMAVSWGDFQAIIQLSAGLNVAIL
1878   APA_18640   2021213   2022529   +   MTTLPKKQKVLLLLSASSLLLPALHKTAHAQVLPFTSLKTSSSSLGRW
1879   APA_18650   2023936   2022578   -   MRYLWSGMRTCLDRAFDISGRGSSIPKEVVAGITTFGAMAYIMAVNP
1880   APA_18660   2024162   2024404   +   MTDKAPHETSSLFHLAERALKQPKLATKEEVRELANYVLKGGVKAG
1881   APA_18670   2024506   2025210   +   MNLKKLLLVAMLIWATPVMASSAPQTVDDAYPYVDAASILLTNDIK
1882   APA_18680   2026218   2025262   -   MPKSVVNPELLPILEKMPSFDGLSSLSLPEVREVFLTSVRLIEGRPLPD
1883   APA_18690   2030480   2026572   -   VADNNVSSGVVVSSGDSITILNTVVGLTVQSGGSVANLGNVSSVTDQ
1884   APA_18700   2031266   2031943   +   MSKLPPNQLTVRKIASLKDGVYGDGGNLWITIRGETRAWTFRYKSPL
1885   APA_18710   2032826   2033059   +   MSALSTLLDTFRHMAVTESEKGTYFEELVVCYLRTEPSYVDLYDKVW
1886   APA_18720   2033063   2034502   +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
1887   APA_18730   2034824   2034645   -   MGEPAFAGSGEEGVDILLGYLMLWRVELALDGVKIACSPFSGDKVD
1891   APA_18746   2034834   2038922   +   VATTNHWNSNAEDTLANQHPPVSKIDLLDLETSIIDWSQYQPKQKPV
1893   APA_18748   2039077   2039766   +   MFSDVSLRNGGKIMNTSQGSLFEQTPSQPRLVQREAITDEGLKHFQD
1894   APA_18750   2041668   2039827   -   MTSRQPSIKTPKFRKRHINQRFFDPSALELCSLNSCLFEKIIIIYFTEIFK
1895   APA_18760   2042960   2042358   -   MNKYNVIVEGETDSFYISKVLSIISKSAQCSEVFPILSSGDVSFLDQGG
1896   APA_18770   2043937   2043110   -   MKRPAQRRELAAQAVAHHGVSIALACRILGISETCFRYRPRLAAEND
1897   APA_18780   2044239   2043934   -   LNENFLSVRIEEILMKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISN
1898   APA_18790   2044632   2045279   +   VCPFWIIVMINDHFNNTLPNWVSRNFFREEDLDRYAALSKELLITPTQ
1900   APA_18810   2046295   2046648   +   MVPRESRDRKRQFMYAVIRTGGKQYRVEPNMVLKVEKLEVEAGAT
1901   APA_18820   2046695   2046964   +   MAQKKAGGSSRNGRDSAGRRLGVKKFGGEQVIAGNIIVRQRGTKVK
1902   APA_18830   2047073   2048092   +                                  obgE
                                           MKFLDQAKIYVRSGDGGDGVTAFRREKYIEFGGPDGGNGGRGGDIIF
1903   APA_18840   2048147   2049274   +   MTGYTSPSLTNAKRLVVKIGSALVVDPEKQAPRQEWLASVAADIAY
1904   APA_18850   2049931   2049278   -   MMSLSFPDWMPVWGQLLVLAFGVLFGLAFMMMPFAVFGVKGRLG
1905   APA_18860   2050227   2049955   -   MDGERISGDEDAAVGGIAADRLRSIIERVERLEEERKALAGDIKDIFTE
1906   APA_18870   2050323   2051957   +   VYVVNDAAHQNPLQTRGRPSISTAPCSCSGPFARKPRLFYGGHPPPAD
1907   APA_18880   2051954   2052400   +   MNTSSPKMTGRGPFAKRTLRQHILRRLAIVLPLSLMMILLAKTGTLDR
1908   APA_18890   2053475   2052417   -   MTMQKIAGNQVAMSDFSDVPQNSMPARPNLPSRLLLRCIRWQEQLK
1909   APA_18900   2054099   2054737   +                                  mraZ
                                           MAVFCCFFCHFNLRPITSHAIPYQTTSVVKAVLFPAELRTERLFLQRLL
1910   APA_18910   2054734   2055741   +                                  mraW
                                           MNALSSFSHPETAQGHIPVMLAEVLEYLHPADGERILDCTFGGGGYS
1911   APA_18920   2055746   2056735   +   MIPRPFTCCCAVLAIASGFFLYTKKHQTTLLDQQISQIVKETEHVRTQ
1912   APA_18930   2056768   2058786   +                                  ftsI
                                           MSVSPNDPDSTRTVGVTGDDLRARAHRDQMHVRLLGVAGGFCLIFA
1913   APA_18940   2058783   2060252   +   MSLPLSTLLAAVGLPILPENPEISAITADSRQIKPGTIFAALPGVKTDGR
1914   APA_18950   2060249   2061634   +   MSLLWTREELETATGGTFLGNTSVSVTGISIDTRTLTHGDLFIALKGD
1915   APA_18960   2061634   2062728   +   MLYMLISHAAHDGHITILNLLRYITFRAGCACMTALGISLLLGRPLIRT
1916   APA_18970   2062725   2064140   +   MNGFSPSLFSGQRFAVFGLGKNGLPAVLMLTSTGATVQVWDDGEAG
1917   APA_18980   2064148   2065311   +                                  ftsW
                                           MAGSSRTDDSPFGRWWRNVDRTTLICTFILIGFGYILMLAASPAVAV
1918   APA_18990   2065308   2066456   +   MSSRTIVIAAGGTGGHFFPAEALADTLAERGHHLVLMTDGRAGKRES
1919   APA_19000   2066453   2067886   +   MRALPLSIGTIHFVGIGGIGMSGIAEVLCLLGYSVQGSDIAENANVKR
1920   APA_19010   2067883   2068827   +   MNNPASMQDMVKHAFANMRGRLTPQAPLGPRTWFRVGGAAEWLF
1921   APA_19020   2068824   2069762   +   MNAPKRVTVLMGGMSSERVVSLSSGQGVAEALRSKGYDVCTLDAQ
1922   APA_19030   2069759   2070721   +                                  ftsQ
                                           MRVPPSPADRPSRIGLFLRRQKRLLRPIAGLLFLAGLGSAGYVSLKIPA
1923   APA_19040   2070714   2072150   +                                  ftsA
                                           MSDPTRSPASSGFSLSDRLHKKRTTAATGSSLLMSGGESSLPLPPSEK
1924   APA_19050   2072237   2073751   +                                  ftsZ
                                           MTLNLTVPPQTHADFSPKITVIGVGGGGTNAVDNMIASNLQGVDFVV
1925   APA_19060   2073905   2074885   +   MDGLLREPLLYSDIVESPASFMRSVRKTPSALQHTLRHAISCTGTGLH
1926   APA_19070   2074982   2076019   +   MSDICIKPQLLRHVLPRVLSVALLTSLAGCGLFNENKKLPPAPKIAAP
1927   APA_19080   2076126   2077910   +                                  recN
                                           LPSFLSFGRKPGKPDAIMLTSLSIRDVVLIETLDLSLHAGFTALTGETG
1928   APA_19090   2077933   2079990   +                                  ligA
                                           MTQQQAREELERLAAEIAHHNAAYYRNDAPEISDAEYDALRRRYDA
1929   APA_19100   2080214   2082889   +   MTKWIYSFGAGQSEGNAGMRNLLGGKGANLAEMANIGLPVPPGFTI
1930   APA_19110   2082940   2083764   +   MQKKITLHLVSEATGQTLDSVARACIAQFPNTEVHLRHWNLIRTQLQ
1931   APA_19120   2084274   2083816   -   MGTMTFRCCQTMYLSAVEQKKESSSMMPVLRKKWLVVAGICAVAL
1932   APA_19130   2084447   2085046   +   MTETLLSPFTLERDIKKSRFLASATPINSIEEAEAFISRIAAAGPDATHH
1933   APA_19140   2085447   2085043   -   MAQLRKPFVTVLSGICVGFGLMAGISAAYADPALMPDDNVSFAEGSG
1934   APA_19150   2085739   2087118   +   MSATLTQPNPTSATWMPDSWRSFPVKQIPSYPDQAALKTVEDRLSSY
1935   APA_19160   2087199   2088446   +   LFPSSLQPQWQKEQIRMTHSFSKPSAGVCSARTAAPLSDAEIRARTDS
1936   APA_19170   2088443   2088862   +   MTEKNDTEDKTWKVRILDLSGGAEDNIVEDVGVFHDLAHANAFARA
1937   APA_19180   2088919   2090247   +   MKLRFAPSPTGLLHVGNARQALANALYARRHGGQFQLRIDDTDIGRS
1938   APA_19190   2090260   2090889   +   MPLQSAPFPLAFIPGKTDALIVVDVQNDFLPDGALPVPKGHAIVPVIN
1939   APA_19200   2090924   2092228   +   MRNSLSRRRFGLCCAGMGISALAGPPVVARATSIPELMEREPPMLETL
1940   APA_19210   2094606   2092234   -   MSQTISFPVEGMSCAACATRLEKVLNRLEGVQASVNFATAKAQVDL
1941   APA_19220   2095130   2094837   -   VVLVGDLLCNLAEREHSCATGALAFATRLHAQACKAEAQKARMQSS
1942   APA_19230   2095195   2096940   +                                  copA
                                           VQHDAEWTIPMHIPPVLKGRNVSRRQFITGGSALAALYALKPPKQVF
1943   APA_19240   2096937   2097932   +                                  copB
                                           MKTCLYHPYISRFLLLGVSALLMASVVTQQAKAASMNHAAMEGMD
1944   APA_19250   2099041   2098016   -   MAMRVYYDRDADVNLIKSKKVAIIGYGSQGHAHANNLKDSGVKEV
1945   APA_19260   2099613   2099095   -   MQQEISGSAVISLLVDNESGALARIVELFSGRGYNIQSLTVAPVDENQ
1946   APA_19270   2101532   2099682   -   MPPVPFPGREDDMTLQAASAPSDARNTPALSGAEVLMRALAEQGVE
1947   APA_19280   2102560   2101547   -   MRQAEHHMGRLADASANLPAALIVAGPTCSGKSALALALARRLNGE
1948   APA_19290   2102591   2103481   +   MTSLVLTLVAQREATTLDSATIALVRDILATNAEATVLSAGEAVDIPC
1949   APA_19300   2103518   2103712   +   MQFDPRDISTYPIVRTICVIVGCGLVAYCFAFYLNLPPDTPEHVMRHV
1950   APA_19310   2104768   2103737   -   MARADYAGTSEGSNMSSCGTQAGVAAFVVGEDFAGMRSQALGLVA
1951   APA_19320   2104898   2106100   +   MSGSFHDLGLDPALCAYAQQAGMAAPTPVQQAAIPAILDGRDVLVR
1952   APA_19330   2107160   2106051   -   LSGIRVFVWQWGRKGAGPRIAAELAKALNTLPNTSAVLSLSSGAEVL
1953   APA_19340   2108384   2107176   -   VTSSLHPLHHLWRLFPVAQRRRLLAKVTALLAPKAASPMPVADANV
1954   APA_19350   2108477   2109607   +   VLFLPSFPHTRRNTLASTVSGEGIMSCASKRHVRPESAFRFRAVSALL
1955   APA_19360   2110939   2109647   -   MSHTDLDRFFHASLAQTDPDVAAAIEGELKRQQEGIELIASENMASEA
1956   APA_19370   2111120   2112601   +   MEQKSAPSVTSAFTRCLPLDKLQAAPGLKRVLGPGSLVALGVGATIG
1957   APA_19380   2112718   2113722   +   MMAGRFPLARPRRNRIDDFTRRLVAENTLGINNLIWPIFFMEGTNTIT
1958   APA_19390   2113797   2114570   +   MTSSQDRPHFFYTAPPGACPYLPNRIERKILVDLATPDANFLHSRLSH
1959   APA_19400   2116809   2114581   -   MQAFQGWQMSETAGHIEETKLAEALSERYLAYALSTIMSRSLPDVRD
1960   APA_19410   2117654   2116863   -                                  recO
                                           MTDKGGTSYQKEAPALVLFAGVQGETSARVHVLTEDYGPLRGIAYG
1961   APA_19420   2118575   2117670   -   MAAITAALVKDLREKTGAGMMDCKKALNEANGDIEAAIDWLRTKG
1962   APA_19430   2119516   2118710   -   MAMPDFTLRQLLEAGVHFGHHTRRWNPRMAPYLFGVRNQVHIIDLQ
1963   APA_19440   2120810   2119683   -   MLVEEAKGKQADGSNTPHYDLRQIDCDPNFWYPVAWSHKVRPGKT
1964   APA_19450   2121536   2121120   -   MTKECPMQKILTSMLLGASLSVMPALAMAQDNNNGAPPTAEGAASM
1965   APA_19460   2122389   2121589   -   MSVIWLNGKIYPAEQAFISPQDRGVTLGDGLFETLRIKNGTVLHFSLH
1966   APA_19470   2123771   2122392   -   LVQIQELQWKDPDAVLSVWGQQPWCAFLDSGGKIDNRSRWQIFCHK
1967   APA_19480   2127192   2128223   +   MRLYSTNLGLFTLRKSTPSLITPSLTEVLFVSSGSKAVSTIHCSPTKLG
1968   APA_19490   2127193   2123774   -   MSYADFIHLRVHSAYSLSQGAIRVPDIAGLAKEMYMPAVGIADSGNL
1969   APA_19500   2128273   2128629   +                                  yjgF
                                           MSIKRLAPEERLTGAVIHNGLVYLAGQIADDSSLDAEGQMADILRQV
1971   APA_19520   2128938   2129972   +   MSAQGPSQTRRNFLLAGMGGIAAIGGGTFLATRGRHHPHKQPDGAY
1972   APA_19530   2131226   2130021   -   MARSFANRLKGLPAPATIEMARRARALKAEGKPVISLALGEPDFATP
1973   APA_19540   2132588   2131230   -   LRTKNAAYEKSPVPPEAEQDYCAAPEPNVCFWGMGDVLVIGMKNIV
1974   APA_19550   2133508   2132597   -   MNNLLHNSQINPAGWVTRFAPSPTGFLHLGHVASALYGWQKAQPDG
1975   APA_19560   2133701   2134264   +   LPDGSTLNFPALVLNADFRPLSYYPLSLWAWQDAIKAVWLDRVSVL
1976   APA_19570   2134579   2134280   -   MQMKNTLRLGFVAVGLALLGGCSSEVGRLPLVDTDITCLRKQMAGP
1977   APA_19580   2134965   2134753   -                                  copZ
                                           MTQTTASFMVDGMSCDGCVSAIKRALAAIDGVEATDVNLATREVKV
1978   APA_19590   2135098   2135760   +   MSSLSMPSGPSKMHNTSAQWRDTPLHRLMLATLIEKLENRLLANPSA
1979   APA_19600   2137342   2135783   -   MKVLAVHPSALMYTRVFLRLEPLGMELVAGAARSAGHDVQIIDLQA
1980   APA_19610   2138085   2137603   -   MVRYGCHPYGAGMPENRRNPMAKERTLSIIKPDATRRNLTGKINAV
1981   APA_19620   2138161   2140050   +   LSLLVISDLTLRMAGRTLLNQANLSIEPGRKVGLIGRNGAGKSTLLAA
1982   APA_19630   2140210   2141355   +   LHSERHLRMPSDTPSPANSLAGGPYEGKPHSADWLQSISRILRMTFSG
1983   APA_19640   2141431   2142108   +   MRVLLVEDDQTVRNFVAKGLAEAGHLVEQAEDGKNGLSLATSEKFD
1984   APA_19650   2142164   2143096   +   VPQLKPNLYSFGWVIREMFQRIIHLIHKSTAAITHGDFSQHIPLIGNGD
1985   APA_19660   2143173   2143991   +   LLSHKQAFTCSGQPEKKALLFANRETSDIKRKHTLMRFYSRSMLFLLS
1986   APA_19670   2144549   2144061   -   VNEEIRVPQVRLIDENGEMAGIMTVRDALAKAYSVGLDLLEISPNAE
1987   APA_19680   2146691   2144754   -   LTMPAITLPDGSVRSFDGPVTGTTVAEAIGPGLAKAALAMEVDGKLC
1988   APA_19690   2147687   2146731   -   MKPLMHSEKAQGIIPQRILVIRLGALGDFVQSFGPFQAIRQAFPAAHIT
1989   APA_19700   2148547   2147684   -   VNEPVWYGGRMKFSFVPTRRHLPCVVAGTALLVSAPVMAATARGH
1990   APA_19710   2148636   2149865   +   MSSFLASASILQILPALEQGGVERGTIEMAQAITQAGGKALVISAGGR
1991   APA_19720   2149915   2150730   +   MTATSLTNPPSIFMRPPQHLAFMAAPTETARDELDRLVTRYGNCHPG
1992   APA_19730   2150727   2151746   +   MMPQCGRFQAPKAGCLCSSSSFSGLVFHLMQNMFPFSRRLVLLCAAS
1993   APA_19740   2153275   2151758   -   MGHCEGKITVAERKTYQTIAGYMVAFVALTLLYTALGMTQPFNSDS
1994   APA_19750   2153801   2153307   -   MPTDSETSNATEQPALAVEIWTDGGCRPNPGPGGWGVLLRCKGVER
1995   APA_19760   2154759   2153785   -   MAVYTDVGNEALEAFLQDYAIGSLVAFRGIAEGVENSNFQLRTTDGD
1996   APA_19770   2155827   2154769   -                                 lytB
                                           MLLHSQFSSIQSAATLGNTMPDQTDTLTPPQSADAQHGRSLKVLLAG
1997   APA_19780   2155992   2156597   +   MPDPYMFPNHNQWRSLFPRIAAPGLAALGLLATLGGCGDGESKSMD
1998   APA_19790   2158019   2156652   -   MARDMDNTGVFGELRRMVQTTGTVGGIAARLAGNKIGLRSGGASH
1999   APA_19800   2159959   2158022   -   LFFISVVHVNRACVHGLSLPAEMHCKVFNMEHTAHSLRSHSLPVFAT
2000   APA_19810   2164577   2160021   -   MDMEQFPNTVSAESGEEFLKAWDANVAALDGLYDPADERDSCGVG
2001   APA_19820   2166025   2164577   -   MTTKMLQFVSVPQKQPDKRAATARRTDFDEIYKDFATPEATEQASR
2002   APA_19830   2167173   2166220   -   MSARKIATVLGGGGFVGRYVVQNLARAGYEVRVASRRPDLTARLRA
2004   APA_19850   2167582   2168520   +   MKLSPPTKGLLLSLLGFAAFSISDAFSKLLTGRLNPFEVAFSGGFFGLL
2005   APA_19860   2169383   2168484   -   MAFQADKMDGKTVTSAAVQKGVTRRSGLLYLGGGGLVAASVPVNV
2006   APA_19870   2169718   2172711   +   MLIQGQLWELCTPSNFYRTPVYIRRKSPCSVVPCHLRGSTTQAGHRR
2007   APA_19880   2172857   2173618   +   LTRLASAGVFMNHPRPAHQTETSFGTEDNGRIVLALPKGRILKAVSPL
2008   APA_19890   2173633   2174946   +   MKRLDTREPNFETDFTALLSNREEQGQEVHKPVADILAAVRKEGDAA
2009   APA_19900   2175021   2175239   +   MSKEDMIEFSGTVTELLPNAMFRVKLDNEHVILAHTSGKMRKNRIRV
2010   APA_19910   2175244   2175876   +                                 maf
                                           VTVSGQQNSVKGETPLLVLASASPRRVDLLRQIGVVPDRIVPADIDET
2011   APA_19920   2175873   2176958   +   VIEYLRVATFPGEMRLAVTQDDTLLDYALWRPAAPDLVGNIYVARV
2012   APA_19930   2176955   2177140   +   MTSKPAKCPVCGKPAQAEFRPFCSKRCADVDLGRWFSGDYRIPGAPA
2014   APA_19950   2177594   2177385   -   MAENQGKTIMNYASIAIAAVEALVENGPVIVEDISALLKPLKEGRAPT
2015   APA_19960   2178363   2177671   -   MNLSRISAYLRQPTTLFALSLILGDLVATWFNVIPAGGSAAMLIAALP
2016   APA_19970   2178592   2178428   -   MFMTERELNRLADLIAERLEKRGLCIAAPRNGQALVVEDVDINTLPV
2017   APA_19980   2179087   2178629   -   MNDPILLAADLCRRSEGLRLCPYVCPAGYWTIGYGSRFLANGATVTA
2018   APA_19990   2179886   2179674   -   MPDDVVRQDEFAAFETSVNGKFSTLEAGIANIWTELKRINNRKTWVN
2019   APA_20000   2180707   2179952   -   MTATLLSAVMETAGNPGASSFILDGAVSGCWSFAQANAKDGPVYYF
2020   APA_20010   2181456   2180704   -   MANAKLLDMVLETATNPGTGSFTLAGAVAGRLPFSSGLASNDLVFY
2021   APA_20020   2182238   2181456   -   MENCGFGWQNRVLDATLAASAQVGSLPVSNLRIPQGAPSLGWRAPA
2022   APA_20030   2183871   2182240   -   MSAVLSAGARLRLVEISANIGAPAQSSAPLPWGAYPWGMAALAQGG
2023   APA_20040   2189750   2183868   -   MAKVSEVINEVITRFVVDDQTAQPTEAAGARIDALQEKSDALAESGK
2024   APA_20050   2190474   2189743   -   MARARMADVLRKQIIVSARASLSSAALHKAAADACRANRDELIASGR
2025   APA_20060   2190852   2190478   -   VDGPVAGRCGVLPPPKHEWEAWDAWLRKVDPEPANMLPWRCWHG
2026   APA_20070   2191310   2190876   -   MAKLSSFTRNAAAIAEGTPVTVGVTDQFTIVTKGMTADYADRLWAL
2027   APA_20080   2192644   2191403   -   VAFFIEVIMAFTGATAGLAAGAQTNDTRMDFALEATYATPPSGNYQA
2028   APA_20090   2193132   2192686   -   MKFFPLIETAANSGKFQLSSTAVEADSTTAALALIAPTVGAGLRYGAW
2029   APA_20100   2193569   2193129   -   MPSEIVWNDAYARASAVAEKQGLPIGDPLTWDFSSNQEAFAALDLA
2030   APA_20110   2193892   2193569   -   MNYRTKRRRRQISTKGRQMVLTARDDTNPVTLRAYAPPPQSSQLAD
2031   APA_20120   2194533   2193889   -   MRRTVQISAPAALQPLALLDDLKADLSISDNMQDTELTRLLLEASAK
2032   APA_20130   2195783   2194545   -   MSDENEYKNAIKQLSDATDEVKKFAETSKAELKNLGKVTDETKASA
2033   APA_20140   2196704   2195853   -   MIDGMEVCAVPFEYKAIAGADGQTGHVEGYGAVFGNTDSHGDVILP
2034   APA_20150   2198031   2196697   -   MKMPAPFRGLLYKAANAMALTVTGVSLTDLRLGAFMAGGPTHSGK
2035   APA_20160   2199821   2198028   -   MASETEKKPATRKRKAATTARKTATATTRRKVAPAAKAGLSWSTAC
2036   APA_20170   2200407   2199811   -   MPKKTDTDWHAIEADFRAGALSNRQIAKKHGVAESTLRKRIASGGW
2037   APA_20180   2200936   2200607   -   MSSRKKAVLTCMRPLVGVLDTSIAKEPPKRADGFYTSPEWRALMAS
2038   APA_20190   2201565   2200933   -   MTMQTVPDGFMQDSRGRLVPEANVRPSDKLQDELVRRLHREAEPVR
2039   APA_20200   2202478   2201603   -   MVSGDQPRSTAPAVPDDGIHRADLPLVKTWLHNRSSNTVRAYRTNV
2040   APA_20210   2203032   2202628   -   MKHRQDICRGAVVRHLGKRSLIIAVLSEGVITVPLHSPSIPRHRADVIM
2041   APA_20220   2203560   2203360   -   MIKTSYDPEADAMFIWLGPEDAKSVRTEEVSPGVMLDYDESGKLIGV
2042   APA_20230   2204249   2204578   +   MRPFFAHYQKFNTVFRAVREMSRLPEPPVNTPEGEAYEARFDALVSE
2043   APA_20240   2204575   2205279   +   MSNIIPFNFEDHAVRVITRDGEPWFVLADVCDVLEHTNSRVVADRLE
2044   APA_20250   2205742   2205239   -   VEVRLKKNGNPHYSLRVGAVYALHKVGSISAAQLRAAEDWARDYE
2045   APA_20260   2206014   2205763   -   MSLRVLLRNLRLKAEGKPNPIDVMEDLRAKLAQEQKRRAEAELEITT
2046   APA_20270   2207168   2206011   -   MADLIRPHIQDFARDDLPSLKMVRSMPSEYRGVFENLRDALKEARSC
2047   APA_20280   2207655   2207161   -   MIPFSYRFLASIKTATKRAVEAVGDFRAAAGFTRVQKSQLEAYASRH
2048   APA_20290   2207740   2208276   +   MKGRSMTEAEKHSSPLDRKLQTELLKRMAEIYPSHLSMSAFEKEYSG
2049   APA_20300   2208787   2209536   +   MNEIHVTQRLKTLRNRAGYTVREFAEALGYEDKYSSYRTYETTYKR
2050   APA_20310   2209551   2210564   +   MIIFITFIFISSSINAFLAYRLNRSITQWILAGIIFPFFSFVLLWSLPKRGES
2052   APA_20320   2210639   2211022   +   LSHKNTHHNPWWRKTVSNTRYKIEEADGGFVLVEERTGPFPKEIRVP
2053   APA_20330   2211252   2211061   -   MSDEIDTTIEAALIQAAATLTASQLSARSASGSDPSDEYEHSKVSSEFY
2054   APA_20340   2211291   2213051   +   MEKVGGVWQQASPSKRSKMVHQTNRPEQYVFSHAHATLYTTPTQH
2055   APA_20350   2213048   2213314   +   MNAIPCPTHLSAFKTAQSAQSIHRRAALIRMQADALMSHSIVLETYHR
2056   APA_20360   2213311   2213544   +   MNNHAFQAARTQLEQLIHRNVDSKEKLAMLSLVKDMAAAMEAEQD
2057   APA_20370   2213893   2214309   +                                   xre
                                           MANHLLACGIKEMGYAQPCTLPAPSHAVVCAVSYRNMRECVPMAA
2058   APA_20380   2214687   2214911   +   MAEAMEQLWTARELARFLQYQESTITRWASMYPEKLPPRVSGLGRP
2059   APA_20390   2215919   2214912   -   MASIIKRGRSWRAMIVRKGQRVSATFDTKAEAEDWALRSEAAIMSG
2060   APA_20400   2216469   2216939   +   MKKTVLALLAALTGGVGFSGAAHAAADGAQLYATHCAMCHQSSGD
2061   APA_20410   2217227   2217009   -   MSGKKHFSPRREKKHATREDLILGLLNQFGSSVETDREKYLDLVSEIA
2062   APA_20420   2218030   2217269   -   MARVAGKVAIVSGAANGIGKATAQLLAKEGAKVVIGDLKEEDGQKA
2063   APA_20430   2219730   2218222   -   LSYYLEIPNVSGGYWEGDEMDCLENSERFFINGQWVSPSAQDQQDII
2064   APA_20440   2219929   2221644   +   VTTAAENNKQLIEQLKNIAGQHHVLTGEDSTYRFTHGFRFGAGKVLA
2065   APA_20450   2222833   2221757   -   MKRFSCQSCNHLVGFEATQCGYCGITVGYLPELAAMTALEPQADGT
2066   APA_20460   2223666   2222830   -   MSSHVMLTHRTCYRYDRPVSMGPQTIRLRPTLHSRTPVLSYNLHVQP
2067   APA_20470   2223914   2225392   +   MTPTALHAPPQATSSGLLDNYRIPDFFCELMNRRDPTPPTLQCVKDR
2068   APA_20480   2225392   2226396   +   MNETQGHLLSRYAECMMWLARYMERTENLTRLLEVTETFVRDANG
2069   APA_20490   2227301   2226444   -   MSYASHLPALLWKPVIQTALFEDLGQGGDITTQALAAPGQKIRAVFR
2070   APA_20500   2228307   2227327   -   MLAFNIPDRDTLYQPVASIMARDFWEDRYAADIEAIIRLKKQYNAVIL
2071   APA_20510   2229272   2228388   -   MKQTAFCRAELVAVLLNVRKDTPCVITLENGQALPSGPLTMGGHSLQ
2072   APA_20520   2229531   2230163   +                                   tetR
                                           MNTPTKHDIAKKKIVDSARALIAERGFSAVGLSQILEVAGIPKGSFYH
2073   APA_20530   2231427   2230135   -   MSSKSEILIVGGGVAGLALATRLGKTLGRHGKARITLIDKSFSHVWKP
2074   APA_20540   2233107   2231608   -   LDEGDDATHKSILLCRVHAAFAGSFCFFHFTVHEVKMAYATTNPYTG
2075   APA_20550   2234714   2233479   -   MTTAPQPPPASSAFIEPPHGRAAALFILTFGTFVVGTGEFAIMGMLPEF
2076   APA_20560   2235159   2234740   -   VQEFCFMKLSLALSMLDAALAEARRIEVNVCVSIVDAAAWPMAFAR
2077   APA_20570   2235889   2235317   -   MTQEKEQLHFVTMLGSLRKASYNGIVARTLPALAPEDITISALGSIAE
2078   APA_20580   2236820   2235951   -                                   pirin
                                           MQKKILGRYGNERGHWVGDGFPVRSLFSYTDFGEHLSPFLLLDYAG
2079   APA_20590   2236920   2237867   +   LRCIGRTMRDLNDFGYFVQVVKYGGFSAAARATGLQKSLLSRRIRLL
2080   APA_20600   2237946   2238203   +   LYLNVLHQSGRHSEVLQGLVRLASTVICMRFVMAEKKNKDSKKQAQ
2081   APA_20610   2238719   2238276   -   MGMNVGSESTTEDEGIVDINTTPLIDVMLVLLIMLIITIPLQTQAVSID
2082   APA_20620   2239193   2238774   -   MGMQVGDSGGEDDVVSAINTTPLVDVMLVLLIIFLITIPVATHTVKV
2083   APA_20630   2240240   2239227   -   MMRIMRKMTRLPRSFVSGLAAPALALLMSTAAPVAAFAQDAAPAAP
2084   APA_20640   2241053   2240310   -   MQNISEHSEKLESDAAQQTEGKERYVLRAGGAVGAGALIAVLLLHG
2085   APA_20650   2243629   2241158   -   MARISKFELSLVASVAFGALIPAESGFAADTTSATANPQKVLVKKTKS
2086   APA_20660   2245100   2243880   -   MNKAAGSSRYIFFIMIFLMYVISYGDRAALSISLPALGQEFSLSSVQMG
2087   APA_20670   2246244   2245231   -   MCREKHTIRKGYGFERKRAEKSGYVSVRGRVVMAMQHNLARGAYL
2088   APA_20680   2247101   2246340   -   MKIDLNADIGEGFGRWTVANDDALMKVISSANIACGFHAGDHLIMD
2089   APA_20690   2248099   2247098   -   VITVLETGVLNSVQDAGRFGYRHLGVSTAGAMDPLALRCGNALLGN
2090   APA_20700   2248797   2248096   -   MTDTISMLENNSFGHSADTPTISMIGTRAMLFEAPGAFTLACQRRIWA
2091   APA_20710   2249074   2249886   +   LVNSVFIISRLIHILSGTYAMTNQPYRTALVTGASSGIGAATVRRLREL
2092   APA_20720   2249899   2250348   +   MDTQALKALIDLFGRAPLRELEISEGGQTVKITRAKQAQAFVPPASPL
2093   APA_20730   2250345   2251742   +   MSAPQRFGRVLIANRGEIALRIQRACRQLGLETVAVYSEADAQSRHV
2094   APA_20740   2251768   2252175   +   VQISQWLNEAGLSSLELSNAQGTHLRICVETAETPAGGSEQYNALEPS
2095   APA_20750   2253529   2252273   -   LTEYSHASAQEYLRSMCVMPGFADRLNGIAISASAAMTDKATALKA
2096   APA_20760   2253827   2254768   +   LDIRRLQAFVKIIDIGSISRAADILNIAQPALSQQLASLETAFKQKLLIRS
2097   APA_20770   2254923   2256284   +   MPSSFPSMLHAAHALADGRTTARELVENALAHIADSQGEGARTFMSV
2098   APA_20780   2257186   2256341   -   VVSTILITGAGTGFGHEVALRLAAKGFNVIAGVEIASQVYALSEAAKQ
2099   APA_20790   2259919   2257292   -   MNTSLRATYRIQFNKDYTLYDAVLLVPYLSRLGISHIYASPLLASVPG
2100   APA_20800   2261673   2259916   -   MRTFRFRKTFGAELLEKRQTAFTLWAPSSKNVFLHVEGMQDLQMHS
2101   APA_20810   2263934   2261706   -   MPARSVSKNRKMADLVLQKQIEELASGHSSNPFAVLGRHPDGRGDIV
2102   APA_20820   2265612   2263984   -   MTQTSVAVLPANLNVLSVASEMYPLIKTGGLGDVVGSLPGALRPYG
2103   APA_20830   2265775   2267961   +                                  glgX
                                           MPQFSPCGENRIGLRHKVRAPPMSFPLRQRLREGNPVEFGATYDGSG
2104   APA_20840   2268060   2268362   +   MPRGDKSAYTDKQKRQAEHIEKNYEQHGVDEKEAERRAWATVNKE
2105   APA_20850   2268482   2269336   +   MMAHEEKIPSQHQTVPGETDKMNPIPDHGEKSYQGSGKLSGKVALIT
2106   APA_20860   2271202   2269385   -   MSFILKEIPPMNVSEFLWKRLQEWGLKRAYGYPGDGVGGIDVALQN
2107   APA_20870   2271698   2271294   -   VRNFIVKSIFSIPMACHKIANRLAGITISYPDSPLNAGSTCGRCGPRPGQ
2108   APA_20880   2271733   2272038   +   LNENFLSVRIEEILMKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISN
2109   APA_20890   2272035   2272862   +   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
2110   APA_20900   2273964   2272897   -                                  pcpB
                                           MSKPVLVIGAGPVGLTMAVELARYGVPVRIVDKLPTRTMQSRALAIW
2111   APA_20910   2274027   2274809   +                                  sco1
                                           MDKTCSYPIPKYTCCFTPNRSYIMKRQCIAASICAVCYNMPMTQKSS
2112   APA_20920   2277203   2274828   -   VFLHAGFSCCLFRFTIMLSIYATPLRLSGVMAVMTLLSAVNAHAATT
2113   APA_20930   2277617   2277228   -   MSARAHSLTHLVVFWPLVLLALVARLTFGGVVSPTALVEDPLKDLIK
2114   APA_20940   2280351   2277691   -   MYLSCRSVIDLMLRIQLMSSQIDLDSDQTYTNTSPVTSSKTALTIELDD
2115   APA_20950   2281240   2280413   -   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
2116   APA_20960   2281542   2281237   -   LNENFLSVRIEEILMKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISN
2123   APA_21030   2287540   2287959   +   MPSSPRTIYLATALLVSPAKNILLVRKHGTRFFMQPGGKRETGERPEQ
2124   APA_21040   2287986   2288882   +   MFLRQLSYLIALDKYRHFSRAAEHCGVSQPALSAGIRQLESELGITIIN
2125   APA_21050   2289004   2290839   +   MRTLTAAIGQPFNKSALAWLLAPSVPDILFALRTASAACLSLLIAMWM
2126   APA_21060   2290903   2291109   +   MHRMPKPENDTPTTDQATQRASTSQTGANLGSGAGITAFLGFIGFIAS
2128   APA_21080   2292533   2291424   -   MIAVWAMVLHLSYLPMRVSRYGRYSCALLVVFLSLTGCSVKLPDPP
2129   APA_21090   2292594   2292809   +   MLIQPANPVPHPKLGHVETIMVDKRKIACDGGLGALGHPRVWLKIGG
2130   APA_21100   2292903   2295095   +                                  dsbD
                                           MSLPVMPFSRLTAFNRSSAPAPMQAKGNRRGLVGWLALSVAILAAPF
2131   APA_21110   2295430   2295092   -                                  emrE
                                           MVSKPSLYLAIAIVSEVIGTSLLTASQGFARWGYAVASLAAYGCAFY
2132   APA_21120   2296718   2295450   -   MHDIRALRADPAAFDADLARRGVEPVSAKLLAWDEERRQAQTVLQE
2133   APA_21130   2297552   2296737   -                                  tatC
                                           MNENETVGEDPIHDQPMPLIEHLLELRRRLLWAGAAFILCFALCYHY
2134   APA_21140   2298271   2297549   -                                  tatB
                                           LRGHFCFSRAVRAATELPMFDFAWSEIALIGAVALVVIGPKDLPVAIR
2135   APA_21150   2299156   2298290   -                                  scpB
                                           MTTDIADNAASESAEAIKVVQPENTMVSEEALRLAEALIFASTEPVSA
2136   APA_21160   2300064   2299153   -                                  scpA
                                           MEAGHTQADIEGASGPVEAIGALSAHADAQAEQAPRVPLLRLDGFEG
2137   APA_21170   2301083   2300085   -   MSDEDRPKFSADDRISRARERMSMDYEDPAPTRPAAVGGRPTENVL
2138   APA_21180   2302882   2301083   -   MSDCVFQRYRQHVLAIVQELLPNVPEETLARVELTPTRDPAHGDMA
2139   APA_21190   2304150   2302930   -   VDRAAKETAGVPDTTECRDLMPYAVQPGEGRARRLYDEPESLTRSP
2140   APA_21200   2304274   2304642   +                                  hesB
                                           MTQPTPFSVSESAANRIASVIAKKQATAAPEKPAPVAMRVSVEAGGC
2141   APA_21210   2304639   2305424   +   MKLSTWNVNSVRQRLDLVLDWLKREQPDVLMMQEIKCETDQFPKA
2142   APA_21220   2306666   2305521   -   MRGVWQCLPRLWFLPLGSLFRLTTYNGISRQADMCMHDTLEQNTQA
2143   APA_21230   2307719   2306682   -   MAEAAPVPDTSEVWILDTHRAGEMAQCRALADMLGLPCQIIPLQAD
2144   APA_21240   2309037   2307712   -   MMSSQVKALFVRVFRNTGYILGGRGFCAVLSLITTAVSARALGLQDY
2145   APA_21250   2309381   2309461   +   MAWTAPKVTEIPLGAEINSYVCGQKK pqqA
2146   APA_21260   2309502   2310461   +                                  pqqB
                                           VNAGFALAAFLFRCVVMLEIVVLGAGAGGGFPQWNSNAPACRRARA
2147   APA_21270   2310458   2311198   +                                  pqqC
                                           MTNQLLTPDELEKALRAIGAERYHNLHPFHRALHDGKLNKGQVQAW
2148   APA_21280   2311219   2311494   +                                  pqqD
                                           MISENSILRFARGTRLQHDRVRDVWFIQAPERAFHADPIAVEVLQLID
2149   APA_21290   2311491   2312585   +                                  pqqE
                                           MSAPPPPMSLLAELTHRCPLQCPYCSNPLQLEPRTQELGTEDWKRVL
2150   APA_21300   2313671   2312658   -   MGSLSDIYSHLPESMDDLPPPPNEAAVEEADYRARHWVSPVKGPLKP
2151   APA_21310   2314490   2313810   -                                  clpP
                                           MYTDTEHAEKAMTGIFPRNAIKMDDEPETPAAPEKAEEKTAGAPHG
2152   APA_21320   2314537   2315709   +   VLSRQPGRKRVRCAPSYCLVSISRSICAAMPQPCLEHKRTLRSAISLKP
2153   APA_21330   2315849   2317081   +   MTEEFHRIRRLPPYVFASVNQAKAAARARGEDIIDLGMGNPDTPTPQ
2154   APA_21340   2317078   2318391   +   VTSCSNSSPLRLGIAGLGTVGTGTIRLLRMNADLLSARAGRKLEVVAV
2155   APA_21350   2318445   2319443   +                                  glpX
                                           MSDSIGPSPFIVSDRNLALELVRVTEAAALASARWTGRGRKNDADGA
2156   APA_21360   2319460   2321292   +                                  recJ
                                           MQSSTLQLTEHSEEASSPAVLGVEASLIGRRWAWRAGAEDPALMRL
2157   APA_21370   2322342   2321383   -                                  rpoH
                                           MFCGRYGNPKHSREFPVQGSSQHMVSSVINVGPENNLSRYLQEIRKY
2158   APA_21380   2323605   2322592   -   MVIMQNGYDPSLPVKETAVSFTVTPEQAGERIDRFLAATMETLSRSR
2159   APA_21390   2323608   2324771   +                                  fecCD
                                           VPTPTRFSSFMQKEKMKTHKAFSTAHRQAQDTMPDYKDTLPDITAV
2160   APA_21400   2324768   2325580   +                                  fecE
                                           MTADKPFSGLIAQNLTVHYGRNTVLDDLTTPCFPHGRICALLGPNGS
2161   APA_21410   2327064   2325601   -   MAPLPFRQSYAALPERFYASAPLSPAPAPKLIRLNHALAEQLGLDAEW
2162   APA_21420   2327345   2328445   +   MTTESDTAFKITRKTDITPAAEREAMLANPGFGRVFTDHMAVVTYTE
2163   APA_21430   2328634   2331435   +   MTETPHLVLVDGSGFIFRAFHALPPMTSPEGVPVNAVYGFTTMLARL
2164   APA_21440   2331440   2332060   +                                  sco1
                                           MTPAGKRIALMTFGVLALAAAGGYTATHLALKHGVQLNTYGNEVG
2165   APA_21450   2332157   2332903   +   MSLFSKLSTSLRFYASLAVIGIIFLALDAGSFLLRHALPEGPKRRKIGQA
2166   APA_21460   2334434   2332974   -   MKDSGTAHAHFGWFKRRKQMKPQDITVVDAQMLNKAVGAAALGN
2167   APA_21470   2334817   2335428   +   VVAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQGSP
2168   APA_21480   2335970   2335830   -   VFYFEITVFSLGCFAELSLLFFETVSAFSNWLRGVLLKGGIFCPGK
2169   APA_21490   2337175   2336159   -   MDLTYWLPIIWAVILVAAISIYVILDGFDLGIGMLFALEHDPGRRNVM
2170   APA_21500   2338614   2337181   -   MQPAHDIALLLARFQFAFTVGVHIIFPAFSIGLAAYLAVLEGCWLKTG
2171   APA_21510   2338841   2339980   +   MCLFDTTFHLATNIHLPMLGISCDYITRHAFRSSLTVVTPQPVDTKLT
2172   APA_21520   2339982   2340776   +   MNNLHKHLAPISHAAWAEIEQEASRTIRRNLAGRRVVDTPEPKGTAF
2173   APA_21530   2341014   2342699   +   MTHVYSNKLCAVYFYETPYTSNLRHFDSAMTSLILRLLLLHYRNKVR
2174   APA_21540   2342699   2343691   +   MSTIFRNFSYKPLRFLLPLALSAITVTTYSHSAYAADQWYTGSLVSPS
2175   APA_21550   2346217   2343779   -   MADTQPTDHQASLGGIYRAFFSLISILAGCALVYGGLQLLVLGGSAYY
2176   APA_21560   2349559   2346872   -   MTDTFVSSGQTVSDVTVSGGNQLVVQSGGTANNVTVMSNANAAVS
2177   APA_21570   2350327   2349938   -   MPLLHFHLVKGRNPAEIRTLLDAAHGAMLAAFKVPERDRYQIVSEHD
2178   APA_21580   2351717   2350368   -   MVDMSSNFDSVNEARKGTYWQPFTSNRLLRADPEPRMLTKAEGIYY
2179   APA_21590   2351851   2353263   +                                  gntR
                                           MSLFHSAFLQSKSSAKGPIINQIVHFIQGEIEKGHIAPGDRLPSIRMLAD
2180   APA_21600   2354575   2353313   -   VSDLAKNSNLRIDGNALWADLMETAQFGGTNKGGVRRLTLTKEDKL
2181   APA_21610   2355880   2354612   -   MANLKTSFAGIKSPNPFWLASAPPTDKAYNVRRAFEAGWGGVVWK
2182   APA_21620   2357239   2355896   -   MHVLDLKNSRLTEEELQKNFSDAHPPLTHEQALVEAERCFYCYDAPC
2183   APA_21630   2358994   2357384   -   MTHAPAVLPDDPDILREMIVSLQTEVARLSASARAYEALVQSLKIRIA
2184   APA_21640   2359405   2359058   -   MIGVGNGVRVYLACGVTDMRKGISGLAALAQDVLRQNPTSGALFAF
2185   APA_21650   2359761   2359402   -   MAQEILIGVERRRRWSDERKLAILAEVGVDGASVSDVARRHDLTRQH
2186   APA_21660   2362280   2359863   -   MPHPRFSVVHFLLAGTICSSIVMESAAFCQSVPHPAKTVRAQPKNTNK
2187   APA_21670   2362501   2363511   +   MILPGDPAPIFTQKCSTNWGYYSFDMAAGKYNILVFVPDIQKLFANK
2188   APA_21680   2364908   2363508   -   MLHVKGGTLVTAEGSKRADILCGPDGKIAHVASTIETPTGCDVVDAA
2189   APA_21690   2365037   2365201   +                                  ncs1
                                           MGGTHHATHDNRLTNEDLAPSATRTWRWKDYLFLWMSDIHSVAGY
2190   APA_21700   2365273   2366496   +                                  ncs1
                                           MAVPSFKTGAPFPVIARMTFGVYGAIIPALIRGIIAVGWYGIQTWLAS
2191   APA_21710   2367100   2366447   -                                  tetR
                                           MMRKNGNIEPSVGNPRKQNTTQILDAAEKVFAVHGLSGTRIDDIAKA
2193   APA_21730   2368169   2367528   -   MSGVQTGVKICGITEEAGLEACMEYGADWVGFVFFERSPRYINALQA
2194   APA_21740   2368911   2368198   -   MSDTARQTGLIVALDTQDPAQAKAWAHAVEGIAGVIKLGMEFAYAA
2195   APA_21750   2369251   2368904   -   MIRLIIVVPFLLALVVFSASNQDPLDMWLLTYSWKSSAGVLALLVAA
2196   APA_21760   2369507   2370001   +                                  secB-2
                                           MNTETADSLGGASQTPPAPSILMGIQYVKSVEFQVLGAPAIYSRVTER
2200   APA_21770   2370056   2370718   +   MPGKASAALWYPFDAHWYRTEYGAIMDALLSFSDQELEQWYKLEG
2201   APA_21780   2370773   2371744   +                                  pdxA
                                           MLALTQGDPAGIAPEITVKAWRILRESGLPFVFVGDPALLEQHAPVQA
2202   APA_21790   2371741   2372463   +                                  pdxJ
                                           MTSAIRLGVNIDHVATIRNARGGTYPDPVAAALLAIQAGADGITAHL
2203   APA_21800   2372465   2372821   +   MEEPQEYKTPKALLVAVIGMGVLIVVGVVVLAGVLIHRMSSKPAPPS
2204   APA_21810   2372826   2373971   +   MPARPPLTTIGLMSGTSLDGVDAALIQTDGTRILRHGPALTVPYTPEL
2205   APA_21820   2374003   2374494   +   MKRFLAFSLLLAALGTPGLTCSASAQTVIDGSDKKASPFVKNTLKTLT
2206   APA_21830   2374652   2374849   +   MTGFSVMKYLNFLLALPFLGLLWTPLYNRYDPVLWGFPFFYWYQFT
2207   APA_21840   2374846   2376300   +   MNIINPWALGVFVFFFAATIVVGSSIQWIRSLFHAKRDANSHEEWSLG
2208   APA_21850   2376761   2376375   -                                  hicB
                                           MSVSGRDMMFIGGIPAVISFNASSRMFRGVFIGLNAEVDFLARSPMDL
2209   APA_21860   2376871   2377539   +   MKDNRPAQLDFLLPDTRPDYVQLDAGAVLLPGFALHDAEACMLAIH
2210   APA_21870   2377573   2378733   +   MPSPAFSRRILLLGMTNLFYMPIKNSMASDTQNHFAQVEQIFQEAIKT
2211   APA_21880   2379205   2378837   -   MADQDDVISPGIDLGQRIKILRKSAGLTQQQVADALGVSRPAIAFWE
2212   APA_21890   2379481   2380788   +   MQPSPHKRCIALTPFYVSIRCILNTFYRIFSMPSPLDAKTLSIIKACVPA
2213   APA_21900   2381516   2380842   -   MSRLILDLLWHATGETLIMVLVSGFIAVLFGLPLAVFMVVAGRGGLY
2214   APA_21910   2382480   2381497   -   MSLLQVEHLTRSFGGQPALKDISFTVGKGDSLGIIGRSGAGKSTLLRC
2215   APA_21920   2383289   2382477   -   MSSSFLSRRVMLAGMGVAMMAPYGVARADGQVLRIGIIAGEDEDVW
2216   APA_21930   2384815   2383388   -   MTNTSFPHADAPKRAEAVLAQLKAQFGERVSCNESVCEAHSHGEAL
2217   APA_21940   2386307   2384904   -   MQGLSENTGWFPVVFRMEGERVLVVGGGNVAASKVQLLVSTGARV
2219   APA_21960   2388141   2387185   -   MIQNSVAPEFREALKVLPSFDGLSDQNLAATRKAFIAAIRNVPVTEYP
2220   APA_21970   2388413   2388904   +                                  marR
                                           MRNEIVVKSRSGKVWRQADPKDQLFSSDASPFFHLTRLVSLYQIRMD
2221   APA_21980   2390186   2388951   -   MVMLPDPTVIAENLIDTINKHEGKIHAFTQYNPEQIRRDAAYLSAGPL
2222   APA_21990   2390706   2390230   -   MNANTTMRDDFRKAMSHFATGVAVVTAQGEQGAQGATISALSSVS
2223   APA_22000   2391461   2390703   -   MSDLWSADETKLRIQLAECYHLIDYFGWTEMIFNHISVRLPGEPKRY
2224   APA_22010   2392450   2391482   -                                  apbA
                                           MPRVCIAGMGGMGGTFASILSSRPVMLSVVARGSTLQALRENGLVC
2225   APA_22020   2393415   2392456   -   MTRQSHLLNVIVDACQLRGSVLCFDLKASNGADLPVWEAGAHIDLY
2226   APA_22030   2394146   2393412   -   MRTALVTGGAQGLGAIIVSSLVQAGYRVAIADINPDVAQHLVKEHGE
2227   APA_22040   2394619   2394146   -   MSISLNDAVELVTLEADLLDDGQFTEWLKLYTQSGFYIIPIDPDADDY
2228   APA_22050   2395881   2394616   -   MTAFPDVKQLLAEDRADGSIYSNPDLYDMEMDRIFMHNWIWVAHR
2229   APA_22060   2396340   2395981   -   MSNPDKKPLRVLFCIGVTQTFFDLPASGIKTVWAGVGEMLKGMNSL
2230   APA_22070   2397514   2396360   -   MLIQTPECKADLAKGPAFDALIEDISSRALEFRENRRITKDIIEKFQEIG
2231   APA_22080   2399390   2397744   -                                  oprB
                                           MRVSVQYQGKWRGAFCCMSHHFNKACNTLSVFFMLSCGAVVVESG
2232   APA_22090   2399960   2401447   +   MDSLLASVANFVSISHELYINGGAVPSSGDARLPIYDPSTGMQIASTV
2233   APA_22100   2401453   2403588   +   MLMSPRPLVLALLAASFLSPSVYATETDPIVEQADSHPENWPTYGRT
2234   APA_22110   2403624   2404949   +   MSPVRPVTTIFLFMLAYLFSYIDRQILSLLIGPIQSDLLITDTQFAFLNG
2235   APA_22120   2404986   2405561   +   MTHDLNLENKLEALVQRVEELEGEAAIRRLQARYMFLCDTPCPEFGI
2236   APA_22130   2406711   2405758   -   MALTLRQLRYFASVAEVGSISGAAMVLLVSQSTVTEALRTLEAEMGF
2237   APA_22140   2407517   2406729   -   MNVSVRNLALWGAALAVLAFLLLPLLLVLMFAFDASSVQVWPIHSL
2238   APA_22150   2407864   2407514   -   MLMPLVSALERIPASLVDAAGDMGATPWQTFRTVIFPLAIPGMAAGS
2239   APA_22160   2408245   2407904   -   VELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQRGIT
2240   APA_22170   2408706   2408287   -   VSACADCFPIFWGDRQMRRYSLRDDQWERIKDLLPGREGYVGGTAV
2241   APA_22180   2409230   2408739   -   MKGGRKLWGHVALLLPPFGWLTVFYLGSLFILLLSAFWQVDSMSGE
2242   APA_22190   2410360   2409230   -   MKGFTALLMASCCTALIAQAHAADLPSTIGKGEGDLNVVAWEGYAD
2243   APA_22200   2411422   2410403   -   MKDNPAMGVPAVSLSGLIKSYGQGKPVLKGIDLEIQPGEFFTMLGPS
2244   APA_22210   2412857   2411430   -   MFTKMLIGGGFVNGTGAKETVYAPVTGDVITNIAEASAEQVDAAVA
2245   APA_22220   2413612   2414379   +   MDHPHISSTEDDAHLAALGVTSDFDRSMSMLENFALGFTYLSPVVGV
2246   APA_22230   2414376   2415113   +   MTIYIGVGASIFACAALLLAVPDIPAVISGQAPNALSDVLFNAFGSVGT
2247   APA_22240   2415237   2416733   +   MRQTLTDRSAFKFVLLSCCAAFLCETGTPTAHAQTSAPAQVQVGDIA
2248   APA_22250   2417575   2416892   -   MLVHIPNVLTAEEISYCRKTLEKSQWVDGKVTAGDQSAKAKFNLQIP
2249   APA_22260   2418130   2417591   -   MFSMNIVIKKYSTPLITGLFIVSAVSGTALFFHWMPGMFHSMHTWLS
2250   APA_22270   2418889   2418173   -   MVRIMKPAIGVGKLDQNSSEDKACHSVSTVNVQLMLGQIYLNNGKF
2251   APA_22280   2421246   2418937   -   MSRSELSHPSSQGKGLRVAVALGVSVGLSVTESKAQAEDAAQPPQPS
2252   APA_22290   2421700   2422476   +   MYCESTWFLMPSSESSLQIPLSFSPWEMFLNAGSVVQCVMALLALAS
2253   APA_22300   2422482   2422931   +   MRRIQHADENPHEASEINVTPFIDVMLVLLVIFMVTAPLTTVNVPVDL
2254   APA_22310   2422928   2423788   +   MNATTYKNIAGKVHSTAFSDWKIQQIRKARQEDTFRWGVSFLIVVAT
2255   APA_22320   2424784   2423843   -   MHSQTKNRQMNPFSRFLIYFLAVARHGSIRKASEDLHIAASAIDRHIL
2256   APA_22330   2424878   2425933   +   VTPPTCARPTESRLPRELSFDADDWLILASYWHPIALVRELEDKPLGV
2257   APA_22340   2426302   2427606   +   VLPSSAPLSSSHQRFLYLQVLVAVGAGIAVGAMFPSIATALKPLGDGF
2258   APA_22350   2427964   2429556   +   MPLTDIISNSEQKRSCYRQDFLFIARLLYAGIVLFTLDIALKASTAYAQ
2259   APA_22360   2429915   2430379   +   MYKHAFSSFITALLLAWGSIPSHAYAQSASTPTITGQWITEDGKGVFD
2260   APA_22370   2430492   2431166   +   MFHSDRAEPGFVGRTRRMRQTHKGQPVAEWCASPNAMRLNKLLRM
2261   APA_22380   2431188   2432825   +   MPSEENLSAEVVIVGSGVAGSSIANELARAGISVIVLEAGPRVDRQHF
2262   APA_22390   2432818   2434137   +   MPDFSKTLRVLLSASTVIGVCALSQTPVHAEDAAPDQAVLDRGAYIA
2263   APA_22400   2435697   2434243   -   MSEKEIRTQLLVAGKWQDAADGRTIPVTNPATGQVIGQVAHASTAD
2264   APA_22410   2435783   2437093   +   MQEKRGLYTPAHNGFLPGSVPSGRAIILQTLSCISRKPMLFKTLSGQT
2265   APA_22420   2437662   2437108   -                                  cobP
                                           MSVLSLNPTETGAQGTVLILGGARSGKSGLAEAMLTALPSPWIYLAT
2266   APA_22430   2437724   2438773   +   MPSSPSFSNAPLCLGSMQELRSLCSNLPQADKAAQNAIAQREQQLTK
2267   APA_22440   2438770   2439603   +   MTSSGSLSILDRLRLHLACGVGLLTRIPVSWLLPATYKNSSASWPLAQ
2268   APA_22450   2440717   2441706   +                                 cobD
                                           MLLYPFSITLPVAAMAAGLEALCGYPAPLFAAISHPVVWIGFLINRLE
2269   APA_22460   2440718   2439600   -   MADAGVREKRQEGKGYPLQQAPAVSVLSSKTSSTPHYIPAHGGQVQ
2270   APA_22470   2441703   2442341   +   MTAPFFSPSFQNQLEQLLIWRRDVRHFRTTPVPTSVLDELLETACLAP
2271   APA_22480   2443875   2442355   -                                 cobQ
                                           MVQGTGSSVGKSTLVAGLARAFTRRGLRVLPFKPQNMSNNAAVTW
2272   APA_22490   2444516   2443890   -                                 cobOP
                                           MIDSQKPASAQDAEHHRTKMQKRKAVQDKEVASKTVEKGLLIVNTG
2273   APA_22500   2445127   2444513   -   MRSFPVLLVRHAPVQVAQGICYGRQDVALSPGWESIVSGLSVLAKGA
2274   APA_22510   2446599   2445238   -                                 cbiA
                                           MKAPRVIMVAAPRSGGGKTTVTLALLAAFQRRGLRVGAVKTGPDYI
2275   APA_22520   2450060   2446596   -                                 cobN
                                           MHLLVRENRTLDEQEVAEDLNLPSADLVVLSFTESDLLALRHAEALL
2276   APA_22530   2451132   2450080   -                                 cobW
                                           MTIASRVPVTIITGFLGAGKTTLLRNLLQRAAGHRIAVVVNEFGSLGID
2277   APA_22540   2451557   2451129   -   MAEASDSSQKSPQNRPVLHVCVTCRRGGPAMDQPPGAQLYARLQAL
2278   APA_22550   2451940   2451791   -   LKAKAAYAHCARADGVLYGMKREERCKAVAAPATVSYPWCSVWA
2279   APA_22560   2452128   2452646   +                                 marR
                                           MNILYMSNILSLTNEDSMTSPRVLPTLDETRFSDMALTFRIMRLATVW
2280   APA_22570   2452636   2454891   +   MSARSGQSSHTLFSFSAVLSHCLPGFFSDEAQWNTFKATAGYSARVF
2281   APA_22580   2455029   2455652   +   MAYSETSPPVTYRRANPAPLGLMGFGLTTVLLNLHNADLVPMGSAIL
2282   APA_22590   2456728   2455709   -   MTEQTLSAVSGVRMQQEGHLGRIILDRPKRLNAVDISMASGIKAALQ
2283   APA_22600   2456794   2457297   +                                 ycdH
                                           MLAPETSAYRDAMARLGAAVNIVTTGTLENPVGFTASAVCSVTDTP
2284   APA_22610   2458293   2457499   -   MLEYEFMRTAFLAAFLAALVCGPVGWFLVLRGQSFASHALSHVGFA
2285   APA_22620   2459099   2458293   -   MPSSAVQVAGVTLLRQKKAVLDNISFTVPAGSFVAVLGGNGAGKTT
2286   APA_22630   2460007   2459099   -   MGMELRKTKGTSRRMLFGMVAVLGVATMGTGSAAARPLSVVAAEN
2287   APA_22640   2460132   2460695   +                                 fur
                                           MMNMPHPTSSSTATPAHTFPAHIEHQLDKATALCTQQGARMTAQRR
2288   APA_22650   2460692   2461237   +   MMGNRHLSSLQNALPGLSLPLAQERRRTPHLKQHHASQKRPTCAED
2289   APA_22660   2462174   2461476   -   MSETRTRRKPAAGKTVSKRKVAAVAPKKRAPRAKVVEVEELFDFEA
2290   APA_22670   2462460   2463590   +   MQTSPSHGTCFMKINGTSFRSVWVDEKDQWSIHIFDQTRLPFSLDILR
2291   APA_22680   2463709   2464224   +   MDFPERATMSETIETPTTQFLTAHGIAFTLQDYDYVSDPGKIGLHAAA
2292   APA_22690   2464370   2465293   +   METRLSRKLTVALLAPLCLAACATQQPQPGARPTPSASSTNTWNTAS
2293   APA_22700   2465407   2466447   +   MTENAVSTPHPGWTTLSADMPGAVGGTPLVRLRKASEATGCDIYGK
2294   APA_22710   2468121   2466520   -   MSVDATPPVSSSKLDESLHHDRILILDFGSQVTQLIARRVRESGVYCE
2295   APA_22720   2468341   2468793   +   MKHTRFSCWLKYGALALGGLGFFCTSAHAATQPASAADDPYGEWIG
2297   APA_22740   2470381   2469812   -   MKIGYARTSTTDQVAGLEAQARDLLANGCERIFREQISGSSTDRPELS
2298   APA_22750   2472525   2470630   -   VRAAIESAKVVNLDSGKGKKSSQRKPSGKRVESPCGQFFCDAFGLFK
2299   APA_22760   2473591   2472530   -   MRRHSAAELARLLADNITRLAPELLPHGKKDGAEWRVGSLAGEPGQ
2300   APA_22770   2474180   2473578   -   MRMSYPSCGAMLTLPEMNQAAKRYEEVPCTWLWSDYTETGPNLLA
2301   APA_22780   2474482   2474177   -   MPSTAQVQNEKTGLMGGVAHFPARHRKETITPLVFSNDQAAAMAGV
2302   APA_22790   2475839   2474601   -   MIAMQYPSGGSLLPIPVLFPMMPPSAARFGRRTPAPHDRPAALLSDVH
2303   APA_22800   2476207   2475836   -   MIIVQATPSCSARGADTLLQDVLALYWQAERSILAIEAVPEPLVTATQ
2304   APA_22810   2476366   2476737   +   MRRYSLRDDQWERIKDLLPGREGYVGGTAVNNRLFVEAVLYRYRA
2305   APA_22820   2476779   2477120   +   VELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQRGIT
2306   APA_22830   2477512   2477051   -   MTQPANTAVSRRTALASAFAASAAAVLPAVACAATSTGNDARLLAL
2307   APA_22840   2477772   2477509   -   MAEHAYTMPGKCWAVLTLARLHSDTLAAIGAAGLSMLALAGFLHPE
2308   APA_22850   2477938   2478150   +   MARAAIGWGVRDLAKEAGVSPDTIARLERGEELKTSTIEAIRSALEAA
2309   APA_22860   2478554   2479117   +   MGAAARTGSGTTGSGIRNDFSGWHKHQGSPQSGGSPKKGASFEERD
2310   APA_22870   2479139   2479750   +   VAIGCSNTECLKTTIKVSICEARYASPSACIINYDKEPLVGMYLLPFSN
2311   APA_22880   2480621   2480208   -   LKFILDENHPPVLARVLEPLAAINDHEAVSVRHLGLEGTKDVDLLHIL
2312   APA_22890   2481304   2480618   -   MPDGSNILGRGVYTVPEAARLLKVPSARLRSWVYGNGAEPVLIPELA
2313   APA_22900   2481777   2482739   +   MRFWWVNHKQTYKQEVGNGYIWSPKTFSNGRKNHFYETMRKVLPG
2314   APA_22910   2483352   2484038   +   MFKGIGNLKMCSFNTIENFLDSSFAASLLGAIIGACGSWYGAKLSNRA
2315   APA_22920   2485168   2484449   -   MSKWQIIAAGLLGALMAQPESAMAIDRARLQETKNLQNTFQSPRLGT
2316   APA_22930   2486595   2485264   -   MKLTKSGIDLLTCPPEKRDVMFSDDEVKGFAVRVTSKGSKVFLFNYS
2317   APA_22940   2488550   2487150   -   MENAAMPEKGAESTVPIKVVVVGVLAATAGLMSGLDIGVISGALDF
2318   APA_22950   2489961   2488630   -   VGKPRNPCFLSQVYGTSLIGKSSCGRGRQVSFRIQQRQTVCAALLLGL
2319   APA_22960   2490141   2491733   +   MFIQPLVPAGHSLVLSFLLAASPIIVTLFVMGILRRPAWQATLGGLIVG
2320   APA_22970   2492122   2491820   -   MSEEITVVALLKAKPGAEEKVAQAMVACIKPSRAESTNSQYVPNRDL
2321   APA_22980   2492272   2493252   +   MIVITGGAGFIGSCLQAALAARGLETIIVDWLGQEGKWRNVSQHAPT
2322   APA_22990   2493277   2494116   +   MLPVLMFPQFNPVLVHVGPFAIRWYALSYIIGIVLGITLLRRLVNLPPR
2323   APA_23000   2494125   2495153   +   MPSPLPPKAERLDAFMARANARYYASKPLLSDFITAPEISQVFGELLG
2324   APA_23010   2495150   2495935   +   MTTTLSPLTSPLLGHTRHGFFTREGGVSTGPYASLNCSTKSGDNPQNL
2325   APA_23020   2495932   2496939   +   MNRLLRHTALPLSTLLLLAGCLDVPHPFSNPGKGASKLAANAPPSRL
2326   APA_23030   2498360   2496996   -   MTSRQISQHKRCSVAWRGKRLAHAAKGSVILGLLALLSACANQPSGD
2327   APA_23040   2498550   2499413   +   MTATSGSSAQFSGSGLPTQPGRASRSRLVSACNDIAGGLRLWRLALS
2328   APA_23050   2499410   2500252   +   MTGSSAPTSTKTTAEPASISITDLSLSFPIFHGGARSLKKMLLKRGKSL
2329   APA_23060   2500268   2500618   +   MMNTLIFLLRSFGIYLLAGFAEIAGCFAVWLWIKEGRSGWLTIPGLISL
2330   APA_23070   2501683   2500622   -                                  corA
                                           MPNPPSAGALPDLLSEGGTLLRDGLVWAIFCRPGKEPVELGRDVVTQ
2331   APA_23080   2502233   2501829   -   VGERLCAFGAGFQRVISALCRQRGHNVGRALFCCNEVQLMRAYRGQ
2332   APA_23090   2503364   2502294   -   MSRFWSPLVHKLTPYVPGEQPKMTDLIKLNTNESPYGPSPRALEAIRA
2333   APA_23100   2504034   2503462   -   MTEVSSRTPSEQGTAAPATGGGAQGFTREQIEALFLNAAREGDADM
2334   APA_23110   2504374   2506476   +   MRVSLPTPVRAPAQTQGSGASSLDTLCINTIRALVMDTVQKANSGHP
2335   APA_23120   2506561   2509416   +   MTSSASPSANPLRTLAKAHQSPWLDFIRRSFVEDGSLARLVQDDDIRG
2336   APA_23130   2509438   2510436   +   MQIGIVGLGRMGGNIAVRLTRHGHDVVVYDRDTAMVEKTVARAEA
2337   APA_23140   2510473   2511360   +   MTDNGQNGLNPGRPPASRIRLVVSDMDGTLLTPEKQVTRHSIAAIQT
2338   APA_23150   2511357   2512103   +   VTEQNTANGALHISATRDSLMHDLADWLVKQTLQRPEAPFRIALSGG
2339   APA_23160   2512120   2512833   +   MTATPPDPAAAFKQQAAIKAASLVQDGMAVGLGTGSTAKFVVAELG
2340   APA_23170   2512844   2513428   +   MPQNASAYPTDSTLPTQPAAQVITRHLLVVMGVCGSGKSTVAEGLH
2341   APA_23180   2513447   2513674   +   VGHNYAKPLTSGQKMERLLTRIPPGWHIALERQIGEATWRALTHAPD
2342   APA_23190   2513908   2513696   -   VRKHKVMLGDKLLYQASQLSHAQRFAKARQAEGVPCHVVPDETPK
2343   APA_23200   2514004   2515026   +   MASLLTRLCCSTLLIAGVGSFIAPAATARSVTDMSGHTVEIKDDHPPI
2344   APA_23210   2515111   2516877   +   MTGLLDHLRTHKTPTRLLLTLRALVRTDSLWLVVLAVLIGLLAGGAV
2345   APA_23220   2517000   2518031   +   MPAPTLLPSTMKAICFTQAGAPDVLHLETIQVPQPGRGEVLVRVMAA
2346   APA_23230   2518176   2518874   +   METPSTLPSSVLADRLAAVRQNIDASAHAAGRDPASVTLVAVSKFHP
2347   APA_23240   2518988   2520970   +   MTDPANKSAGSPPTGDQPHVASAPEPRRITEFDADQPQHAAAPVGFA
2348   APA_23250   2520975   2522129   +   VEQDALALYIHWPFCLAKCPYCDFNSHVRAEIPQARFAQALRTELAY
2349   APA_23260   2522174   2522608   +   MLNLIKLAVGVESLEDLSERLKQPFNTRSHPDYDTPLPVVHTRSFPKQ
2350   APA_23270   2522979   2522617   -   MPIKHFIKGLTVCYFVCAVTVAAFAQSSLHNIAVCQLTAGHPVFCSK
2352   APA_23290   2524140   2523445   -   MLRVEDVHLHYGAAIALRGVSLEACAGKVTCVLGRNGVGKTSLMR
2353   APA_23300   2524919   2524179   -   MSETLLLEMHDVSVTFDGFRAINGLNLTLRPGEMRAIIGPNGAGKTT
2354   APA_23310   2526055   2524916   -   MNALSPSATKSFPGAIRMAAVAFAVTIVLAGASLLPEANPLHVSAFVV
2355   APA_23320   2527656   2526052   -   MRRFSHFLWAGIVCLLLAFSGVRVAAADEFSGLESGQFNTIADTVSA
2356   APA_23330   2528989   2527649   -   MSDILPKLSRRAFGRLALASSVAAIGAAYRPGQALAAAPTGQPIKVGI
2357   APA_23340   2529129   2532446   +   LPHDASRLRIVRTRRAYNRWAADQTFEDYALRFTARSARTATPMRA
2358   APA_23350   2532443   2533330   +                                  luxR
                                           MKISSTQRRTILIVDDDPSVLGMMDETLSDNGYSVLLAQSGASALEV
2359   APA_23360   2533810   2533361   -   MSGDNKMQIMMHRSLKQAFVVFCGLFAGAAYADSDIQNLDCRHLFA
2360   APA_23370   2534817   2533861   -   MGTASQFHKYVKSTLNLERLRDGNWNVLDGILQIEPWKFFNVWMG
2361   APA_23380   2535294   2535650   +   MRLIDAQFLETPYYGSRQMTWHLRRLGHEVGRKRVRRLMAIMGLRA
2362   APA_23390   2537201   2535816   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
2363   APA_23400   2538072   2537746   -   MATRGKVMVALLSRFSSSRKTKLFQCGTTVLSLCAVVSAALPQSSHA
2364   APA_23410   2538938   2538324   -                                  ureG
                                           MTDIKYGPLRVGIGGPVGTGKTALMDALCRRFRDVYNIAAITNDIYT
2365   APA_23420   2539600   2538935   -                                  ureF
                                           MEGKDFLRLLSWVSPAFPTGGYAYSHGLEWAVENGDVNNVTSLCQ
2366   APA_23430   2540096   2539611   -                                  ureE
                                           MQRIIEILPAGSWPEAAATEIFAADYEGRHRRRLVIDLQSGEKVLLDL
2367   APA_23440   2541802   2540096   -   MTRLSRYEYAGQFGPTTGDRVRLADTALLVEVEKDFTIYGEEARFGG
2368   APA_23450   2542107   2541799   -   VPGEILVAQGEIVLNEGQPQRKLMVSNTGDRPIQVGSHYHFYEVNPA
2369   APA_23460   2542429   2542127   -   MKLTPREKDKLLIAMAAMVARRRLERGVRLNYPEAVALITDHVVEG
2370   APA_23470   2543270   2542458   -                                  ureD
                                           VPLLQRAYGRFGLKVRNDRSQTRCHGLEQKGCCRLLFPRVAGGQME
2371   APA_23480   2543459   2544493   +   MRRRLCYKFNTFQENIIWKAIGLFTILGGFNIAAWFWAFSAFHASPSL
2372   APA_23490   2546236   2544560   -   MTYTVGMYLAERLSQIGLKHHFAVAGDFNLVLLDQLLVNKEMEQV
2373   APA_23500   2547140   2546547   -   MMSNLPVVRVVLVGSLMSQDVRKGCIPREDEIIKFQFSKEIQEKILEE
2374   APA_23510   2547257   2549221   +   MSIFSIRFISKLNHKTCYIAAVLALTGCTPPVSVKQLSLTEAYQDRTHT
2375   APA_23520   2549218   2550243   +   MSKLPHNSSTHGWIFWMKAAGVCLFSLYSAAAFYYSTLTPDILRLGL
2376   APA_23530   2550430   2550915   +   MVKDPKVIEHLNTQLTNELTAINQYFLHARTLRHWGVTLLGKKEYE
2377   APA_23540   2551327   2550968   -   MSVPITIYGIKSCDTMRKAMKWLEAHSVGYSFHDYKKQGIDTATLK
2378   APA_23550   2551799   2551353   -   MTKNVIQQRVEWAREGKFPQVIGRMPSGWLIVADTQPVQGYCQLLS
2379   APA_23560   2552432   2551869   -   MDSPKHRCKWACGNMLLRDYHDAEWGKPIKDARTLWETLVLESFQ
2380   APA_23570   2552878   2552447   -                                   arsR
                                           MVEMSLDEAKQLVEQLKLFAQPQRLMILDALLQHGALAVGELESKT
2381   APA_23580   2553563   2552883   -   MRVNTAAMNDRIIDTSQLEPVVAAPRIGDMAPDFMARTTQGMLTLS
2382   APA_23590   2553652   2554578   +   MSDPAIATATQQILMAVQHPEQRPVVKTFFDEKTFTASHVVHDPQTL
2383   APA_23600   2554608   2555393   +   MLTLFSAHLLLELMSGVLVGFTLGLIGGGGSILAVPLMVYLVGVKNP
2384   APA_23610   2557079   2555388   -   MSPLLGIKNWLGQRITKKSGSWSDMLAGLSLASMNIPQVLGYARIAE
2385   APA_23620   2557160   2557441   +   MSVTLYHNPSCGTSRTVLGLIRDAGIEPNIILYLKTPPTRAELENILAK
2386   APA_23630   2557445   2558884   +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
2387   APA_23640   2560010   2559276   -                                   pirin
                                           MITIRRADTLGNAHSDTLILRCHFAFSDYQDPAYTHDGRLRVLNLGT
2388   APA_23650   2561543   2560020   -   MKRLLLSGLSVIALSGCTVGPNYHKPQVKAPADWRAMQPPAESQITT
2389   APA_23660   2562624   2561548   -   MIYKKPLLYAGCAAAVLALVAWGGSRLINGDGINQYTNDAYVTADF
2390   APA_23670   2564277   2562640   -   MNNAAPAQGVGAPVIHAAPPRPSYIPPFGLRTVIGCLGMLLAVHVAG
2391   APA_23680   2564398   2565321   +   MKGYDLDLLRYLQVLIEEESVSLAARRLKVSEPAMSRQLAKLRKAFA
2392   APA_23690   2566892   2565507   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
2393   APA_23700   2568682   2567093   -   VMQNTGLHAVSFSCRATKFMGCCGVFGGLLPSLVFAEPQHTEKMEQ
2394   APA_23710   2570108   2568801   -   MRSVAVSGQTSRSEPSGNRLFSTMAWRILPLLFLGFLASYLDRVNVG
2395   APA_23720   2571131   2570520   -   VVAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQGSP
2396   APA_23730   2572146   2571355   -   MGDPPLLSSQEVLMKKIYRIGQIVPSSNITMETEIPALLKLRENIRPERF
2397   APA_23740   2572995   2572201   -   MSAEKFLYGANVYANGIRQHYLRYGGKGKPLVLAPGITSPAITWGFV
2398   APA_23750   2573649   2573017   -   MTTEDMRDEARYQKQGFGNEIGIVGGIGLLIIDFVNGFADPEAFGGG
2399   APA_23760   2574686   2573649   -   MPVSDFELVQSWRQVLDLCNLQSGQSVTILTSIGTNAQTLRCAILAVQ
2400   APA_23770   2578326   2574754   -   MTGVLQIFRKSLPPKGLSARGEFIPRDEVLVQIEENGQVLGFCGHVDL
2401   APA_23780   2578805   2578323   -   MAASVFLTVNGCRHAITAAGNTPLLAILRNDLGLNGPKYGCGLGACG
2402   APA_23790   2579953   2578829   -   MSGGVRIGIAGAGLGGVAAAGLLEKAGFDVVLFDQAPAFSRLGAGIQ
2403   APA_23800   2580712   2580260   -                                   marR
                                           MKGNKNKAEQNYALDEQVGFLLRRAYQRHTAIFQEHIPDQHLTSAQ
2404   APA_23810   2582825   2581440   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVIVVKQADDILG
2405   APA_23820   2585039   2582883   -   MVDMKRDRPHLHIEGGGEKELYTSPKRGDSGLPPARVRAAHARKLE
2406   APA_23830   2586037   2585054   -   MTTARHIVALLQSHIAGDEQRFLSVATQLAAHEARQGHGKLAQELRE
2407   APA_23840   2587623   2586454   -                                   trbI
                                           MTGQAPTAGSTAGAAPPPNLRLRADRPRVVRLSRTVVWSLGGVGM
2408   APA_23850   2589061   2588171   -   MTRFIEEHRQTYVVGSICRVLSIAPSAYYATVARQKNPCVRSQKDKE
2409   APA_23860   2589381   2589058   -   MSNKSKRFPPEFRERAARMVLEEEKNHPSRWSAVMMIAPKLDIHPDT
2410   APA_23870   2589929   2589396   -                                   trbG
                                           MIRMVMRAVPLALLTLSACAGQYHPPVIRYDDAVEARRQPDPPKPV
2411   APA_23880   2590618   2589926   -                                   trbF
                                           MRTMFRRSTSRYGITPAPVTLYQKAAQIWDERIGSARLQARNWRLM
2412   APA_23890   2591427   2590615   -                                   trbL
                                           VLGNVVSSGVKVMVLAVISAITSVLFRQFNISYGDAVPTIGQSVSVVL
2413   APA_23900   2593070   2591685   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVIVVKQADDILG
2414   APA_23910   2593994   2593128   -   MTRVALYARYSSDNQRDASIEDQFRICREHAKREKWKVIGAYKDAG
2415   APA_23920   2594403   2594023   -   MTADLKPIRSEADYDAALEEVGRLWGAKSGTPDGDRLDVLATLIDA
2416   APA_23930   2595045   2594818   -   MTGKVDRMARKPDRIRIEVFGPTEAETAEEAFRPSNEAVRSLARLIGR
2417   APA_23940   2595153   2595557   +   VEKVIILLAIGYAIGFYIRGRRAAADLAQAGQQIAERNARLQSLDRQIS
2418   APA_23950   2597085   2595700   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
2419   APA_23960   2598175   2597285   -   MTRFIEEHRQTYVVGSICRVLSIAPSAYYATVARQKNPCVRSQKDKE
2420   APA_23970   2598495   2598172   -   MSTKSKRFPPEFRERAARMVLEEEKNHPSRWSAVMMIAPKLDIHPDT
2421   APA_23980   2598707   2599255   +   VIELREVLANADDPAVMPINLADLPDLVARLDDGDAWHGFWPSRAS
2422   APA_23990   2599858   2600019   +   MPIAIDIGIKIIPLAEVHESFPDLPVYTRIDGKIMATNIPGSVIYPWSLTG
2423   APA_24000   2600134   2600520   +   MSDGGIGVYAVVSRVIMRRLYAGATSVHAVAVWPSFPNATVLMIRH
2424   APA_24010   2601332   2600571   -   MSLSRGDERKLHALSQGKCNLCSRSVFTCGTYVGENAHIIAFRINGPR
2425   APA_24020   2601388   2601807   +   LSILFPRAITFYVGNNSILGCRNHALLIPALSISPLLRHGSPWPAVVADS
2426   APA_24030   2601834   2602379   +                                   repA
                                           MAGVMPQRGQQGRESERLRLDPFVIAGGDASPRDQRDLMERPFFSLS
2427   APA_24040   2603307   2602417   -   MTRFIEEHRQTYVVGSICRVLSIAPSAYYATVARQKNPCVRSQKDKE
2428   APA_24050   2603525   2603304   -   MMIAPKLDIHPDTLSKWTRLHERANAPAVSDLPDREKIRQLERENRE
2429   APA_24060   2603710   2605095   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVIVVKQADDILG
2430   APA_24070   2605556   2606152   +   VLSGLKNRMMAPEIAAEAMRAYAEETNRLNRERRSNADVWQVEQV
2437   APA_24140   2612800   2611826   -   LTLLVTGAAGFVGFHVTQALLARGEQVIGIDNLNGYYNPQLKQARLA
2438   APA_24150   2613415   2612885   -   MMGPRRTDKVLTKKLLGLMAACMIGGAAGSLLPAYAEETGEPTQAQ
2439   APA_24160   2614083   2613412   -   MQVNYPDMQLRIVPVTPFRQNCSVLWHEKTRKAVIVDAGGDVDVL
2440   APA_24170   2614618   2614196   -   MYSMTEARDGLVVYVVADGGKVRFLHDAEGEMRDVQDFDTRGHE
2441   APA_24180   2614734   2615825   +                                  xdhC
                                           MTVPALFSQLVTPLDHALLWARQGQAVALATVTGTWGSSPRPAGSN
2442   APA_24190   2615819   2616469   +   VVTPSFLRGTWACVLCAGRSSRTAPANKLLAPDAAGQPMVVQTLKN
2443   APA_24200   2616557   2616907   +                                  yjgF
                                           MSKILRTNPNPILSAAVEYHGFIFTQGVVARNLDQDVEGQTRDVLEQ
2444   APA_24210   2617201   2617974   +   MRSGKVSTMRHGRSGILKLKLAVLSFLSVSAFTASASARTYHAASHH
2445   APA_24220   2621102   2618142   -   MARSRRALFRKNFYMFSLAPGSDARSQHSLEALPAFAALKAEGEAFA
2446   APA_24230   2621488   2621123   -   MTLYFTKEHEWLRVDGETATVGITRHAADELGELVFIEARPSGTEVK
2447   APA_24240   2622668   2621532   -   MGTDTLLHTPLYSLHEESGGKMVPFAGYAMPLQYADGIMAEHRHV
2448   APA_24250   2623838   2622966   -   MAETWIEETLYDNWGQRFRVVKELARTRSPFQDIVVFESDSHGRVLM
2449   APA_24260   2624417   2623950   -   MNALAQLGMVSEHPSNNQAFSVPVSSADEERKDYFVEKNGEKFAGT
2450   APA_24270   2626998   2624572   -   MQAVCCQKQHCGMFEVGGDVATGKSVMGKYMCGMLSACLLLPML
2451   APA_24280   2627063   2627980   +   MLDRITSMQIFVKVIAAGSFTGAARLMALSPTMVTKHVTALETRLGV
2453   APA_24300   2628790   2628299   -   MSSEDKNDIIHMDIPHGRVIIKLRPDLAPKAAERIRTLAAEGFYDNVP
2454   APA_24310   2629371   2628832   -   MNTPVGSVPKRVGFYAGTFDPVTVGHLDVIERASRLVDRLVIGVAYN
2455   APA_24320   2632133   2629368   -   LTEISDQPGVPEPSDLLPVTIEEEMRSSYLAYAMSVIVSRALPDVRDG
2456   APA_24330   2632327   2632512   +   MRLLLALLFPWFQFFTIGRPFSGIICLILQITVIGWIPAAIWSVYALNQY
2457   APA_24340   2634019   2632601   -   MKAINTVRMGGVDILPLVEGGKGVSVSTGVSAGAWAAAGGAGTVS
2458   APA_24350   2636229   2634079   -   MFNYFRKEIEWGGRPLILETGKVARQADGAVMVTYGETVVLCTAVG
2459   APA_24360   2636776   2636507   -   MSITAERRTQVIAEYQTAPGDTGSPEVQVAILTERINNLTEHLKTHAK
2460   APA_24370   2637758   2636808   -                                  truB
                                           MVFDESHTGVFMRRRRGRPLNGWLIVDKPSGMTSTQVVGRAKRLFD
2461   APA_24380   2638027   2639184   +   MADQSPSSGLHKAADTPAWSLQNTADGVCLNVEGAWTVQAGGATP
2462   APA_24390   2639184   2639969   +   MMSDAETLISVRDLQLSFGPKIIQQNVSFDLKRGSIFAIMGGSGCGKS
2463   APA_24400   2639975   2640931   +   MSQSTNRKTLIGAFVILGGLLGLFIIMAFGHMRFFTPSREAAVVFQNS
2464   APA_24410   2640931   2641518   +   MFPPRRIALAFLGACTLLAGCASPPLRLYTLGMPGDRDIQQPHLSARL
2465   APA_24420   2643010   2641571   -   LKYLFIHQNFPGQYLHIVRHLVQNDDNEVVFISEDNQNAIKGVRRVR
2466   APA_24430   2644233   2643088   -   MSQASQQRITDLKVTGHLMTLQTGLFCISHAAGQQPPTSAGLPGVRI
2467   APA_24440   2647389   2644303   -   MSMAALNQSESQQAGFVTEADRIAYEQRASALAQESFRQGNTAWQE
2471   APA_24450   2649229   2647457   -   LVWKLFQKTFGKSGKDVQSRLEQAKAQLKEQPVEAFSKLAVLAREG
2472   APA_24460   2650740   2649277   -                                  hlyD
                                           MSEQDAQVVPNDPSDDKQQKAVTPASDDFLKQADDPYAQGDMPVA
2473   APA_24470   2653000   2650745   -   VDQTDHVPEQAGSPSDTDRGQGAPVSAPVIRLKAVVAAAKYHGLEL
2474   APA_24480   2653575   2653183   -   MSTSLIEQSVKPRDGRIMLHVCISVPDKKSDDHEDALLFVNTEITQEQ
2475   APA_24490   2653608   2657171   +   VLCGVGKAPFPFLLYFMVAMSSRLPLLDALRDQVLLCDGGMGSRIQM
2476   APA_24500   2657193   2657543   +   MQRIIHLMVTSPPPASPPASAALKRLCRQVGLHATNCTAAFIDNRQQD
2477   APA_24510   2657595   2658119   +                                  cvpA
                                           MAAIDALSLLIIGLSALHGAWRGFTRHALGFVSWGIAIVLALRFHAAF
2478   APA_24520   2658166   2659653   +   MLAHPTPSASLPDPLTLDDDHPHEECAVFGIWNAKDAAPLTTLGLHA
2479   APA_24530   2660434   2659736   -   MTQTGSCKPMKTRLDRRMLLRLSGVAGLGVMAFTLTACSGGSPSLY
2480   APA_24540   2662148   2660439   -   VNGHSHNHFSPPEGESAQDALVRRIRFSIIWIIPIVSVLIAGFLVWRSFM
2481   APA_24550   2663614   2662145   -   MNMSQLFGLVREALNPGQNVPVDQKRHVRLVQGIVECPCCGHYQH
2483   APA_24570   2665635   2663944   -   MLNQKNGHQPLSLKALLLLGLAAFLLFLPGRAVTPPFDRDEPRYMEA
2484   APA_24580   2666402   2665629   -   VTGLVSAAPSQHNDAQCELSIVIAVLDEQDNLPQVCRELAEAMQQLP
2485   APA_24590   2666932   2666429   -   MSGIFHEAGFWVAVSFVLFFVLVGKKIWLPITTVLDSRANRIREELDE
2486   APA_24600   2667537   2666956   -   MLRAGLLATVSGVSLLAVSAPGAYATGMPQLDFANPLVTGQVMWG
2487   APA_24610   2667811   2667587   -   MDIAAAREIGAGIAVIALAGVGIGLGNIFSTLVSSIARNPASRPHVFGL
2488   APA_24620   2668616   2667867   -   VAGGSSINVLEQFELHPVLGGLGEALRFSQSPLYMIVAVCLVLAFLYF
2489   APA_24630   2668973   2668671   -   MSKNGDDSFDARLKAAERRSGLEKKEDSAEKEDAVEQSLPGLALRA
2490   APA_24640   2670022   2669093   -                                  ftsY
                                           MALGFFSRLKQGLSRSTQKLGGGITGIFTKRKLDDEALEELEDLLITA
2491   APA_24650   2671268   2670024   -                                  miaB
                                           MSKPEILTFGCRLNTWESEVMRNHAASLDNVIIVNTCAVTGEAERQA
2492   APA_24660   2672077   2671265   -   MLTSFRKMHGLGNDFVILDERNGHLSLTPARIAALAHRRRGIGCDQL
2493   APA_24670   2672584   2672183   -   MAKMIHSMLRVLDEARSTHFYADTLGIKPVGRFEFESFTLVYLANDE
2494   APA_24680   2672630   2674675   +   VLNAHLFSLKLFFKERALYGKPRKMVHIHIRTTSTIFEKRMRIFRQFSC
2495   APA_24690   2674797   2676557   +   MPFQNAPAPLARALAARGFTAPTAVQAAVLADDAKNRDLLVSARTG
2496   APA_24700   2677206   2676619   -   MRFIQKFAVMSLSVAALAGTASLAHADPCLSLTGCLQQDAQDQLNA
2497   APA_24710   2677364   2678956   +   MRIVMKPVFYPAKWPSFSKLKLASSLAVALSLSTTAIAATEPSPPPAK
2498   APA_24720   2679511   2679023   -   MSETQERTGTLADLKTVVPEIASDAPVYEAKRDAQGRSYATGRRKD
2499   APA_24730   2679993   2679517   -   MKTTLSLKPAEVTKNWILIDAEGLALGRLAVIIAQRLRGKHKPQFTPH
2500   APA_24740   2680200   2681531   +   VKKNVLVMISGIAILGGIGWLGARHAEHLMLDKSIERFRQTLGPDAS
2501   APA_24750   2681531   2682403   +   MLPLHTLQPMADPVHVIGASGRSGRAVCQALLAQGVPVVPIVRNAS
2502   APA_24760   2683147   2682431   -                                  phoU
                                           MGNEPAHTVTRYDQELDRLRGIVARMGGLVERQTAQAIAAVVDQD
2503   APA_24770   2683995   2683165   -                                  pstB
                                           MSVEVQTETVAAEQTVTVAETEKDARPIALQVRDLNFYYGKSHALH
2504   APA_24780   2684867   2683992   -                                  pstA
                                           MATSRSLLRSDRSASLLLRRKITDRMATGLSWLAMLIVVCVLGSILW
2505   APA_24790   2685853   2684870   -                                  pstC
                                           MEISARQPLPATKKNHPAGGVRTADPFFRMLVMATGIGVLVVLGAII
2506   APA_24800   2686118   2687986   +   MAGYRSRTTTHGRNMAGARSLWRATGMKDSDFGKPIIAVANSFTQF
2507   APA_24810   2688812   2688111   -   MSSLVTGSVAVCTLAVAGLAAPSAAHAQASVLLKNQTATAVVETVD
2509   APA_24830   2690273   2689278   -   MRQEMASDLNTVVRVHHTGPPDVLCVETLPVPQPQKGEVLLRQEAI
2510   APA_24840   2691404   2690376   -   MIPFSIQAPWLNNAVARQTVRLLSAVGLSGFMVWLTNLQEPGWAIIT
2511   APA_24850   2692936   2693058   +   MKKQSFCQTAAGKCILSLWHERAERSARFTHAVFVLPISA
2512   APA_24860   2692937   2691405   -                                  htrA
                                           MRISVRFARVFSLSGLLLAGASFVHPARADQAATATPPVVVAQRVPE
2513   APA_24870   2693725   2693069   -   LHHKGNIMPLTKLSALPHVARLLQYKKPVKITLFGSSSTEGVGASSIA
2514   APA_24880   2694948   2693737   -   MTHMVNAVADGRVEKMTSQAEKTSGSGVVSAQPPKPVAGRGRDHR
2515   APA_24890   2695106   2696221   +                                  apbC
                                           VAQPPSVSSQDIARVLENVKDPQTGKNLLAYGHLEGCSLTEGKLSVA
2516   APA_24900   2696577   2696296   -   MGDRMTNFMQRISIVFSGVAMIGLAYPAHADTLREKQTEACKGDAL
2517   APA_24910   2696896   2696618   -   MTNKPDETNAFKGETPLFEQIVQEGSHGKKLRQPFKPTYLPPLWPFV
2518   APA_24920   2697860   2696919   -                                  thyX
                                           VFCKDFSKGQTMSLTDEQRAEIAAHGQETFATRRPTVPALEAMLYEP
2519   APA_24930   2698451   2698987   +   MADDHDPTQDDSLFPAPSLLPYERWLNEASRSVMLNALEHVSREGL
2520   APA_24940   2699034   2700686   +   MTSQPPRPPVPEFAYSPLFPMGEDKTTYRKLDLAGVSTSQCGGKTVL
2521   APA_24950   2700747   2701139   +   MRFTVDRLDHVVLTVRDVEISASWFQRVLGMDREEYGRNNRTALRF
2522   APA_24960   2702720   2701188   -   MKTKCVPDVWKNKKPDLSEKRKSFLKTGALLLAGSLFLGVANISGQ
2523   APA_24970   2702924   2702763   -   MRFPLVRTAKNLPSKALFLHTLCFMLTFVGTLHSCWNVFMRLAYKP
2524   APA_24980   2704229   2702970   -   MKILVLGSGVVGVTSAWYLAKAGHEVTVVDRQPEAGMETSFANAG
2525   APA_24990   2705405   2704260   -   VAVVNTVSSSARTLWPASRAGAVLTVNLSAIAENYRYLKSRLGKTAC
2526   APA_25000   2705534   2705986   +                                  asnC
                                           MPDRVTEAILRQLEHNGRLSNAELAAKVGLSPSACLRRVRMLEQQG
2527   APA_25010   2706455   2705991   -   MSRKNGSGSKVAGPAGYLAGLAPSGPSQRQLRVGEEVRRVLAEVFA
2528   APA_25020   2709121   2706452   -   MSEGKDQDQGKGRLSLRPAGRSEVGRTVDAGSVRQSFSHGRSKVVQ
2529   APA_25030   2709768   2709118   -   VGGDFLPETEEKGSLRRCAVTREEGEPSLMIRFVISPSGEVVPDLDAR
2530   APA_25040   2711326   2709782   -                                  nusA
                                           MDTSVSRPELLLVADAVSREKGIEREEVLEAMEQAIQKAGRAKYGH
2531   APA_25050   2711962   2711357   -   VALTAAFFALDTDLSTHSGLEARVAALIAPAVEDMGYEIVRVAVLGR
2532   APA_25060   2712196   2712792   +   MHKEPEPAWKPQPQPQAADKPSGVRMALIGLATCVIMAGAGVHFM
2533   APA_25070   2712789   2714072   +                                  clpA
                                           MKGLLPALNRLMPLMMVIFLVLASIQIALSLHLSLHSITHVLQWCAPA
2534   APA_25080   2714116   2715084   +   MSAFTRLWQRAPVWRVALFTAGACSVFSVMFPAPWLTSRLPAYAKL
2535   APA_25090   2716074   2715124   -   MCACSQGQCWTSMDLLSALHSFVRVAATGSFSAVSRETGVSQPTISR
2536   APA_25100   2717809   2716250   -   VKQNAQYCPPRFWGLFLRCVCMLLAVSWLGAGAHVAHAQEEKPIR
2537   APA_25110   2718567   2717806   -   VEDPVVLSAEHLHKNFGEGDVLCGVSMQVRKGELVSIIGPSGCGKST
2538   APA_25120   2721325   2718632   -   MKTVGHDKLKTGRTLEVDGKTYHYFSIPEAAKTIGDVSRLPVSLKVL
2539   APA_25130   2721517   2722263   +                                  ccmA
                                           LRPCTVTIRRSVIADSPFPAGQSAPIGPETGAFPALYAEDLCVFRGERL
2540   APA_25140   2722260   2722928   +                                  ccmB
                                           MIGLFWAIVGRDLRLALRHGADTMGAILFFIVTATLFPLALGPSPELL
2541   APA_25150   2723773   2722985   -   VLSRSTIRTQTRPLWMAFGKGEIMKKTGMLLGALLAATTAVAPAWA
2542   APA_25160   2725134   2723821   -   MHAPTQQRTCHWPSEVTQRRQAFWQSGCFVHLPLVAGPLDRFATSF
2543   APA_25170   2725319   2726389   +   MPLLFWCAATSLSLVPQKVPLTLTKDAPIPMQVICQPDTRPSVHPDSH
2544   APA_25180   2727204   2726488   -   VLNISDYKSVLHSEGRKRLLLQCEHGLLANRTMSENGVNRRMSALR
2545   APA_25190   2727320   2727793   +   VLRPLPVMERPLIAVLNGPNLNMLGQRQPEIYGRATLDDVEQLCLQT
2546   APA_25200   2727793   2728266   +   MSGLLVDAEAIRALAEILAETGLTEIEVSEKDSRIRVARMPAPVQAVA
2547   APA_25210   2728266   2729609   +   MFSKILIANRGEIALRILRACRELGIKTVAVHSTADEDAMHVRLADEA
2548   APA_25220   2731194   2729707   -   MKSEKKRAQEAIQNLEISPYAKHVLWIAAFVSAICGGLYGYDTGIISG
2549   APA_25230   2731603   2733480   +                                  thiC
                                           MSSVDSKQNAAPPITGGNPKPANTAAPAPGHVTTGAIRGSCKVYSSP
2550   APA_25240   2734085   2733555   -   MSSHPLAFLRLPNSLLMALDSRAYHFWFQPVHYLARIVHILTMAAFF
2551   APA_25250   2734160   2734519   +   MEYHTMKLLVAAIPLLAGAWICFPQQAHSQTVFQLTVKDHHFEPDH
2552   APA_25260   2734523   2735344   +                                  ftr1
                                           MLGSLIIVFREVMEAGLIVGIVLAATRGIPGRGWWVSGGIGAGVVGA
2553   APA_25270   2735378   2735929   +   VPYKNLRCRHMKSYLSILSAASVLTLAIALPAAAREYPVGGPVHAHD
2554   APA_25280   2736094   2737671   +                                  oprB
                                           MQKYRKNNRKFLKFFCLYATILTAPALAHGEETQVEQDRRRLGNSG
2555   APA_25290   2738589   2737855   -   MVGRLLARGMVAGILAALLSFVFAKIFGEPQVALAIAFEAAQDAAAG
2556   APA_25300   2738831   2738613   -   MNTSVHTAMPVAAAGQSIPVRAILPWAVFGLIVSALLIYFVGAEQGA
2557   APA_25310   2740569   2738977   -                                 oprB
                                           MPFPTNRIWKRFPYSLHCLLLAGGVLGNLPILAHGEETQVEQDRRRL
2558   APA_25320   2741027   2741974   +   MDQRYRIPPLAMLNAFTAFARTGGIRRAAAELRVDHAAISRHIRDLEN
2559   APA_25330   2742134   2743420   +   MATNKDLLNRRTNAVPRGVATSTPVFADRAENAEIWDVEGKRYVD
2560   APA_25340   2744453   2743797   -   VFGGIATDVAYICHKAFEYLHLTIRFSLKRMYLVSHNSFRMAATTLLG
2561   APA_25350   2744920   2744456   -                                 yqgF
                                           MTLLSLTDLVATLPRHARLLGIDPGKKQVGLALSDVSRMVASPFQTV
2562   APA_25360   2745001   2745288   +   MSLDLATTRRIAKLARIGLEEHELEATRQKLNGILGWIDQLAEVDVEG
2563   APA_25370   2745288   2746775   +   MLTGLTLTQAREGLAARKFSARELAKAQMDAIARLNPVLNAYITVLP
2564   APA_25380   2746772   2748226   +   MSYVIEGKTGPWEIVVGLEVHAQVISQSKLFSGASTKFGGDPNTQVS
2566   APA_25400   2750281   2748488   -   MPQASESHVESGRKASLFVDVLKFVVRRWLAFPLPLTITAGSILAATV
2567   APA_25410   2750350   2751207   +   MRMSMDAIQPDALHCPMAKKLTTAAPVTSDKPMDKSRAKKRTAAK
2568   APA_25420   2752275   2751247   -   MVFHHIPPQPQHAQAAPRVGILLVNLGTPDDTGYRAVRRYLSEFLSD
2569   APA_25430   2753351   2752278   -                                 mutY
                                           VTHPSAHALLHWYDRHRRTLPWRVVGQSHPDPYRVWLSEIMLQQT
2570   APA_25440   2753362   2753898   +   MKKEANGGKAVTPKSRTTRRSPQKTEAAPPPRARNLRSLAALLPAVT
2571   APA_25450   2753977   2754303   +   LPYKAQFFKSWAKPTLSGLCLTIKQQIQDNHRICAMLRKPNTTLNMT
2572   APA_25460   2754377   2755471   +   MSLLMGCSLAVSLRQKKRFLMAFASLAMLAGCANQPRSSYNPPGPA
2573   APA_25470   2755711   2756247   +   MLRRLMPCRPAASHAPAGFRHASTLLTACAGLGLLAACSSGDRSDNG
2574   APA_25480   2756307   2758925   +   MSQSSSTPTSYDFNTVEPKWQKAWADADIFTVPDVPPANKPKYYVL
2575   APA_25490   2758925   2759620   +   MAHSRFLLRSARLALAIAPLVALPVVLSGCGFQPLYGENGKNNVDVN
2576   APA_25500   2759636   2760649   +   MKIDARNLSRVLADPGAWRILLLHGEDTGLIKERAQNAVIKIAGSAD
2583   APA_25570   2768466   2766877   -   VQGLVFSIRHIIFGEGERVAKRNAQRTGALALVFMLAGCMVGPDYKK
2584   APA_25580   2768550   2769191   +                                 tetR
                                           MSESSSVSSLTSTCTGESEAKREQILKGAYNVFAEHGYEGASMSAIAR
2585   APA_25590   2770197   2769271   -   MTALVLLDHEEGQIRKAALSAVTAAAQLGDVHVLVAGDASIAQAAA
2586   APA_25600   2770949   2770200   -   MKILVPVKRVVDYNIKPRVKADGSGVDTTGVKMSMNPFDEIAVEEA
2587   APA_25610   2772650   2771013   -   MSEPVRESMEFDVVIVGGGPAGLAAAIRLRQLSPDLSVCLIEKGSEIG
2588   APA_25620   2773440   2772763   -   MSPDATAPDQSVTFSLPNLLAQTPVASDPFPHWMLENVLEPDACAAL
2589   APA_25630   2774962   2773577   -   MGAASVSDLISRYGGNLPRYTSYPTAASFTEAVGSQQVAGWLKALP
2590   APA_25640   2775804   2774971   -                                 ompW
                                           MVKFRSLFTAVVAGVAALAGTAKAQTAAPNAAYVNAPVMQRIPDA
2591   APA_25650   2776082   2776894   +                                 aadR
                                           MLKVPVFPDSAPMPPSPSAQALHPAGKRTGRADPDSARCLMCKVRE
2592   APA_25660   2778529   2776961   -                                 htrA
                                           MSGKSVTKVWARNRRRNWMSALLASCVLVTAAAPWCSTPARAEAD
2593   APA_25670   2779160   2778705   -   MTKQNGMALALQQAQLAAENGEVPVGAVLLDSNGNVLAQAGNRV
2594   APA_25680   2779321   2779533   +   MPCGIALLQSYQTRARRVRNMHSLSFILAAAAIGFGLAIADGVNYEPA
2595   APA_25690   2779658   2780389   +   MMEKRPVIGITLDLEDGGEGRYSRFKWYAMRENYMSAVSTAGGLPI
2596   APA_25700   2780386   2781162   +   VTQETRGERIAKWLARSGVASRRDAERMIEENRIRLNGQPVTHPATF
2597   APA_25710   2781162   2781746   +   MVRIIAGSRKGRLLTAPAGQATRPTADRVRQALFDMLLHAPWGGHA
2598   APA_25720   2781826   2782386   +                                 ssb
                                           MAGSVNKVILVGNLGKDPEVRSSQSGAKIVSFSLATSDTWNDRASGE
2599   APA_25730   2782448   2783722   +   MPPAVSSPLRVKLAGYLTAAGLVCLSIFPFFLFYSRALSDTFASVIGGL
2600   APA_25740   2783938   2784351   +                                 traR
                                           MITLPPDYRPSEDEEFMNPLQTEYFRQKLLKWRADLLKEAGDTLASL
2602   APA_25760   2785044   2785853   +   MRGMERPSLHPITQKKRIRPSPATLNRERAALSGFLQYCFDSQYIKAIP
2603   APA_25770   2786561   2785938   -   MLNECKGYIKNHPGISVVVVVLISVFIDRIIMCFSVNDLLKVIPSTIIGL
2604   APA_25780   2787133   2786555   -   VTNERFQVIFGYARTSTIEQEAGLEAQKRDLSLNGCERIYAEQISGSST
2605   APA_25790   2788063   2787452   -   VITCEAHELLTKWINKRISTEAGKKGSVFKWKEKSKGPFDDSKFNAA
2606   APA_25800   2788158   2789543   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVIVVKQADDILG
2607   APA_25810   2791646   2789709   -   VSRQKLTGFSFVINIYEREKEMLYSSANCGSGKTHSMIQLISINKNFYN
2608   APA_25820   2792459   2792118   -   VELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQRGIT
2609   APA_25830   2792920   2792501   -   VSACADCFPIFWGDRQMRRYSLRDDQWERIKDLLPGREGYVGGTAV
2610   APA_25840   2794327   2793236   -   VLYPKKIAYVINSLEGGGTGAMVPAITGFFRARGCDVGVFVLTPRDR
2611   APA_25850   2794839   2794453   -   VKKLALKLSALGLLCSLSACGGPYYGDGGLYYPYGYSGYGPVYDDY
2612   APA_25860   2796129   2794861   -   MVENGFKSSFMREAAARGFIFQCTDADALDALMAEKSVAAYIGFDP
2613   APA_25870   2797706   2796249   -                                 tldD
                                           MSSSSQHPGALAVTDQLFFHRPDAQLHKDDAEKLTKTALAGMEDGE
2614   APA_25880   2798527   2797832   -   MNEIRDLPKVLPSSQDHFLDGPKLAPGITRFWLIRHALVEENARMCM
2615   APA_25890   2800729   2798582   -   MTGTRQTDPMQWVHMVPELAFLANSSPVIGKPEQSNPFVCEKHNGI
2616   APA_25900   2800931   2801989   +   MRILLTGGCGFIGSAVIRHIIHNTSHSVLNVDCMTYAASPETVEDAPE
2617   APA_25910   2801986   2802897   +   MIHKPATPTPMKGILLAGGSGTRLYPMTLAASKQLLPVYDKPMVYY
2618   APA_25920   2802946   2803518   +   MKSERLAIPDVILITPPRFGDNRGFFSETYNIERMREAGITEPFVQDNQ
2619   APA_25930   2803521   2804426   +   MSILSETGGPVLVTGGKGQLATSLVNLGGPRIRCVGRPNFDFDRPETL
2620   APA_25940   2804507   2805481   +   VQTLNVQHGMDLPQHQETAPVAVLLSVYNGAAFLNDLLTSLKQQTH
2621   APA_25950   2805717   2808371   +                                  ftsK
                                           VFRLLESGSTPLARISPTQSDQYPPSSHKSTLRLRLEEGGGLALCVLAC
2622   APA_25960   2808539   2809045   +   LDTDTSGCLAIALRKQPLLALQQAFATKTAQKTYWAVVQTGPQEDT
2623   APA_25970   2810151   2809057   -   MCALRVLTVLPPRERFAPQQAGAIALLVHRTALEGETVVGASLSVPS
2624   APA_25980   2810881   2810210   -   MADGRLVIGTQRYSSWSLRGWLMVKLAQLNVDIDVVPLAGGGKTT
2625   APA_25990   2811988   2810906   -   MRILVAMSGGVDSSVVAARLLEEGHEVVGATLQLYDSRGAAKKGA
2626   APA_26000   2812360   2812016   -   MKQPLAGWKPMPQMTFVEQDGTEHKVDAPVGLSVLEIAHKHGIDLE
2627   APA_26010   2813571   2812408   -                                  nifS
                                           MASSIYFDHAATTPCDPRVRAVLLDVLDHENGNPHSTTHEAGMRAA
2628   APA_26020   2814764   2813580   -                                  nifS
                                           VAGDLIRGIMTSRTERNSSGSGVVYLDANATEPLRPQAREALLEAAD
2629   APA_26030   2815212   2815877   +   MPEVMFAGPDGRLEGRYHHSNEPNAPLALVLHPHPLHGGTMNNRIT
2630   APA_26040   2816715   2815945   -                                  spoU
                                           MTGRDGGAPLEPIGNTPVVILVRPQMAENIGTTARAMANGGLFHLRL
2631   APA_26050   2818145   2816712   -   MKGFLGAQDIASKPLLAHLGCMPHSHLPPHPVLSLHDSQSRATVPFT
2633   APA_26070   2819675   2818338   -                                  folC
                                           MTKAAACGPTAEFTGRTGAVLERLNNLYPALIDLSLGRLEALLAKLG
2634   APA_26080   2820588   2819683   -   MSWITEYVRPKIRGLLRRDVPDNLWTTCDSCSQMILTKELHKALNVC
2635   APA_26090   2821099   2820773   -   MSEHTLAVSDSSFDKDVLKASGLVLVDFWAEWCGPCKMIGPALEEIG
2636   APA_26100   2824799   2821227   -                                  uvrD/rep
                                           MSISAQKALQKAISQANAQQALASDPSASVFVSASAGSGKTKLLIDRL
2637   APA_26110   2827885   2824796   -   MKLATIPAHLPFLDQLALRWIETAHHNIEAIGEGIIVLPGRRAARALTE
2638   APA_26120   2828382   2827882   -   MVGQCMEKAKMARDMILQDEDATIKLATKLTEYARAGDAILLSGPL
2639   APA_26130   2828731   2829516   +                                  ctrA
                                           MRILLLENNFTSSRTIFSALTKASFSVDIAQCDQEAIELLRNYDYGLAI
2640   APA_26140   2830968   2829610   -   MSRMKRFFGTDGIRGTANVAPMTVEVAQKLGQAAGLHFKRGDHRH
2641   APA_26150   2832190   2831102   -   VERGGRNVASFRLGRADEMTYARLIEPLGLVYGSIAQAAIKQGDALP
2642   APA_26160   2834149   2832212   -                                  ftsH
                                           MNNLGRNLALWVSIILLLLLLVNMFQPGSTQHAAQQLAYSDFIADVD
2643   APA_26170   2835594   2834287   -                                  tilS
                                           VVSGKVSAPVLFGRDVFSDQPVSPACFAQCMAQLGPFFPDQSDYPPI
2644   APA_26180   2836367   2835603   -   MLWKGKNLMKVCFKASRYVRTGLAALAMATAISSVCVPVAWARDT
2645   APA_26190   2836967   2836485   -   MRLKVVAALGMVALLSACAHDNANTGASNSAASTQPTISGPVPGSE
2646   APA_26200   2838655   2837291   -                                  tolB
                                           MVMSTRPLISDQEADVLAGALRRRSLLGASVAAGGIMAMPVGAFAA
2647   APA_26210   2839686   2838679   -   MPMARPRRSDQIILRRSLYLSGGAHVALLLALLITLPPPKPPEEPPQPT
2648   APA_26220   2840148   2839717   -   MAMPSGGSGRRRRRPMAEINVTPMVDVMLVLLIIFMVTSPMMTSGV
2649   APA_26230   2840892   2840152   -   VQRQEALLDRAVDAANLGVSAAGDLSVWALFMHASLVVKIVMLGL
2650   APA_26240   2841404   2840991   -   MTTHSIDFRIYYEDTDAGGIVYHARYLAFAERARTEAIRSLGMPASSL
2651   APA_26250   2842477   2841401   -                                  ruvB
                                           MSAEFTPDREIDAARREEDVGESTLRPQTLHDFTGQKASRENLSIFIKA
2652   APA_26260   2843082   2842474   -                                  ruvA
                                           MIAFLCGLVIQVDLGSCVIDVNGVGYLVAASTRTLAALPNPPEKARL
2653   APA_26270   2843585   2843079   -                                  ruvC
                                           MVRLLGIDPGLRFTGWGVIDVEGNRLRHVENGVIATNSADSVPDRLK
2654   APA_26280   2844341   2843592   -   MAGHSQFKNIMHRKGAQDAKRSKQFGKVIRELTVATRSGLPDPAAN
2655   APA_26290   2847107   2844381   -                                  secA
                                           MLSRFVRALFGTANDRTLKIFQRRVPEINALEPQVQALDDTALSGKT
2656   APA_26300   2847196   2848254   +   VQNRTGAGCGQPTVPVEAGLKQGLPGGKPSFIQDKQVLMALKVLIH
2657   APA_26310   2848329   2849576   +                                  argJ
                                           MAQTIPVSPLALPMPELGVVRGIRLGAIAAGIRYKGRTDLVLAEMAP
2658   APA_26320   2849633   2850262   +   MSNSAPPPGWGAPSGDFYGTQPGTPAPVWIYAGFWWRVWAFLIDG
2659   APA_26330   2850310   2852943   +                                  mscS
                                           MPPNLPPTLEADWAAVFCAPLLSYPFSKGCSAPMAANSPDQSLSFSPS
2660   APA_26340   2852936   2853688   +   MPETGLNLSGGAISLDCIEKPLAQEGFAFLQAASMRPILQGFGLADWD
2661   APA_26350   2853881   2853717   -   MSEAERQNSVVSPASAASAYDTISFKECCQMAGAMFFVFACLALGLH
2662   APA_26360   2854048   2854464   +   LKQIASALLATSLLVSPVFAQTPDKPAATEKAAPAQPYSIASFMGKW
2663   APA_26370   2855442   2854528   -                                  dnaJ
                                           MSARDPYDVLGISKSASQDDIRKAYRKLAKKYHPDLNPNDKKAEEE
2664   APA_26380   2855609   2855439   -   MNNLTAEAYLKPRLEAFVKEAEQAGYSRDVVIALLMSLLDTDNFSD
2665   APA_26390   2855782   2856192   +   VASGAHTLYKAQNVRYRHTHTLLTFMPQTRMMEKPVMADKPRFFD
2666   APA_26400   2856250   2856750   +   MPALTSEASSMLTNPLDLMEQVIGGHGWTFERCTPTEMAAEAPSRW
2667   APA_26410   2856750   2857571   +   MTNTPLLPSILLVGCGKMGGAMLEGWLARGLAPSVVMDRHLAELPA
2668   APA_26420   2857629   2858270   +                                  tetR
                                           MDNDDFDAALVSSALTLAAERGWSSISVLDAARDAGLSLREARQRFP
2670   APA_26440   2858670   2859950   +   VLFLLLYQTAPVLMTNPSAPSPSLLKQSGIPAVLGGRTLSAFASQVQA
2671   APA_26450   2860294   2860025   -   MSKAFIAAVIQDSINCTGVAANQAANDLIDAIVEELKREGGFTLPSFG
2672   APA_26460   2860406   2861365   +   MQHLLNPPDPVSKNGSCDFSDTGLPPGSVCLFAAFAPDGILPIFTRFYL
2673   APA_26470   2864181   2861362   -   MAYSELPCNTPEKQQSTAEALTASYRASMRIQAMRMDDIAHEASSLR
2674   APA_26480   2865733   2864312   -   MPIITVVGASGNIQVTVDGAQNSALYNQATDLSNQLSSVISTLDAQN
2675   APA_26490   2866010   2869105   +   MPVAPSSLLESLSSLEDSPLFTPIVLIQNSTSGCENIPFLTWILKEAFFSG
2677   APA_26510   2869516   2871549   +   MFRSLYHQGFARVAACTLPVALANPAINAQRILESAKTAATDGAVLC
2678   APA_26520      2871625      2872221   +   MKASRQATIHRVTSETDIAITLDLDGSGQADIQTGLGFFDHMLTALAK
2679   APA_26530      2872323      2873024   +   MATGFRQGHQQQEGSMTQPLSIAVVDYEGGNLASAARAALRAAELS
2680   APA_26540      2873024      2874349   +                                 hisA
                                                 MTRNKRVQRILNLEEDDLQALCEAVDASILDGGGFGWLQPQGRQVL
2681   APA_26550      2874349      2875125   +                                 hisF
                                                 MLKLRVIPCLDVKNGRVVKGVNFVSLRDAGDPVEQAAVYDAAGAD
2682   APA_26560      2875134      2875568   +   MTKKAPSKTEAKTDTKSKKNKEALTLPEISEADISVLNRLYDVVQSR
2683   APA_26570      2875575      2875949   +   MAVTGRGPYDPQNVFAKILRGEIPCKAIFENEWVLAFYDIAPKAPVH
2684   APA_26580      2875983      2876579   +   MTPMDMLLSRASTDHLKAPAPSEAQMAEVLAAAMRAPDHGKLRPW
2685   APA_26590      2876576      2877760   +   MTHITDAVVIGGGPVGLATALSLEKAGLSVTVLERSSLPAWEEPSFDG
2686   APA_26600      2878197      2877781   -   VQQGDLFPQEQTLPPVSDTLWPRLTRSSFRSRFHLNCQDMTYLTEKG
2687   APA_26610      2878799      2878248   -   MSSPDHNQMSQDPFSREATRLRKSFFEMNLYEGFELLIMLVLTGLIM
2688   APA_26620      2879718      2879020   -   MITVHHLDNSRSQRILWLLEELELPYDIQFYKRDPKTMMAPKSLRAIH
2690   APA_26640      2881205      2880282   -                                 parB
                                                 MSGQSSRKSSARPKLGRGLAALLGDAAPVDEPASSPNKSASKAAPTA
2691   APA_26650      2881999      2881202   -                                 minD
                                                 VSKVKKSGKACHVFAVANQKGGVGKTTTAINLAASLAADGAKVVL
2692   APA_26660      2882588      2881992   -                                 gidB
                                                 MHKWPEGVHVSRETEEKLSAFVSLLEKWNPRINLVSSKDIENVWSRH
2693   APA_26670      2884452      2882572   -                                 gidA
                                                 MNKAYDVIVVGGGHAGCEAAAAAARCGAKTLLLTHHKNTVGAMS
2694   APA_26680      2885805      2884474   -                                 trmE
                                                 MAALGYQAEDTIFALSTGIERAAIAVLRVSGAGSRDILLRVCGKVPDA
2695   APA_26690      2885968      2886432   +   MPQLSLHSPLGPITLSEEDGKIISLDWGWGRDQTETPLLCQAREWLDN
2696   APA_26700      2887175      2886480   -   MWTAISKKIGLAALLVCGLSVPVFSAHAHPGPGGGGFGGGGGFGHG
2697   APA_26710      2887477      2888088   +   VVAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQGSP
2698   APA_26720      2888275      2888718   +   MAWKKATFVSLWLAALSLAICSTFIFIACGLKFSIFHSGLTVNQADFV
2700   APA_26740      2889579      2888995   -   MTIDVRAVAVFCGSRMGAKPVYQQAAQETGKELAQAGIRLVYGGG
2701   APA_26750      2890860      2889628   -   MNGDNDIEVASDAAGKTLWSIFAIVVFTLLCYIEIGLQMAVVPLFVKE
2702   APA_26760      2890957      2891532   +   MNMSSPNDEGYITVSTRIAYENPWTRVREDIIRLPNGKDGLYGIVERG
2703   APA_26770      2892020      2891568   -   MVIDALLPWLRWLIAFHIMSVMAWMAGLFYLPRLFVYHCQVAVGSQ
2704   APA_26780      2892724      2892023   -   MMAEQPLVLSPQGHLKLIIFDCDGVLVDSEETCCRISAEEARRVGMH
2705   APA_26790      2893800      2892721   -   MMTDQHIPSAKRLLRTLNGEALWPPPMWLMRQAGRFLPEFRAMRA
2706   APA_26800      2894170      2894802   +                                 maf
                                                 MQDLVLMPTPLQNRDSKLLLASGSFSRCKMLEEVGLDFEVRVGDVN
2708   APA_26820      2895878      2895063   -   MATVVDALVVEVLLQAEALKKGTQQVQTLFGNVTAGAGKMSAGV
2709   APA_26830      2896547      2895882   -   MKNNPTRKELAKIISEIQLTENNFSKIENAYFNAISSRDKLEQNLEEAR
2710   APA_26840      2897371      2896553   -   MLFPSMAFDQSVRVKSPEGHLRITQCVLSSACVCPYYGREIPGWRKL
2711   APA_26850      2898780      2897371   -   MSMSVLQAMRDPDLFGAEFNSPSWTAWEAFLAALLGEEMTDEQKT
2712   APA_26860      2899130      2898777   -   MKKIGPYSRPDSLKKLDGRSKEARLLKDVRSALVDHVGGAPSVTQL
2713   APA_26870      2899871      2899293   -   MRNAMKIGYARVSTVDQDAGLEAQIRDLKAAGCEKIFSEKISGTDSQ
2714   APA_26880      2901630      2900230   -   MTGAINADKAVQDGLRKAQTTLGSNNYALLTEHGMAAAFTERYKD
2715   APA_26890      2902493      2901627   -                                 recA
                                                 MGSCQVQLESQASKKGKNLMSTQKREHSRLALLPVAEKAQLLARHG
2716   APA_26900      2902512      2902685   +   MHLRGAVSLFSGWRFLFYGLLDFAGGKLLIYDSMDSVLIMVARPIFT
2717   APA_26910      2903316      2902792   -   VKNTAHRRKIGSVNLLVAIVLHNKNSTTNSQDRPMLSMRHSIKSQNP
2718   APA_26920      2903561      2903313   -   MAKHTSASQQCKSPVVTPDRLSVIQDATSELSCIGICLQAMSNGMLT
2719   APA_26930      2903682      2903554   -   MKRILREMSLFILLPLTCLAFRMTTGLARFTYRVAGKDWDHG
2720   APA_26940      2904053      2903679   -   VIRHQPMLIATHGLKERDGSYIPLLVFATVWRERVIMNNQMSLTGFE
2721   APA_26950      2904335      2904162   -   MAKRAYSTPIHTWAFHIFCTSLPALVVPALIALTLLGLGASDPVVTGH
4001   APA_40010   550          287          -   MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4004   APA_40020   986          648          -   MAGHHVEAMIARAHAQKRFMDDAGWRYVVELYGRYQSLLREQNA
4005   APA_40030   1065         2126         +   MVVGRNDCAKGRQMKDTVIGVDLAKNIFQVHGASRAGEVMFRKKL
4006   APA_40040   3710         2670         -   MEQIIRIGMDTSKSVFQLHGVNAKEQPVLRRKLSRREMVKFFEKLPP
4007   APA_40050   4186         3743         -   VVPPKPGKTPVGGRLIGYARVSTDDQGTDAQLNELRDAGCTMIFEKH
4008   APA_40060   4488         4739         +   MLTSRIHRRKPMGKPMSKATARANAAKSSIRAHVEHVFAHQKNRFN
4009   APA_40070   4985         6463         +   LNLNRNAISHVPDTVYTPRYDPALLRPGIVHLGCGNFHRGHQVVATQ
4010   APA_40080   7249         6536         -   MTDTVFPAHLLKHKQEPVHGVVFDMDGLLLDSESLAMEALVFAARD
4011   APA_40090   7955         8338         +   MRRDMDLVRQLLLKLEGIEKGPHDVLLIGGNSEEVAVDGRTSDEIYF
4012   APA_40100   8991         8629         -   MRPLGSGLSVRTYGCSEADDQENDGWAKKDTGEIVALYEMSSPVM
4013   APA_40110   9054         13013        +   MSSKPSHHSVLSYWHSALLDDAQMKISFSRDNLVALDEEGFEKGKLP
4014   APA_40120   13946        15385        +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
4015   APA_40130   15660        16088        +   LQKEAKGDLAKDEKADARYLEAKEKSILDIKVSVGKTVFNSNGQVV
4016   APA_40140   17675        16305        -   MAADELTGLIRYLGQEDWQECFGEVLGDHIGPALEAGDITFEDLAEM
4017   APA_40150   18114           18443           +   MDCLSRDPEDTKSIECKSVAHDSGEKQHVAAASYSRTLPNQNIAYHE
4018   APA_40160   19971           18586           -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4019   APA_40170   20180           20638           +   MKERATSAPEINSEEVQHLLASTVSLTDQRLVNQIRGMVEDMRSGVA
4020   APA_40180   20704           20967           +   MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4021   APA_40190   20964           21791           +   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
4022   APA_40200   21852           22514           +   MSMGAALVGGFSRLAGALATKLEAEPGKLSPGWLDRAREKSQRHDA
4023   APA_40210   22528           24903           +   MTVRGFLASVFMVLGLALYVSSAMAQSGSVTGSTTQSTMSGSSSEA
4024   APA_40220   24921           25322           +   MSDSGLGAFAAYMLGHNAGSAAERNSRFIRSIFDRSNAADYDEVLKL
4025   APA_40230   26349           25729           -   MSEHDNSFQASQKKGVIKTTAKLAKHVTGSPSDAVGWRQISGNFNV
4026   APA_40240   27353           26346           -   VLRFYPLALTLILLEPTVTQAQQCSIASNGTSSAPSPSLPPKRQSNPSDS
4027   APA_40250   27771           27394           -                                  traA
                                                       MHEEFYRGFSSLALLAKEDLPTCVREAIVFLEKHICRVIPDCPHPILRS
4028   APA_40260   28241           29626           +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4029   APA_40270   29841           30338           +   MRITLPHSKGDKKHQGTTIVIPRGITRHCPVRAWETWLRQSKLTPRN
4030   APA_40280   30763           31686           +                                  repA
                                                       MADVHHLLLQHGLDEARRLQNIDKNSRACVDAAHEVLCDEQQAIGI
4031   APA_40290   31897           32952           +                                  minD
                                                       MTENNAGNTLKKIRTNLGLSQAELKSLLNERLSRNYDRHTISRWENG
4032   APA_40300   32939           33811           +                                  parB
                                                       MSVARTFKKRNPSAFLEAQKGITTSFSTPFLGKGRFNHSFEVQLSELV
4035   APA_40324   34078           33887           -   MASTNHLRHTLRTGGSSVLLSFCPSVLLSFCPSVLLSFCPSVLLSFCPS
4037   APA_40330           34306           37014   +                                  snf2
                                                       MSMSASQLNLFDTTVLSGELAALWSLEDDQPIPEVSLPSPQTFRIPQR
4038   APA_40340           37211           37972   +   LPDAESVLFGFALRQTTGFVESLLRLAVLSWSVPDFSTLSRRQKSLTV
4039   APA_40350           38086           38364   +   MNNHDLIERIVATTDISKKDAKTALDTVFAAIIEAAAEGDDTAIPGFG
4040   APA_40360           38761           39069   +   MTGSDEPTHAAWRAHVDEQFDAIHESLRALHQRQTLILELLTPEERE
4041   APA_40370           39066           39662   +                                  traA
                                                       MMTFRKISAGCRGQVISNYYLQDIPDPDIDFRLDPTKAPDSDGARLTN
4042   APA_40380           39666           40181   +   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
4043   APA_40390           40239           41624   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4044   APA_40400           41908           43293   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4045   APA_40410           44257           43640   -   MKQPGFFDVEERLARLSGLGDQLEAFSRTVDFEVFRPDLELALAYSD
4046   APA_40420           44608           45201   +                                  tetR
                                                       MKIAEKHHAARQHILKAAKPLIGQRGFSAVGLTQILDVAGVPKGSFY
4047   APA_40430           45289           46446   +   MQNFEFYNPTRILFGKGMIARLDEQLSPEARVLVLYGGASAERSGTL
4048   APA_40440           46531           47922   +   MAYATTNPYTNEVVATFPEATDAEVQTALAEAHAAFEAWRDTSFAE
4049   APA_40450           48483           48169   -   MRFDMICEAHGIEHRLTKPNHPWTNGQVERMNRTIKEATVKRFHYD
4050   APA_40460           49128           48493   -   MGQIRHGSATTTHAVRAAIQRSQASLAALSEEFGINPKTVAKWRKRQ
4051   APA_40470           50572           49322   -   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
4052   APA_40480           51335           50886   -   MIKNIPGFEKISSIFDLFEEIAMLVLTLCIMVVAALGLIHVLYAVFEML
4053   APA_40490           52694           51372   -   MSDPFYAAFLSGESTTMMTRVYLDKSAFLKWTPRSGNVGFFLTAAIT
4054   APA_40500           53062           54768   +                                  kdpA
                                                       MSFYGWVAIMAFLICVIAMTRPLGGFLKRVLEGEQHVLGRIFGPVER
4055   APA_40510           54783           56891   +                                  kdpB
                                                       MALHLPHSEAPHGGRHSEHRSQSSLMQASLLLPAIRESFRKLDPRIMW
4056   APA_40520           56902           57525   +                                  kdpC
                                                       MTLIRQLRPALVIFGFLSVLTGLLYPLGITAISHLLLPEKAGGSLVHEN
4057   APA_40530           57525           60212   +                                  kdpD
                                                       MEAHLIRPDPDALLRQTVLDGESRKRGRLKVFLGAAPGVGKTFEML
4058   APA_40540           60209           60892   +                                  kdpE
                                                       MSNPSVLVVDDEPAIRRLLRTALGSQAWRVIEARTGEMALNMAMEV
4059   APA_40550           61150           62412   +                                  nhaAP
                                                       MDTISLFALLLTLSAGFSILNHHTFRLPVTIGVLVFSLLASLLVMILNPL
4060   APA_40560           63439           62717   -   VRNPRRECVREALLEGDEPWERRSWRTGATVTCERHRRVLEEACPR
4061   APA_40570           65050           63611   -   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
4062   APA_40580           67263           66433   -   MSDSSYSVHVISGLPRSGSTLLAALLRQNPQIIAASHNTPVMPMLIRIM
4063   APA_40590           65481           66443   +                                  araC
                                                       MAEKSTQTVASSDVPESRQTDTTQSSMIRLNAYTRLIALQSGLHILYW
4064   APA_40600           67808           69781   +   MNIGSISFSETVKKFSYRKDIDGIRAIAILMVIINHLNTKWLPGGYLGV
4065   APA_40610           70133           71218   +   MFGSETLKHSDGYLHKNLTQTAIAFGRIDQRLRHHPLLPAILFRERLE
4066   APA_40620           72277           71231   -                                  ftsA
                                                       MMPVTDPYLYPDTDVLVNKKGYQNADRLRVFETTRYLSRAITMPTA
4067   APA_40630           72630           72274   -   MQTIRDTYPHSLGTTGRTEGNMNEPTRFPRVERYRKELAKLTFEPVS
4068   APA_40640           74038           72722   -                                  repC
                                                       MLSEGYSRSAGIRKITPAMVAARTTAEALPLQAVEMSDLYRYLRQGR
4069   APA_40650           74047           74466   +   LSDEWEYLPRRDADPQDKRPLWQEKTCNFTGYVGEKLSPNSFSSDIP
4070   APA_40660           76564           75179   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4071   APA_40670           76972           79440   +   MHLLSFSRRKALWLFCSPLAFSVAHAATTAKPHHTTHRAHVAPRTTA
4072   APA_40680           79453           80562   +   MADLSRRALLAATCAAGFMGATRSWAAPSLVPKPLVFAHRGCSAQR
4073   APA_40690           81615           80740   -   MAAFLFFAVVLIWGTTWYAIHMQVAVTDANTAIFWRFLVASALLAA
4074   APA_40700           81808           82698   +                                  araC
                                                       MSALSRFTIRNYLHGRSVPAVAEVELGAGLAMVIWDRDERTCTTYET
4075   APA_40710    83331    82939   -                                  crcB
                                         LGTLARYVVSVLTGPYSRMMPWGTIIAVNMVGSFIIAFFGTLTLADG
4076   APA_40720    83693    83295   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4077   APA_40730    84480    85241   +   LPDAESVLFGFALRQTTGFVESLLRLAVLSWSVPDFSTLSRRQKSLTV
4078   APA_40740    85782    86396   +   MQHGVNPSCDAVSTWEDTGIQGEHLKLEETSTSVVTFRTPSSPEVRA
4079   APA_40750    86830    87465   +   MTTKKTSRTKKPVVSKAPEDPARHRYTEEEMDALIDKAWPEEKVEA
4080   APA_40760    89954    88569   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4081   APA_40770    90378    89971   -   MKQSGFFDVEERLARLSGLGDQLEAFSRTVDFEAFRPDLEQALAYSD
4082   APA_40780    91228    91560   +                                  abrB
                                         MVDLLKAESTITAKGQTTIPKSVRKALGVDYGGRIAFVVDDQRRVHV
4083   APA_40790    91563    92054   +   MLTINGWTILAHPLFLDQLEKLIGAVEELKEKKPHEYQKKPSTKLLAA
4084   APA_40800    92761    92489   -   MSRHWSSDPYFVDALDKYTALRNAGQKTLELDLDAIEEVISNRDGPA
4085   APA_40810    93135    94520   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4086   APA_40820    94932    95357   +   MEEGDRTGTFTDETWAIWEPLIEEVRPRGKTPPHDLRRTIAAIFWRHE
4087   APA_40830    95120    95728   +   VAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQGSPQ
4088   APA_40840    97456    96083   -                                  mntH
                                         MTQDSHSSVSPLPPQKSAWRFAKTGDADSQSLPEVFASIKLPAAGTPW
4089   APA_40850    99874    98144   -   VKQLFQMMGDLWFLSRPYFSSEDRKKAWLLIIAVLGLTLLMVGLDV
4090   APA_40860    97642    98157   +                                  mntR
                                         MDMQQRFDTVDTLPDAQTHSEGFRVSREARQHALIEDYVELIADLLD
4091   APA_40870   100425   102017   +                                  oprB
                                         MPDLTNKIWKKFPYSLHCLLLVAGVWGTLPTFAHGEETQIEEDRRRL
4092   APA_40880   102163   102381   +   MNTSVHTAMPVAAAGQSIPVRAILPWAVFGLIVSALLIYFVGAEQGA
4093   APA_40890   102405   103139   +   MVGRLLARGMVAGILAALLSFVFAKIFGEPQVALAIAFEAAQDAAAG
4094   APA_40900   103942   104319   +   MLAPDRTCISKFFGPEYFLPVEVQLQQNGYDLFECMITGLPVHHQAR
4095   APA_40910   105070   105429   +   MTQQEKKPSNHRELSVGELVHIATTVCRGEQQVVWSDYSILTRQRLM
4096   APA_40920   106470   105580   -   VLLGKGDVHNNLITCMAHGIAFNHEGQSVAPNAQPGATCLKLKTWA
4097   APA_40930   106920   106507   -   LIWRTKGGMNTKLHAVTDRNGRPLDFFMTAGQISDYTGAAALLDSL
4098   APA_40940   107264   106917   -   MSDLYWLTEEQMDRLRPFFPKSHGKPRVDDRRVLSGIIFVNRNGLRW
4099   APA_40950   108694   107444   -   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
4100   APA_40960   109527   108859   -   VINAVRYLVRSGCGWRMLPIHFGHWRTVYGWFRELARRFLFQTIHD
4101   APA_40970   110488   109598   -   MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKDKE
4102   APA_40980   110808   110485   -   MSNKSKRFPPEFRDRAARMVLEEEKNHPSRWSAVMMIAPKLDIHPD
4103   APA_40990   111176   112132   +   MPKSVVNPEFLPILEKMPSFDGLSSLSLPEVREVFLTSVRLIEGRPLPD
4104   APA_41000   112426   112184   -   MFQPTDLGDCEDIGSVAQNIFVDAYKDLALIAAGKSGGRLPFSASAQ
4105   APA_41010   112535   113614   +   MKQSGFFDVEERLARLSGLGDQLEAFSRTVDFEAFRPDLEQALAYSD
4106   APA_41020   113623   113958   +   VAILPGLLKSQSKNQDKEPEITHKSTQSKVFRTLHLFSKSIFSMSNQFL
4107   APA_41030   114255   116969   +                                  cas3
                                         MPDTVEDNSLNFFWGKARPVAEAEEVISSMHPLIAHMLDVAAVAILL
4108   APA_41040   117031   118686   +   MAHGSLNLISDAWLPVRHKSGASSIIRPAQIVEGFEEDPIVGFDWPRA
4109   APA_41050   118686   119246   +   MLLSNKEAIRQVVNWWHGLQPDPERKQFGDRATLARLRRCATVTEA
4110   APA_41060   119267   120325   +                                  cas4
                                         MSRFLQLHLLTFYPPSNVNRDDTGNPKTATVGGVTRLRISSQALKRA
4111   APA_41070   120331   121110   +                                  cas5
                                         MGHFLTFAMVAPMASFGTLSVGERRDGEDRPARSAVLGLVGACLGI
4112   APA_41080   121110   121799   +                                  cas3
                                         MTVGFLSRVALRRDASVQALAGLLVPQGEGRQHGAAHHLLWVLFG
4113   APA_41090   121812   122771   +                                  cas1
                                         VSRPLPGLPPPRPIPLKERSSILFVAMGQLDVLDGAFVLVDQNGIRTHI
4114   APA_41100   122752   123093   +                                  cas2
                                         MLVIVVENAPPRLRGRLAVWLLEVRAGVYIGSYGRRVREMIWGQVC
4115   APA_41110   124036   123206   -   VCGEHRRDGNIANGRGGSSPRVRGTRAVLYTTRRARRFIPACAGNTP
4116   APA_41120   125587   124613   -   VEGSIMGQIRHGSATTTHAVRAAIQRSQASLAALSEEFGINPKTVAKW
4117   APA_41130   126010   125630   -   MVEMKDVLRSQKKKEILLIGFDGLDEVGKRLAAAFEGKKQEPRHTF
4118   APA_41140   126592   127074   +   MTVKNFPLSEPVLQALQTSLSPERFSTYLRASGGHQEKALRLYTRNT
4119   APA_41150   128002   127112   -   MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKDKE
4120   APA_41160   128322   127999   -   MSNKSKRFPPEFRDRAARMVLEEEKNHPSRWSAVMMIAPKLDIHPD
4121   APA_41170   129169   128720   -   MIKNIPGFEKISSIFDLFEEIAMLVLTLCIMVVAALGLIHVLYAVFEML
4122   APA_41180   129306   129536   +   MDPKSLFSLSDHLDALSKEGDPLEVLQETVDFEYFRAWLVEGLGYGD
4123   APA_41190   131064   129679   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4124   APA_41200   131130   131711   +   MYNPSVRFPRPSLLGKIAIFACLTIFLLRWGRAGFALAQPFCQSHQIDC
4125   APA_41210   131739   132038   +   MTEALPYRSTPVFDQDTLPAALRTRHNTKAGVWGVIRVLEGELKLT
4126   APA_41220   132992   132177   -   MRFLGLGLSDRVPDAKTVWLCQKRLTQAGAIDGLFNRFDATLRNAG
4127   APA_41230   133877   133050   -   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
4128   APA_41240   134137   133874   -   MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4129   APA_41250   134287   134649   +   MKKRSDTKEQFKRRVSGQQEKDTPGVQQEGAYWLLGSNATQAGSL
4130   APA_41260         134836         135123   +                                  relEB
                                                     MCIHARRLCMSAVTFRVDETLKAAAVKKLSAQGISLSDALRDTLAYI
4131   APA_41270         135120         135413   +                                  relEB
                                                     MKEYCLEFDDRALREWDALDGSVRKKFEKKLEKLIWNPHSPGNELH
4132   APA_41280         136598         135615   -                                  abi
                                                     MFVTLTFCMSYNKPFLSVHDQVLLLQARGMDVGTVTHAETLLTQFG
4133   APA_41290         138655         136856   -   MRYAHSNYEAFVQPPAPQDMAGWSAWIVGGGLAGMAAAAFLIRDA
4134   APA_41300         138818         139561   +   MRQRARQGKAGQKPRQNQKKQTGPPAIQKGAGHAAQREGQHDGG
4135   APA_41310         140551         139883   -   MSGQILDATLVAAPKQRNTNGEKEDLREGRIPQDWQDKPAKLSHKD
4136   APA_41320         142166         140781   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4137   APA_41330         142631         142224   -   MKQSGFFDVEERLARLSGLGDQLEAFSRTVDFEAFRPDLEQALAYSD
4138   APA_41340         143965         142763   -   MWENKKFIFCILIVSNFSDSDAFAKTVKDIVVGKVIIHPFAQDQLEVG
4139   APA_41350         144590         145975   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4140   APA_41360         148908         146686   -   MITLINPRRVPTWAWVIAAVYAAPTISAAQAQTTAAQGSARQSNTAS
4141   APA_41370         149515         148985   -   MARPSHSLHTLLKWPLVVVTLVGFLGLLALQSFAQPDELPRTTIVRLL
4142   APA_41380         149567         149746   +   MGWGFALFVYWGLCVKRVTAAKVIFLIEGNGQRYKTTEKAHTDHA
4143   APA_41390         149844         150836   +   VKPHGRLGQDDGALTPDVRAPEICPPLAPPEGAVFSARQSRTSRVWS
4144   APA_41400         150882         152132   +   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
4145   APA_41410         152495         153574   +   MKQPGFFDVEERLARLSGLGDQLEAFSRTVDFEVFRPDLELALAYSD
4146   APA_41420         154380         154102   -   MNSQDLIERIVAATDIQKKDAKTALETVFAAITEAAVKGDDTTIAGFG
4147   APA_41430         155450         154587   -   MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKDKE
4148   APA_41440         155770         155447   -   MSNKSKRFPPEFRDRAARMVLEEEKNHPSRWSAVMMIAPKLDIHPD
4149   APA_41450         156092         156907   +   MLVKKRRSTLHRWKVLPALGCSFLIYPALAQTVNVPAGLPPTVNATY
4150   APA_41460         156920         157324   +   MFFRKLSFAAFAGMSLACVSSHALAAGPKPVKPLQGYKCLAIDAPDS
4151   APA_41470         157701         157381   -   MDRQHPCMTTSKNALSSDRPEIRLSGRRLFQCLMVLGWSERLAAERC
4152   APA_41480         157931         157731   -   MNLARAIMIRKERKRQRREGASRREKLSVSPLLWDTLAADRQLQRTW
4153   APA_41490         158317         157988   -   MVAYVPDAGEIVWLDFSPQIGHEQAGHRPAVVLSSAAYNRIGLMLC
4154   APA_41500         158573         158319   -                                  abrB
                                                     MEGAMKAVVKKWGNSASIRIPASVLAAAGLTLDQPVDVREESGRIV
4155   APA_41510         158980         158672   -                                  ntrR
                                                     VSIYLLDTNIISDLVRNPSGSCAQRIEHIDPGDLCTSIIVAAELRYGCAK
4156   APA_41520         159249         158977   -                                  ntrP
                                                     MPVPEVTPRPREVKLFRNNRSQAVRIPVEFEMPGDRVLIRRDGDKLV
4157   APA_41530         159893         159579   -   MEWRGRPEAIRMDNGPEYVSHTLVPWAEKQGITLIYTQPGNPQQNA
4158   APA_41540         160044         161429   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4159   APA_41550         161857         162012   +   MGRPSLVTPSQRLEIIKKRKNGEKLEQIAKAFGISSGTVYRIASQALKH
4160   APA_41560         163099         162326   -   MQFTFDTILFLISSAFVAGGIDALAGGGGLVTIPALMAAGIPPVSALAT
4161   APA_41570         163291         163884   +   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
4162   APA_41580         165435         164050   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4163   APA_41590         165586         165957   +   LPLIANGGRIVNISSGLTRFAYPGWIAYAAMKGAVEVMTHYMAKEL
4164   APA_41600         167770         165998   -   MLPWTTYEAMYDAALNQPEEFWLSAAQRITWKQEPAMACRERTDG
4165   APA_41610         169083         167785   -   MRRCASCLSDTETKRTTMTQNEKSIPVIIVGGGQAGLSLSWYLCREK
4166   APA_41620         170502         169324   -   MSLSIGILTHSTNPRGGVVHGMALAETLCDAGHDATLIAPDVTGSGF
4167   APA_41630         171470         170499   -   MMAHELTTLLRTLRMGRSLAAKQDIAEVSAILGTGAKAIRLGDDCAA
4168   APA_41640         172030         171467   -   MSTILEGMEDRPFIPTEYVVRLARTPWERAGYHALRREVFCSEQHVF
4169   APA_41650         173136         172027   -                                  nifB
                                                     MTIPTLGTLSGRKLVTDLQSFGLQIGEQTGGIARKGGAGPSDHKTITIA
4170   APA_41660         174107         173133   -   MSRIVRAAAIQISPVLGDDGLGTARKVCQAIREAAEKGVKLAVFPET
4171   APA_41670         174614         174132   -   MPKVEHAPYQDGDCFVNYENKVFEDVKAKPGEKALITFHTVANEGS
4172   APA_41680         176358         174955   -                                  gntR
                                                     MSAYPYLAHWKEEISQSPNAIYLTLADALALSIRRGDLREGDKLPPQR
4173   APA_41690         176793         177416   +   MFPGGSGDIGLGKNGVIRHDHNFVVRTRRLWNRQGYAVIIPDTINHIN
4174   APA_41700         178298         177420   -   MELRHLRYFVVLAEELHFTRAAERLNISPPTLTVQIQEIERTLSAQLLN
4175   APA_41710         178490         180022   +                                  emrB
                                                     MGTSMTSSRVTNPLFVLLAASTGCALTVLDTNVVAIILPTIAREFRAS
4176   APA_41720         180474         180346   -   MLAYAVMASVRYQANSLKPKKTQLRTRQSLSAGPFRRSGASS
4177   APA_41730         180652         182037   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4178   APA_41740         182333         183718   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVIVVKQADDILG
4179   APA_41750         184178         183861   -   MLQFSYMSEEADAIAAEIGRRAASGCAWHDIAVIYRQNRLSRAIEEA
4180   APA_41760         186634         184415   -                                  recD
                                                     MTSAVVGEQCQTEALAGLVERVTFHNAENGFCVLRVKVRGQRDLV
4181   APA_41770         188856         186631   -   VVESQVSHIQPEYKFHINLDEYDRRATLSADELKVVRRWKEENLVIT
4182   APA_41780         189853         190053   +   VELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQRGIT
4183   APA_41790   20             256            +   MKGPAFLMAMDTVIGGIHIQNDPGGCALMLVHEERDEQGSQGLMIS
4184   APA_41800   290            586            +   MPQGIVIIEIFIAQCQAHDPLTDKVFNPVFHKAGMPLIAKTGSKAAAE
4185   APA_41810   680     973     +   MDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQRLALGQTSLETAT
4186   APA_41820   1738    1139    -   MSFLSENEIEDWACDILRECGYTIAWGPDIAPGGKKPERASLSDVVLE
4187   APA_41830   2079    1735    -   MTTNQAISSLIPKGIGKSYIFLHMLHSKVNLANKATGSAQQNLSKNLI
4188   APA_41840   2700    2326    -   VIADGHGKAFGFALAPGQAHELPLAPAMLDSLPATPLWVVADKGYA
4189   APA_41850   3122    2697    -   MEEGDRTGTFTDETWAIWEPLIEEVRPRGKTPPHDLRRTIAAIFWRHE
4190   APA_41860   3854    3144    -   MLMEASKLVLYGTQLHASDYVTSGVPCIMPQDIIDGKISTGKIAYISE
4191   APA_41870   4245    3925    -   VTGLIEITPEERAIVLRILNEIVPDREVRAFGSRVTGKAKLFSDLDLAIM
4192   APA_41880   4643    4242    -   MLYLTPLERALNRLKEGWTRHLAHPDDEQLRDGLIQRFEFTYELSHK
4193   APA_41890   6256    4643    -                                  hsdM
                                       MSRGRPRKNPDAASAPKKTTKARKAKAATATLGFEQQMFLAADKL
4194   APA_41900   7854    6781    -   MTSLFEPIELGSIYAKNRILMAPLTRGRGTRDHVPTPIMAEYYAQRAG
4195   APA_41910   8112    9362    +   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
4196   APA_41920   10493   9486    -   MYGSDARFNPTIGMGSGSLHGLYQWAPTQAHLDVHLPWIFKRGIDV
4197   APA_41930   11961   10687   -   VKQADDILGLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYE
4198   APA_41940   12650   12129   -   MRQTLIDRSAFKFVLLSCCAAFLCETGMPTAHAQTSAPAQVQVGDIA
4199   APA_41950   13903   12977   -   LKVKFSLRQIEYFVATAELGSIVQASRQIPISQPAISAAIAHLESVFGVS
4200   APA_41960   15152   13998   -                                  argE
                                       MTSMYDLSVQDILSQLVAFPTICRTENQNLIDWVEEFLRACGARCLR
4201   APA_41970   16765   15149   -   MSGQNDFPTEFDFIIVGAGAAGCVLANRLSARSNLRVALLEAGQADN
4202   APA_41980   18159   16765   -   MTDTTTARGPEAHTIYQIPLDQRHGRPRDLFTVWFGSNIMMLTIITGA
4203   APA_41990   18688   18281   -   MAHTRLRPFNTKDTYPEQELDNDLCQAVITQNTIYLRGQVPQDLDTR
4204   APA_42000   20307   18826   -   MKSLSYYTQRADALKFRNNCWIDGKFVPARSGKWFEDVNPATSSILT
4205   APA_42010   21566   20307   -   MTIEKTEVLVVGAGQAGIAMSEHLRGYGIEHVVLERNRVAERWRSC
4206   APA_42020   22396   21626   -   MFRFGNDGGTVRSYLTPAVWLDYVSSERGSSMTFSIVARCPQSGQFA
4207   APA_42030   23141   23404   +   MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4208   APA_42040   23401   24228   +   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
4209   APA_42050   25454   24480   -                                  ntrA
                                       MSTPLRIGVLKLADSAPVIMARQKGIFARYGLEVELVVSPSWANIAD
4210   APA_42060   26062   25451   -   MDEKISSTVHLKVLVADENPRRGQALSEVLYTDSSLDVQTVPCGMA
4211   APA_42070   29400   26062   -   LPIRPGTDLALLNGLLHLLVKNDAIDRDFIAQTTTGWEAMESFLEEYA
4212   APA_42080   30029   29466   -   MGAAARTGSGTTGSGIRNDFSGWHKHQGSPQSGGSPKKGASFEERD
4213   APA_42090   30262   29837   -   MEEGDRTGTFTDETWAIWEPLIEEVRPRGKTPPHDLRRTIAAIFWRHE
4214   APA_42100   30884   30291   -   MAREEVRTVCPYCGVGCGIILEVENDRIAKVRGDTAHPANGGRLCTK
4215   APA_42110   33048   30892   -                                  nirB
                                       LARECGLAIGSRGGVVIDDTCRTSDAAIFAIGECACWNGQVFGLVAP
4216   APA_42120   33819   33157   -                                  nirB
                                       MPSLTIGETVMITTENIVIIGNGMVGHYCAEQLVTHGLHKTHAIHIFG
4217   APA_42130   35474   33819   -   VTRIFFSSHSASFSTASVAMLAGLCLHQTAWADNAQPANKQTTNAQ
4218   APA_42140   35972   35508   -   LHSFGCVCWFVRAPLGRGHIGGERALSILYTLAAGIFAVIGVGLPTIW
4219   APA_42150   36748   35894   -   MLMTETGCDDVDKGFLKAGNPRTLLAAFLYFDVSFMVWVLLGPLG
4220   APA_42160   37906   37202   -                                  duf125
                                       MENNILNSQKETHATSRLGWLRAAVLGANDGILSTSSLIIGVASAHAG
4221   APA_42170   39315   37963   -   MKNWSLATRIVSGVLCVVTLSLLALSIAVAGFTRYEITERLDNSLQEV
4222   APA_42180   39983   39312   -                                  kdpE
                                       MRILIVEDEHDLGAAVQERVRQDGHAVDWFMTLEDARAAVATVDY
4223   APA_42190   43057   39983   -   MARKYLEALLRARMLVLGGLALILAAGMMAVLELPVEAVPDISPKQ
4224   APA_42200   44211   43057   -                                  czcB
                                       MKGRILAYFAVCFCMSPLANAEDQILPSVVALDMAAIKNEGITVTFA
4225   APA_42210   45443   44208   -                                  czcC
                                       MREILLLSIVTFSFGIFSANAQNMPEKIDFHRAVNMAWAVDPVRTELQ
4226   APA_42220   45932   45462   -   MQRVIRYGLSILITLSLCGCVSYTETESICKGTEEGILLHIDGSYAGYPH
4227   APA_42230   46454   46335   -   MLAVLGGLADVERDLIRTRTSEGRIRAIRQGKKWDVLVA
4228   APA_42240   47865   46615   -   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
4229   APA_42250   49201   48701   -   MRDMVPETDQRDICISARQRTRWMFYMRKTDICLLLSLDVPACALH
4230   APA_42260   49222   50310   +   MNGIYGFMKSNHFYSPFLSGIRNSTLLTAHMTKVSMIQESSFNIKRIH
4231   APA_42270   50338   51366   +   MKTLLPTSTAGSLPKPSWLAKPEALWSPWKLQGEELVEGKQDALRL
4232   APA_42280   51419   52402   +   MEIVCLYDYMSFAHLLRQGMGVLERSHLTIIQEVAREGSLTAAAVRL
4233   APA_42290   52463   52834   +   MRRYSLRDDQWERIKDLLPGREGYVGGTAVNNRLFVEAVLYRYRA
4234   APA_42300   52876   53217   +   VELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQRGIT
4235   APA_42310   53656   53360   -                                  xre
                                       MSTYDSILQGLNEALAYSEAQVQNSVTHKVRVLSVNVAAIRTRTGLS
4236   APA_42320   53994   53653   -                                  relEB
                                       MSKLQTVVELPEFIKRAKALMSDDDRMALINTLAAMPDSGVSLGGG
4237   APA_42330   55387   54308   -   MAEQFDVVIVGGGQAALAASYFLRRTGLTYVILDNGTQAGGAWVH
4238   APA_42340   56094   55396   -                                  arsH
                                       MTEPDLPALHPEYLERVDLARLEPQPRVDHPPRILLLFGSLRPRSFSRL
4239   APA_42350   57413   56118   -   MLALLIFVATLVFVIWQPRGLGIGWSAMAGAAVALAAGVIHWHDIP
4240   APA_42360   57835    57413    -   MTIMIYHNPACGTSRNVLALIRNAGIEPTTIEYLKTPPGRAELVDLIAR
4241   APA_42370   59059    58322    -   MGDKDHRILTYGDEHIRVELLPRARPGTTLRIKVHPDLTVQVVVPED
4242   APA_42380   62358    59062    -   MVSAPKFQEEYSAKLPALALLSTLGWRFLPPSEALALRGDRQSAVVL
4243   APA_42390   63544    62390    -   MLPEGWKETTLEKYIHVKHGYAFKGEYFSNSGKYIVLTPGNFFETGG
4244   APA_42400   65060    63534    -                                  hsdM
                                         VTEQISQDTINKALWNACDTFRGTVSPDTYRDYVLTMLFLKYISDVW
4245   APA_42410   65692    65096    -   MKPNGAQKMDLVAVASISAGHPFRGRIDPVAGVETAVVQMRDTSSS
4246   APA_42420   66755    65928    -   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
4247   APA_42430   67015    66752    -   MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4248   APA_42440   67131    67442    +   MKHDALGELGLSEATAARPIQAAFASATAFSSGALLPVLAAVLTPVA
4249   APA_42450   67870    68292    +   MTIMIYHNPACGTSRNVLALIRNAGIEPTTIEYLKTPPGRAELVDLIAR
4250   APA_42460   68292    68822    +                                  arsB
                                         MLALLIFVATLVFVIWQPRGLGIGWSAMAGAAVALAAGVIHWHDIP
4251   APA_42470   68812    69135    +   MSNKSKRFPPEFRDRAARMVLEEEKNHPSRWSAVMMIAPKLDIHPD
4252   APA_42480   69132    70022    +   MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKDKE
4253   APA_42490   70134    70883    +   MIVAFRRHTLLPLDDCLYALQASIPYLTRSALHRCLQRHGISRLPDIER
4254   APA_42500   71973    71062    -   MRGYDLDLLRFLQVLIEEQSVSNAARRMNVSEPAMSRHLSKLRTVFG
4255   APA_42510   72092    73789    +   MNSSHDGTPDDIRGLGERTHQLSPARSFSPAAPIIHPSPPLPSYIPPFGR
4256   APA_42520   73978    74289    +   MGKVTRKRYAAEFKSRVALEAIRGELTLAELASKHGVHQTMIAQWK
4257   APA_42530   74286    75170    +   MIDPKRACLPIIRQCTLLQLNRSGVYYRPVPQSEANLELMRLIDAQFL
4258   APA_42540   75289    76020    +   MFSNSTLWKYGISPDFSIQVHTIVDYGWKHAEGHSHGPKTGDVPVD
4259   APA_42550   76451    76062    -                                  ntrR
                                         MFDTNTISDIIRADERVLLHVEALDPDQCCVSAVTAGEVAYGLAKRP
4260   APA_42560   78131    77817    -   MRFDMICEAHGIEHRLTKPNHPWTNGQVERMNRTIKEATVKRFHYD
4261   APA_42570   78791    78141    -   VEGSIMGQIRHGSATTTHAVRAAIQRSQASLAALSEEFGINPKTVAKW
4262   APA_42580   78990    79253    +   MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4263   APA_42590   79250    80077    +   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
4264   APA_42600   80271    81869    +   VSLTAPASVQVGKGAAGHDARPAGFAAILGALGVVFGDIGTSPIYAL
4265   APA_42610   82705    81878    -   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
4266   APA_42620   82965    82702    -   MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4267   APA_42630   83080    83394    +   MTDQRAEVAEVAPNIYRVTLRYGFMEMPNLPPALAQLQFESTGFDV
4268   APA_42640   84450    83677    -   MILRLLHLWSCSVDCGCMACPRPRPTSSSRGAPAFEAAIPILSQLLKA
4269   APA_42650   85712    84447    -   VALGYDGSYGRVAAFIRQWKHEQHQARQTTGRGVFVPLCFQPGEAF
4270   APA_42660   85722    85889    +   MQSSRRAPVLAGASGFQDQPSPQPVSKRVQSAGTFGDLEPRFNTLCP
4271   APA_42670   86004    87389    +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVIVVKQADDILG
4272   APA_42680   87619    88104    +                                  traA
                                         MPTGGDPHAHFHNTMFNMVVTDDGHVGSLDTKQLRSRVHEFGAYF
4273   APA_42690   88771    88142    -   MRRMGLKGVIRGKGVRTTRPDPQRPCPQDLVQRQFHAPAPNRLWVS
4274   APA_42700   90353    88968    -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVIVVKQADDILG
4275   APA_42710   92441    90411    -                                  traD
                                         MVKRQIGGPLGHQQIKRGATYRDTRPLFERFTAEMRTSSSGFVLLIVA
4276   APA_42720   93077    92445    -   MTTITIETEGQPPIVITVGHSNTMTVSKKDYLTHPQPHPLSPPAHALPS
4277   APA_42730   94238    93090    -   MSSSSTPWSSSDDYALFSIIAIIVGGAGLSYMVWSNWHAEISLLYIRAL
4278   APA_42740   94750    94235    -   MKSLSLLTATFLALGLTRISHAQTAQDDAFVQGQRVQACLTAAASNA
4279   APA_42750   95436    94750    -   MIDVARNRLTRKVSYSGRQKLSAHFAGSCSLELDNIDHRSAGHSLFW
4280   APA_42760   96595    95429    -                                  dotB
                                         MNVIITPPEERETWENEGRSGYTWVVERRKYAPGLDDLLKWAYRLG
4281   APA_42770   97626    96592    -                                  dotC
                                         MRKTIHYTLMACTMLATFVRPGLAEEAPHIDGRLIPFKTSAPPTAPNG
4282   APA_42780   98077    97619    -                                  dotD
                                         MKKTSFLFATLTIGLTACSGHIKPGPIETTGMPNPELALQRSISSTTAD
4283   APA_42790   98773    99042    +                                  relEB
                                         MTSSNAISQVNLKVNTQLKENAYATLKELGTTPSDFFRDILEYVVRE
4284   APA_42800   99044    99319    +                                  relEB
                                         MLDAAKKELAALPKTENNQIIKRLIKLQDNPHIPALALSGNLAGCYEI
4285   APA_42810   102232   99542    -                                  dotO
                                         MGGLPYVLWTRKGVLSREERKQVSEEQAATAKAFPNIGDTQRFALR
4286   APA_42820   102289   102552   +   MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4287   APA_42830   102549   103376   +   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
4288   APA_42840   103418   103954   +   MALCLGLLATPAFAQQTEQGSVGCAELTQAAANAINQRVQANDAYE
4289   APA_42850   103954   105141   +   MSKQNRRITHTALLAAGVCLLTVSIQPQRAYGFMGEAAVVGAIHALQ
4290   APA_42860   105156   105308   +   MSETLTQIADLANVMDYLDRTKDVVREHAPDVVQRFERLKERVSTR
4291   APA_42870   106859   105474   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4292   APA_42880   107225   106917   -   MPIRPMAEVNTDEWDQMIDVNLKGTLYGIAAALPGFLEQGSGHIINL
4293   APA_42890   107281   107604   +   MSNKSKRFPPEFRERAARMVLEEEKNHPSRWSAVMLIAPKLDIHPDT
4294   APA_42900   107601   108023   +   MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKDKE
4295   APA_42910   108039   108491   +   VAFIIDVFARVIVGWRVSSTAHTDFVLDALEQALCQRRPEGKVTHHS
4296   APA_42920   108634   110535   +   MADDVTTISSNTSWLNYNGGGTQDSHTPPDNATSGLGTGPTLNVTN
4297   APA_42930   112185   110980   -   MIQDMMSGGASVEETLALWASGLRSAKERMAPLFTQKRVVDSACA
4298   APA_42940   114073   112634   -   MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
4299   APA_42950   114326   115231   +   MKPDGRVFLKSVFGQISDEWPCISFSRSSVGNMLRQEFVPGRDILIYV
4300   APA_42960   115474   116307   +   MNCNLSDKSICERSFQKNNARWYYPTHPNHSWFEGFSRNFLSPDVRI
4301   APA_42970   116702   116427   -                                  pilT
                                         VSIVSLWEIAIKIRIGKLDADMNDILAAIPAEGFSLLQIQPEHLQILMSL
4302   APA_42980   117569   116742   -   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
4303   APA_42990   117829   117566   -   MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4304   APA_43000   118011   117895   -                                  pilT
                                         VKVLLDTHALLWWLSGSDRLGETAREIIADPVHDILVR
4305   APA_43010   118346   118008   -   MPQEFSTSSLCVHVMMTHGEETMSQHLSDNAPLPQKIGVREFRGNLT
4306   APA_43020   118992   118354   -   MEKKTRFPSPTLKASVPWNAGKMVGAKRALKEKHVWAIRFWLGSE
4307   APA_43030   122738   119604   -   MTGRSFSLQAAIIGFSIRFRGVVIATACLLFFYGLYGLRHASYDVFPEF
4308   APA_43040   123772   122738   -   MKARAFWLPLVGLSVFLVLNVADIAIADDDDPPVSVLGAEATVTVSP
4309   APA_43050   125211   123769   -                                  nodT
                                         MYKSYNTLEYIKQVRRRTRYNAAFILLIFPLLCGCTNSDHSNISPESDV
4310   APA_43060   125854   125204   -   MAGGCCGGCTDTPLPINKSWRRALLIALFLNASMFAVEAGAGVSVG
4311   APA_43070   125928   126326   +                                  merR
                                         MRSIGALGKATNTKVETIRYYERIGLLAPPQRTDGNYRTYDDEALAR
4312   APA_43080   127097   126648   -   MIKNIPGFEKISSIFDLFEEIAMLVLTLCIMVVAALGLIHVLYAVFEML
4313   APA_43090   128456   127134   -   MSDPFYAAFLSGESTTMMTRVYLDKSAFLKWTPRSGNVGFFLTAAIT
4314   APA_43100   128824   130530   +                                  kdpA
                                         MSFYGWVAIMAFLICVIAMTRPLGGFLKRVLEGEQHVLGRIFGPVER
4315   APA_43110   130545   132653   +                                  kdpB
                                         MALHLPHSEAPHGGRHSEHRSQSSLMQASLLLPAIRESFRKLDPRIMW
4316   APA_43120   132664   133287   +                                  kdpC
                                         MTLIRQLRPALVIFGFLSVLTGLLYPLGITAISHLLLPEKAGGSLVHEN
4317   APA_43130   133287   135974   +                                  kdpD
                                         MEAHLIRPDPDALLRQTVLDGESRKRGRLKVFLGAAPGVGKTFEML
4318   APA_43140   135971   136654   +                                  kdpE
                                         MSNPSVLVVDDEPAIRRLLRTALGSQAWRVIEARTGEMALNMAMEV
4319   APA_43150   136958   137527   +                                  tetR
                                         MARPLSEEKRAAILRAATELVATIGISAATSQIAKRAGIADGTLFTYFP
4320   APA_43160   137579   138406   +   MSKIWFVTGSSRGLGRDIVEAALAAGDSVVATARKPADLDAVVAQY
4321   APA_43170   138413   139216   +   MTGQQMKRAHILVYTSSATKIPLVGGGTHDVGIFLGELVEPIEPLIRA
4322   APA_43180   142552   139994   -   VDMVLFLNGLPIVTLELKNAWTHQTARYHGQKQYRERDANQTLLRF
4323   APA_43190   143047   142586   -   MCRGRNSFESNAMNVAVSNTKEIALEQAVERRLCGASSEELAAGAIA
4324   APA_43200   144325   143063   -   MTIAAYSKYDAYRDSGVQWVGQFPANWELARLGGLFEERRHKVSD
4325   APA_43210   146715   144322   -                                  hsdM
                                         LNQTSHSSLVSFIWRIADDCLRDVYVRGKYRDVILPMVVLRRLDTLL
4326   APA_43220   147120   147539   +   MSRIWPCQRVIMSRNAKCLSQLDSLEQKSGSQRISAYVRRGLMRYQE
4327   APA_43230   148679   147588   -   MTKSPKETLKDPVTGKPLPKGVWYRGPGQYQARRMVNGKRHRETF
4328   APA_43240   149045   149545   +   MRVEIRARLKGRIRYNVTTDQIEVMVGEDDELLRWETIDRRTMSQHL
4329   APA_43250   149668   151101   +   MTQNPSEKPKSRASAKVGTTVTKDNLKALGADRLADLLIELAGQDT
4330   APA_43260   151207   151431   +   MLTRTTLFLSNRSQAVRLPKAVAFDVNLKDVVIIPDGARRIIAPANAA
4331   APA_43270   151431   151769   +                                  ntrR
                                         MLRYLLDTNFCIRVLRDRPQGLRERFNDNAEALCISDVVLYELLYGA
4332   APA_43280   151877   153400   +   MELLSVIRRWHCRDHLPIREIERRTGLSRNTIRKYLRAQSIEPRFQVPE
4333   APA_43290   153397   154170   +   MILRLLHLWSCSVDCGCMACPRPRPTSSSRGAPAFEAAIPILSQLLKA
4334   APA_43300   154544   154744   +   VTLPAQLLEEARSLDLNISQACEQGLKSAIASVRAQQWLAENRSSLEA
4335   APA_43310   154745   155050   +   MARFDVYCLAGRGEARFVLDVQADLLDELGTRIVVPLLSQKVAPRPA
4336   APA_43320   155089   155613   +   LFLLWGLPKADISYHNQLGKAANTRRAYRSAIRGWYVWAARHDLPA
4337   APA_43330   155671   157056   +   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4338   APA_43340   158272   157199   -   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
4339   APA_43350   159600   158371   -   VGHDVILSDVLLHRYLRLPLVAVSWILLVARVVDAFCDPAIGYVVDR
4340   APA_43360   160029   160403   +   MSQKSLPETTSGERLIRDIRRATRRQYSAEEKIRIVLDGLRGESSIAELC
4341   APA_43370   160400   161380   +   MRYMASEKLEIIRLVEQSALPVRQVLGKIGIPRSTFHRWCDLYRTGGP
4342   APA_43380   161674   161411   -   MSKTLDVTRQTCGRYVVETCLRPDGAVFLRTPNIFPVNARNWHGPY
4343   APA_43390   162113   161778   -   VRSVLRHSGLLLTDGAHYLAANGAAWLIDVLASVQYLPAMRAEERQ
4344   APA_43400   163203   162091   -                                  parB
                                         MTELRRVDPRTLVPNPNNPRKTQPDARAEHQLALNIKTVGLIHAPCV
4345   APA_43410   168516   163390   -                                  snf2
                                         MSMSASQLNLFDTTVLSGELAALWSLDDDQPIPEVCIPSPHPFRIPQRD
4346   APA_43420   170693   170352   -   VELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQRGIT
4347   APA_43430   171106   170735   -   MRRYSLRDDQWERIKDLLPGREGYVGGTAVNNRLFVEAVLYRYRA
4348   APA_43440   172820   171897   -                                  repA
                                         MGQIHSLLDRFGVEEMRRLASLEDKTQRLCVEAAHEVMSDEDQAIG
4349   APA_43450   174803   173313   -   MLDTLHITGSWPVLRSYVLEQVDRLTCQRLNDPQASIDVLRPILSTAH
4350   APA_43460   174996   176246   +   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
4351   APA_43470   176621   176890   +   MITCPIFGDDVLEERVISLFRRLGHDGRGVTLTSLQTYTGVLGTRLRA
4352   APA_43480   177446   177985   +   MEEISMKRSWHSRDWSRLVRLFNGLTFYERFEQAIILILIALIMLVTAI
4353   APA_43490   177948   178304   +   MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACAF
4354   APA_43500   179232   178369   -   MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKDKE
4355   APA_43510   179378   179229   -   MYNPSVRFPRREKIRQLERENHELRQANEILRKASAYFAQAELDRIFK
4356   APA_43520   179725   179360   -   MPQGIVIIEIFIAQCQAHDPLTDKVFNPVFHKAGMPLIAKTGSKAAAE
4357   APA_43530   501      1070     +   VFTMAGQIVAYVRVSSADQNTDRQMFDGMTVDKTFTDKCSGGTRN
4358   APA_43540   1194     1433     +   MSTTRWNIAVSSEVDQSVRMFLAANGGGRKGDLSRFIEDAVRSYLLE
4359   APA_43550   1415     1855     +   VGTWALMRVVLDTNILVSALIYPRGAPDAIYRAWRAHRFDLVTSTTQ
4360   APA_43560   2206     1949     -                                 traD
                                         MRDWAKARRERTHHLIELGGLVQKARLVDLTDDDRATLLGAFLDIA
4361   APA_43570   3143     2253     -   MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKDKE
4362   APA_43580   3463     3140     -   MSNKSKRFPPEFRERAARMVLEEEKNHPSRWSAVMMIAPKLDIHPDT
4363   APA_43590   3462     3941     +   MNPSYLSGRSVSTKPGAIQPASRRLEGVFEKAIGEVRKERQALASIVG
4364   APA_43600   6345     4027     -   MDYWNDTSVSNGETLNDITLTSANDTHDRLFVSSGGVANNVHVGGG
4365   APA_43610   6555     6391     -   VTVTSNSQEVLSSGATGMQQTIEESQKSASITVTTLGDDSRPERRVRW
4366   APA_43620   6991     6764     -   MRERIWDMGARPAIPAKRRDGPVACPKWAYRCRHLVENLWARLKE
4367   APA_43630   7560     7135     -   MEEGDRTGTFTDETWAIWEPLIEEVRPRGKTPPHDLRRTIAAIFWRHE
4368   APA_43640   7752     7907     +   MQIQTLNSFECHKVFREKASGADVERVELRRLIKNLCHGDTVVIPPFL
4369   APA_43650   8743     7916     -   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
4370   APA_43660   9003     8740     -   MKSGRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4371   APA_43670   9099     9491     +   LARSTFDLFAIVKEIIQKGAQFYSLSEPWADTTTSTGRLMLAVLGGLA
4372   APA_43680   10318    9725     -   MTHILIGYARCSTDKQDLAVQKQELLKLGVSADRIYTDKGFTGTNRD
4373   APA_43690   10437    11936    +   MILYRTGAITMADDRVLGTDSTEVAMRMAVLRPYLIDNVPLTKIAVD
4374   APA_43700   11936    12760    +   MRTARTTSFIATQEHRRFSEFADAVRKHRYIGLCHGPAGVGKTLSAR
4375   APA_43710   12808    13455    +   LHGGFSGRVQMGQRAVIYCRVSTADQSCARQKDELKRFAERAGYEV
4376   APA_43720   13498    14133    +                                 parA
                                         MKVLAVLSQKGGVGKTTLATCLAVAAEQAGKVAAIIDLDPQATASF
4377   APA_43730   14160    14411    +   MLDRAKGSGEAMPTPSPKPDISSRKPTLNGRKGTKLIGGHFSPEVSTQ
4378   APA_43740   15547    14447    -                                 repA
                                         MKPRIKPDRQRNPELALIVSETPNVDGRSVLLPERYPTPDLFICDVLDA
4379   APA_43750   16600    17007    +   MANDMNYQTAREADTLHRATVPHAVSARLIRARRALHVTLSNGVEM
4380   APA_43760   17110    17337    +                                 mazE
                                         MVELKVRKFGNSLGVVLPKEVISRLNTQDGAPLYLTEAPDGGYRLVP
4381   APA_43770   17334    17729    +   MTVFVWIDEREALILHDRLLGLHGGASGLRDAGLLKSALARPQQHA
4382   APA_43780   17857    18102    +                                 yefM
                                         MRTVNIHEAKTHLSRLIDAAMKGESFIIAKAGRPMVRVSPITAPEELQ
4383   APA_43790   18099    18485    +                                 pilT
                                         MRLLLDTHLLLWAAGEPDKLSARARTLMEDPGNDLVFSAASLWEIT
4384   APA_43800   18511    18687    +   MPSLHSDEAAEDFVATVDLTRYDLSGFKPMRCEIEPKAAALNMRLPA
4385   APA_43810   18772    19026    +   MSRTYHHSRKYGRNHRWANQPDRCGYGGSREASESPNWYSHLHDI
4386   APA_43820   19298    19122    -   MTMTDLSDERAAKRDAIRKASNSTKPTVPADQVLALLDAELARIQAA
4387   APA_43830   19627    19295    -   MAPEYPSPEWFSDTINRHQWMWNLNARFVARAAKRMTDTDAFILLN
4388   APA_43840   19970    19731    -                                 traD
                                         MRDWAKARRERTHHLIELGGLVQKAGLVDLTDDDRATLLGAFLDIA
4389   APA_43850   20394    20035    -   MSDAVLACVIKYATDQKNKGSIMRKPRDIDAELEELQKRARALKAK
4390   APA_43860   20491    23577    +                                 traA
                                         MAIYHLHAKVISRATGRSAVAAAAYRAASRLHDVRLDRDHDFSNKS
4391   APA_43870   23628    23894    +   MRSSVMSSVVIRNLPEETHRALKAQAMLHGRSTEAEIRTILEAAVRPP
4392   APA_43880   23891    24313    +   MILLDTNVISEPWKPVPEPRVLAWIDRQAIETLFLSAVTVAELRFGIGA
4393   APA_43890   24313    24540    +   MSETDPAARAFEDLCAEMTVLRRSVEALPQAWRDNRPPDYTEDLAR
4394   APA_43900   26068    24683    -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4395   APA_43910   26365    26126    -   MLVGYMRVSSADERQSVDLQRDALIAAGVDARHIHSDKASGARDDR
4396   APA_43920   26993    26520    -                                 parA
                                         MKTGKIVVISKLKGGSGATTLTRELATSALDAGKSVAIIDLDAQGSLT
4397   APA_43930   28381    28082    -                                 xre
                                         MAEQMNIADELLTSMEQAVGIAAGTVKPGRIWTPPEINVADIRKRTG
4398   APA_43940   28721    28383    -                                 relEB
                                         MHSVIETPIFTKRADALLSREERAELIRLLAENPRQGDVIPGTGGVRKL
4399   APA_43950   28802    29188    +   MLSHLKSPGKTTMQPLIHRGSGLSQSDYDLKGHIMSKSSSPYVRRLL
4400   APA_43960   30058    29249    -   MTEHLTKRWQTLPATPAPLASFKGQHAPINGCSLYYTEGGTGDDVII
4401   APA_43970   30960    30133    -   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
4402   APA_43980   31220    30957    -   MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4403   APA_43990   32517    31330    -   MAELSDEELLAELGVSLETKKKAALTAEEERIIAGFEDICRFYEEHGH
4404   APA_44000   34594    32510    -   MTINPVIPAVSLRTGQTGLSARTNELGMRPMQEAVYEKRGEQYLLIK
4405   APA_44010   37306   34598   -   MNPVEIEEAVSRIAEAPFNPGEFPFEFLQAFGNRDVTIKRLRKDNRSD
4406   APA_44020   38440   37346   -                                  ftsA
                                       MLTPTYHIRPLPPQAEIETVPVLKALVEANKALAELKGRAATIPNQGI
4407   APA_44030   39237   38767   -   LKESRKRTGSTISGLVRKHLSEIEKRMIEGESRDQILDWLKEETGREIE
4408   APA_44040   39775   40191   +   MRERKYTVRFTEDEAEWLQEVALDGNVSGYIRDTVLRQSKSDRKLV
4409   APA_44050   40644   40261   -   VRDRSVVASGRVFAPGEIVLADWRGDALPKEPNKLRPAVVVEDELF
4410   APA_44060   40972   40637   -   MFGGDRLDLRVFLVVVEYIIVLQNQHTICMEEAMASPLSIRLDERLRL
4411   APA_44070   41559   41074   -   VKVDKIFTDKCSGGTRNRPALTEMLRYVREGDTIICHSIDRLARDLQD
4412   APA_44080   43138   41753   -   MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDILG
4413   APA_44090   43256   43723   +   MTPQAYGQGIREEGLAASRRLEGVFEKAIGEVRKERQALASIVGEAN
4414   APA_44100   45986   43809   -   MSIVNPSNGTPYLTPGTTTFTSGQVVSGVTVPSNSKEVLSSGATGMQ
4415   APA_44110   46313   46576   +   MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYG
4416   APA_44120   46573   47400   +   MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAEND
4417   APA_44130   47575   47913   +                                  relEB
                                       MHSVIETPIFTKRADALLSREERAELIRLLAENPRQGDVIPGTGGVRKL
4418   APA_44140   47915   48214   +                                  xre
                                       MAEQMNIADELLTSMEQAVGIAAGTVKPGRIWTPPEINVADIRKRTG
4419   APA_44150   49303   49938   +                                  parA
                                       MKTGKIVVISKLKGGSGATTLTRELATSALDAGKSVAIIDLDAQGSLT
4420   APA_44160   562     116     -   MASFRIETHIANLRQLEKPSTEQRILILLYDKTDRTPKEERDLKALIRSE
4421   APA_44170   744     2195    +                                  mobAL
                                       VAIGRLSMKVGGKGKACAHSNYIERQGKYAHRLETGERLVATGSGN
4422   APA_44180   2317    3006    +   VEGLTRLWVPLQAEDGRRSRETPVTFVKNRVPALSHAQNAIPRDKLK
4423   APA_44190   741     1499    +   LWSFPPFEKGTTGEENLIYFYLAWITSPQNEHFCRKTAKKWLAIKSLT
4424   APA_44200   1601    1945    +   MNVLAAKIIMTDQTEPAPLIGVVPLDEAFSRLEAAFHGIPSPKSHNFIS
4425   APA_44210   466     1263    +   LRGTQLSGRFPMSVSLKELRRRGHSDEEIKMARMIQDGARRSGGAPR
4426   APA_44220   1551    1378    -   MTTRKETLVTFDAVTAARSPDVQKQLLEMAKADNNPEALEHALNVI
Products
Holliday junction resolvase RusA
Phage integrase
Hypothetical protein
Hypothetical protein
Major facilitator superfamily Multidrug resistance transporter Bcr
Hypothetical protein
Hypothetical protein
Lon-like ATP-dependent protease La
Thioredoxin
Hypothetical protein
Excinuclease UvrABC subunit A
Creatininase
Hypothetical protein
Hypothetical protein
Nitrogen fixing thioredoxin-like protein
NADH dehydrogenase
Peptidase
Ribosomal protein alanine acetyltransferase
Phosphoribosylamine--glycine ligase
Exodeoxyribonuclease VII large subunit
Hypothetical protein
Phosphoserine aminotransferase
Aldehyde dehydrogenase
Alcohol dehydrogenase, Zinc-dependent
NAD(P) transhydrogenase subunit beta
NAD(P) transhydrogenase subunit alpha
NAD(P) transhydrogenase subunit alpha
Hypothetical protein
Aspartate-semialdehyde dehydrogenase
Succinate dehydrogenase cytochrome b subunit
Succinate dehydrogenase membrane anchor subunit
Succinate dehydrogenase flavoprotein subunit
Succinate dehydrogenase Fe-S protein subunit
Hypothetical protein
Hypothetical protein
Phosphoglycerate kinase
Glyceraldehyde 3-phosphate dehydrogenase
Transketolase
Hypothetical protein
5-aminolevulinic acid synthase
Outer membrane protein
Gamma-glutamyltranspeptidase
DNA recombinase
N-acetyltransferase GCN5-related
Transcriptional regulator for molybdenum transport MopA
Glucan biosynthesis periplasmic protein
Glucosyltransferase
N-acetylglucosamine-6-phosphate deacetylase
Major facilitator superfamily Glucose/galactose transporter
Hypothetical protein
DNA polymerase III gamma and tau subunit
Hypothetical protein
DNA recombinase
Oxidoreductase
Dihydroneopterin aldolase
Hypothetical protein
3-phosphoshikimate 1-carboxyvinyltransferase
Cytidylate kinase
SSU ribosomal protein S1
Gluconolactonase
Nucleoside-triphosphatase
Ribonuclease PH
Transcriptional repressor heat-inducible
Penicillin-binding protein 1A
Translation peptide chain release factor 2 (RF-2)
TonB-dependent Ferric iron siderophore receptor
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbB/TolQ/MotA
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbD/TolR
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbD/TolR
Hypothetical protein
Rod shape-determining protein
Cell division transpeptidase protein
Rod shape-determining protein
Rod shape-determining protein
Rod shape-determining protein
2-isopropylmalate synthase
Cytochrome c oxidase assembly protein
Hypothetical protein
Major facilitator superfamily Multidrug resistance transporter Bcr
Two component hybrid sensor histidine kinase and regulator
Adenine phosphoribosyltransferase
Fusaric acid resistance protein
Glycerate dehydrogenase
Uracil-DNA glycosylase
Alcohol dehydrogenase cytochrome c subunit
Alcohol dehydrogenase large subunit
Hypothetical protein
Hypothetical protein
Cytochrome o ubiquinol oxidase subunit II
Cytochrome o ubiquinol oxidase subunit I
Cytochrome o ubiquinol oxidase subunit III
Cytochrome o ubiquinol oxidase subunit IV
Hypothetical protein
Ferredoxin
DNA helicase
Leucyl aminopeptidase
Transcriptional regulator
Hypothetical protein
Polysaccharide biosynthesis protein
Undecaprenyl-phosphate alpha-N-acetylglucosaminephosphotransferase
Pleiotropic regulatory protein DnrJ/EryC1/StrS
Hypothetical protein
Dihydroorotase
Glutathione reductase
Ferredoxin--NADP reductase
RNA helicase
Oxidoreductase
Hypothetical protein
Peptidase S9
Malate dehydrogenase
Transcription antitermination factor
Protein translocase subunit
Hypothetical protein
ATP synthase F1 delta subunit
ATP synthase F1 alpha subunit
ATP synthase F1 gamma subunit
ATP synthase F1 beta subunit
ATP synthase F1 epsilon subunit
7-cyano-7-deazaguanine reductase/nitrile oxidoreductase
Ribonuclease D
Sugar kinase
Hypothetical protein
Hypothetical protein
Transporter of L-asparagine
ABC transporter Sulfate transporter ATP-binding protein
ABC transporter Sulfate transporter permease protein
ABC transporter Sulfate transporter permease protein
Hypothetical protein
Porin O/P polyphosphate-selective
Transposase
Porin O/P polyphosphate-selective
Thiosulphate-binding protein
Transcriptional regulator
Ethanolamine ammonia lyase large subunit
Ethanolamine ammonia-lyase small subunit
Amino acid transporter
Multidrug efflux pump acriflavin resistance protein
Resistance-nodulation-division superfamily Multidrug efflux pump acriflavin resistance protein
Secretion system type I outer membrane efflux pump lipoprotein NodT
Transcriptional regulator cold shock protein DNA-binding protein
Hypothetical protein
Transposase
Hypothetical protein
Transposase
Hypothetical protein
TonB-dependent Ferric iron siderophore receptor
Outer membrane protein
Glycosyl transferase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Aliphatic amidase
Two component response regulator
Two component hybrid sensor histidine kinase and regulator
ABC transporter Amide-urea transporter substrate-binding periplasmic protein
ABC transporter Amide-urea transporter permease protein
ABC transporter Amide-urea transporter permease protein
ABC transporter Amide-urea transporter ATP-binding protein
ABC transporter Amide-urea transporter ATP-binding protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Phage integrase
Hypothetical protein
Transposase
Hypothetical protein
Hypothetical protein
Transposase
Serine/threonine protein phosphatase
Protein kinase
Protein kinase
Phage integrase (C-terminal domain)
Transposase
Transposase
Transposase
Phage integrase (N-terminal domain)
Hypothetical protein
Hypothetical protein
ABC transporter Spermidine/putrescine transporter permease protein
ABC transporter Spermidine/putrescine transporter substrate-binding periplasmic protein
ABC transporter Spermidine/putrescine transporter ATP-binding protein
Hypothetical protein
Hypothetical protein
Transcriptional regulator
Major facilitator superfamily Multidrug resistance transporter HlyD/EmrA/FusE
Secretion system type I outer membrane efflux pump lipoprotein NodT
Hypothetical protein
Hypothetical protein
Squalene--hopene cyclase
Amine oxidase
Phytoene/squalene synthase
Phytoene/squalene synthase
Glycosyl transferase
Epimerase/dehydratase
Hypothetical protein
Cyclohexadienyl/arogenate/prephenate dehydrogenase
Hypothetical protein
Transcriptional regulator LysR
Peroxiredoxin
Peroxiredoxin reductase
Hypothetical protein
Aromatic ring-opening dioxygenase catalytic subunit
Inorganic pyrophosphatase
ABC transporter ATP-binding protein
Acetyltransferase
ABC transporter Toluene transporter auxiliary component
Lipoprotein VacJ family
Heat shock protein DnaJ-like protein
Hypothetical protein
Iron-sulfur cluster-binding protein
Queuine tRNA-ribosyltransferase
tRNA ribosyltransferase/isomerase
Hypothetical protein
Kinase inhibitor phospholipid-binding protein
Hypothetical protein
5,10-methylenetetrahydrofolate reductase
Methylene-tetrahydrofolate dehydrogenase
Hypothetical protein
Translation initiation inhibitor
Vitamin B12-dependent ribonucleotide reductase
NADH-ubiquinone oxidoreductase 17.2 kD subunit
ABC transporter Toluene transporter substrate-binding periplasmic protein
Hypothetical protein
Hypothetical protein
Trehalose phosphatase
Alpha,alpha-trehalose-phosphate synthase
Disulfide bond formation protein B
Glycosyl transferase
Phosphohydrolase
Aldo/keto reductase
Hypothetical protein
Excinuclease UvrABC helicase subunit B
Hypothetical protein
Peptidase
Hypothetical protein
Phosphatase IIIC
Hypothetical protein
Glycosyl transferase
Hypothetical protein
Amino acid transporter
DNA polymerase IV
Aspartyl/Asparaginyl beta-hydroxylase
Hypothetical protein
Dihydroorotate dehydrogenase
Hydrolase IIA
ADP-ribose pyrophosphatase
Hypothetical protein
5-formyltetrahydrofolate cyclo-ligase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Fructose-bisphosphate aldolase
Thiamine phosphate pyrophosphorylase
Hypothetical protein
Phage antirepressor
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Transposase
Transposase
Transposase
Transposase
Hypothetical protein
Beta-Ig-H3/fasciclin repeat containing protein
Hypothetical protein
Lysyl-tRNA synthetase
Lysine 2,3-aminomutase
Gamma-glutamyl transpeptidase
Methionine aminopeptidase
D-alanyl-D-alanine serine-type carboxypeptidase
Clp protease adaptor protein
Clp protease ATP-binding subunit
Hypothetical protein
Hypothetical protein
Transcriptional regulator
Hypothetical protein
Translation initiation inhibitor
Two component sensor histidine kinase
Two component response regulator
Heat shock protein
Heat shock protein Hsp70
Heat shock protein
Dihydrodipicolinate reductase
S-adenosylmethionine (SAM) synthetase
tRNA (guanine-N(7)-)-methyltransferase
Bifunctional protein(phosphoribosyl aminoimidazole carboxamide formyltransferase/IMP cyclohydrolase)
Hypothetical protein
Hypothetical protein
Integral membrane protein
Hypothetical protein
Glycyl-tRNA synthetase beta subunit
Glycyl-tRNA synthetase alpha subunit
Hypothetical protein
Transcriptional regulator
Apolipoprotein N-acyltransferase
Hypothetical protein
Transcriptional regulator
Hypothetical protein
Transcription termination factor
Hypothetical protein
Magnesium/cobalt transporter
Tryptophan synthase beta subunit
Tryptophan synthase alpha subunit
NAD(FAD)-utilizing dehydrogenases
GMP reductase
Histidyl-tRNA synthetase
Adenylosuccinate synthetase
Two component response regulator
Two component sensor histidine kinase
Phosphate-binding ABC transporter
Porin O/P polyphosphate-selective
Hypothetical protein
Hypothetical protein
Phosphoanhydride phosphohydrolase
Hemolysin/magnesium/cobalt transporter HlyC
Alcohol dehydrogenase, Zinc-dependent
ABC transporter Bacteriocin/lantibiotic exporter permease protein
Transporter
Hypothetical protein
Outer membrane protein
Oxidoreductase
N-acetyl-gamma-glutamyl-phosphate reductase
Nucleotide pyrophosphohydrolase
Hypothetical protein
Heat shock protein Hsp90
N-formylglutamate amidohydrolase
Prophage integrase
Hypothetical protein
Hypothetical protein
Transposase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Lipopolysaccharide modification acyltransferase
Hypothetical protein
Hypothetical protein
Endonuclease
Hypothetical protein
Hypothetical protein
Transcriptional regulator
2-methylcitrate dehydratase
Citrate synthase
Methylisocitrate lyase
Acetyl-CoA synthetase
Major facilitator superfamily Sugar transporter
Hypothetical protein
Hypothetical protein
Aminopeptidase
Hypothetical protein
Hypothetical protein
Aspartyl-tRNA synthetase
L-threonine aldolase
LSU ribosomal protein L25P
Peptidyl-tRNA hydrolase
GTP-binding protein
Gamma-glutamyl phosphate reductase
Nicotinate-nucleotide adenylyltransferase
Unknown function Iojap protein
Hypothetical protein
Thiosulfate sulfurtransferase
Transcriptional regulator LysR
Alpha-acetolactate decarboxylase
Acetolactate synthase large subunit
Hypothetical protein
Acetolactate synthase large subunit
Iron-sulfur (Fe-S) oxidoreductase
Iron-sulfur binding oxidoreductase
Hypothetical protein
Hypothetical protein
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Deoxycytidine triphosphate deaminase
Hypothetical protein
Porin B carbohydrate-selective OprB
Hypothetical protein
Sugar phosphotransferase system protein
Iron-sulfur (Fe-S) oxidoreductase
Ceramide glucosyltransferase
ABC transporter Toluene transporter auxiliary component
1-deoxy-D-xylulose-5-phosphate synthase
Iron-molybdenum cofactorbiosynthesis nitrogenase
Hemolysin/magnesium/cobalt transporter HlyC
Lytic murein transglycosylase
Bacteriophage-type DNA polymerase
Tetratricopeptide repeat family protein
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Hypothetical protein
Hypothetical protein
Oxidoreductase
Alkaline phosphatase
Hypothetical protein
Na+ driven multidrug/antimicrobial extrusion protein
ABC transporter O-antigene exporter ATP-binding protein
ABC transporter Polysaccharide/O-antigene exporter permease protein
Ribose-phosphate pyrophosphokinase
Phosphoglycerate mutase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
TonB-dependent Outer membrane colicin I receptor
Oxidoreductase
Transcriptional regulator LysR
Antiporter of Na+/H+ NhaA/NhaP
TonB-dependent Ferrichrome siderophore receptor
ABC transporter Ferrichrome transporter substrate-binding periplasmic protein
ABC transporter Ferrichrome Fe3+-siderophore transporter permease protein
ABC transporter Ferrichrome transporter ATP-binding protein
Beta-N-acetylhexosaminidase
N-acetylglucosamine kinase
Hypothetical protein
Symporter of Na+/proline
Glycosyl transferase
Hypothetical protein
Transposase
Transposase
Outer membrane protein
Two component response regulator
Outer membrane protein
Deoxyribodipyrimidine photo-lyase
Deoxyribodipyrimidine photo-lyase
Peptide methionine sulfoxide reductase
Hypothetical protein
Transporter
L-aspartate beta-decarboxylase
Transposase
Transposase
Transposase
Outer membrane protein
Transcriptional regulator starvation/low temperature inducible DNA-binding protein
Glycerol-3-phosphate dehydrogenase
Bacterioferritin-associated ferredoxin
Hypothetical protein
Hypothetical protein
Transcriptional regulator LysR
Methylamine dehydrogenase heavy chain
Methylamine utilization protein
Hypothetical protein
Methylamine dehydrogenase light chain
Cytochrome c class I
Hypothetical protein
Hypothetical protein
Hypothetical protein
2,5-diketo-D-gluconate reductase
Transcriptional regulator LysR
Aldehyde/betaine dehydrogenase
Alcohol dehydrogenase cytochrome c subunit
Aldehyde dehydrogenase large subunit
Aldehyde dehydrogenase small subunit
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Outer membrane protein
Major facilitator superfamily Transporter
Hypothetical protein
Endonuclease
Hypothetical protein
Phage integrase (truncated middle)
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Outer membrane protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
TonB-dependent Ferric iron siderophore receptor
Cytochrome c
D-amino acid oxidase
Hypothetical protein
Oxidoreductase
Hypothetical protein
Hypothetical protein
Outer membrane protein
Outer membrane protein
Lysine/threonine exporter protein
Hypothetical protein
Outer membrane protein
Transcriptional regulator
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Outer membrane protein
DNA resolvase
Outer membrane protein
Radical S-adenosylmethionine (SAM) protein
Acyltransferase
Hypothetical protein
Hypothetical protein
Phage terminase large subunit
Hypothetical protein
Hypothetical protein
Phage related protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Transposase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Phage baseplate assembly protein
Hypothetical protein
Phage Mu protein
Hypothetical protein
Tail fiber protein
Hypothetical protein
Hypothetical protein
Antiporter of Na+/H+ NhaA/NhaP
TonB-dependent receptor
Aminoglycoside phospho transferase
Transporter of nicotinamide mononucleotide
Hypothetical protein
Hypothetical protein
Formyltetrahydrofolate deformylase
Hypothetical protein
Transcriptional regulator Rrf2
Oxidoreductase
Integral membrane protein
Glyoxalase/bleomycin resistance dioxygenase
Hypothetical protein
Hypothetical protein
Acyl-CoA thioester hydrolase cytosolic long-chain
Outer membrane protein
TonB periplasmic protein
Metallopeptidase
TonB-dependent receptor
Transcriptional regulator
Acyl-CoA transferase
Transposase
Transposase
Transposase
Acyl-CoA transferase
Glycerate dehydrogenase
Acyl-CoA dehydrogenase
Oxidoreductase
Hypothetical protein
Hypothetical protein
Electron transfer flavoprotein beta subunit
Transposase
Transposase
Transposase
Transposase
Electron transfer flavoprotein alpha subunit
Aldehyde/L-sorbosone dehydrogenase
L-sorbose dehydrogenase
Major facilitator superfamily Glucose/galactose transporter
Hypothetical protein
Porin B carbohydrate-selective OprB
Hypothetical protein
Outer membrane protein
Transposase
Transposase
Transposase
Hypothetical protein
Inorganic phosphate low-affinity transporter
Hypothetical protein
Pyruvate dehydrogenase E1 component alpha subunit
Pyruvate dehydrogenase E1 component beta subunit
Esterase/lipase
Heat shock protein Hsp20
Hypothetical protein
NADH dehydrogenase
Hypothetical protein
Cobalamin synthesis protein
Chloride channel protein
Cation efflux system protein
Cation efflux system protein
Oxidoreductase
Esterase/lipase
Universal stress protein
Hypothetical protein
ABC transporter Oligopeptide transporter membrane spanning protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Molybdopterin biosynthesis protein
Hypothetical protein
Pyruvate kinase
Gluconolactonase
Major facilitator superfamily Transporter
Hypothetical protein
GTP-binding protein TypA
Hypothetical protein
Hypothetical protein
D-amino acid dehydrogenase small subunit
Thioredoxin reductase
Isocitrate dehydrogenase
Hypothetical protein
Hypothetical protein
Aminotransferase
Nitrogen regulatory protein PII/GlnB/GlnK
Glutamine synthetase
Hypothetical protein
Glucose dehydrogenase
Hypothetical protein
Transcriptional regulator
GTP-binding protein
Homoserine O-acetyltransferase
Methionine biosynthesis
RNA helicase
Hypothetical protein
Carbonic anhydrase
Hypothetical protein
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
DNA-directed RNA polymerase omega subunit
GTP pyrophosphokinase
Holo-[acyl-carrier protein] synthase
Signal peptidase I
Ribonuclease III
GTP-binding protein
Uridylate kinase
Ribosome Recycling Factor (RRF)
Undecaprenyl pyrophosphate synthetase
Phosphatidate cytidylyltransferase
1-deoxy-D-xylulose-5-phosphate reductoisomerase
Zinc metallopeptidase
Outer membrane protein
Outer membrane protein
UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
3R-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
Hypothetical protein
Lactoylglutathione lyase
Hypothetical protein
LSU ribosomal protein L34
Ribonuclease P protein component
Translocase inner membrane component
GTPase
Acetylglutamate kinase
2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
Acetylornithine deacetylase
Hypothetical protein
tRNA pseudouridine synthase A
Methionyl-tRNA formyl transferase
N-formylmethionylaminoacyl-tRNA deformylase
Heat shock protein Hsp20
Hypothetical protein
SSU ribosomal protein S30P
Hypothetical protein
Hypothetical protein
ABC transporter ATP-binding protein
Hypothetical protein
Hypothetical protein
Arabinose-5-phosphate isomerase GutQ
Ribonuclease D
Ribosomal large subunit 23S rRNA methyltransferase
Cytosine/purines/uracil/thiamine/allantoin transporter
Oxidoreductase
Guanylate kinase
Bifunctional protein (heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase)
Mannose-6-phosphate isomerase
DNA helicase
NERD domain-containing protein
Mechanosensitive ion channel
Hypothetical protein
ABC transporter ATP-binding protein
ABC transporter permease protein
Hypothetical protein
DNA repair protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Amino acid/polyamine transporter
Hypothetical protein
Bifunctional protein (proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase)
Transcriptional regulator
Alcohol dehydrogenase small subunit
Acetyl-CoA synthetase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Methyltransferase
Hypothetical protein
Cobalamin adenosyltransferase family protein
Hypothetical protein
Hypothetical protein
Oxidoreductase
Hypothetical protein
Translation modulator YciO/YrdC/YwlC
3'(2'),5'-bisphosphate nucleotidase
Leucyl/cytosol aminopeptidase
DNA polymerase III chi subunit
Aldo/keto reductase
Endopeptidase DegP/Do
DNA helicase
Hypothetical protein
Heat shock protein Hsp33
Hypothetical protein
Ornithine carbamoyltransferase
Bifunctional protein (acetylornithine/succinylornithine aminotransferase)
RecA repressor protein
Hypothetical protein
Twin-arginine translocation protein
Sugar aldolase
Dioxygenase
2,3-diketo-5-methylthio-1-phosphopentane phosphatase
Riboflavin kinase
Isoleucyl-tRNA synthetase
Lipoprotein signal peptidase
Hypothetical protein
DNA mismatch repair protein
NADH-quinone oxidoreductase chain M
Transporter
DNA topoisomerase IV subunit B
Hypothetical protein
Hypothetical protein
Transcriptional regulator Rrf2
Cysteine synthase A
Outer membrane protein
Hypothetical protein
Carboxy-terminal processing protease
Ribonuclease R
DNA topoisomerase I
DNA processing chain A
Transposase
Transposase
Transposase
DNA processing chain A
Hypothetical protein
Dihydroorotase
Aspartate carbamoyltransferase
Glutamyl-tRNA synthetase
DNA translocation competence protein ComEC/Rec2
Alkylhydroperoxidase
AFG1-family ATPase
2-oxoglutarate dehydrogenase E1 component
2-oxoglutarate dehydrogenase E2 component
Dihydrolipoamide dehydrogenase
Hypothetical protein
Hypothetical protein
Adenosylhomocysteinase
1-acyl-sn-glycerol-3-phosphate acyltransferase
Hypothetical protein
Hydroxyacylglutathione hydrolase
Methyltransferase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
NADH-ubiquinone oxidoreductase 49kDa subunit
NADH-ubiquinone oxidoreductase 20 kDa subunit
CDP-diacylglycerol--serine O-phosphatidyltransferase
Phosphatidylserine decarboxylase
Alanyl-tRNA synthetase
Hypothetical protein
Outer membrane protein
Bifunctional protein (shikimate kinase / 3-dehydroquinate synthase)
Hypothetical protein
Phage DNA site-specific tyrosinerecombinase RipX
Acetyl-CoA carboxylase carboxyl transferase alpha subunit
Competence-damage protein
Lysyl-tRNA synthetase
Transporter
Multiple antibiotic resistance (MarC) family protein
Hypothetical protein
O-sialoglycoprotein endopeptidase
Porphobilinogen deaminase
Uroporphyrinogen-III synthase
Protein translocase subunit
Mitochondrial import inner membrane translocase subunit
Phosphoglycerate mutase
DNA methyltransferase
Cytochrome c peroxidase
DNA mismatch repair protein Smr
Hypothetical protein
Coproporphyrinogen III oxidase
Ubiquinol-cytochrome c reductase cytochrome b
Ubiquinol-cytochrome c reductase cytochrome c1
5'-methylthioadenosine phosphorylase
Hypothetical protein
Lysine/threonine exporter protein
Hypothetical protein
NAD(P)H nitroreductase
Ornithine cyclodeaminase
Aldehyde dehydrogenase
Transcriptional regulator
Transposase
Transposase
Transposase
Hypothetical protein
Hypothetical protein
Hypothetical protein
DNA resolvase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Phage integrase
Toxin-antitoxin systems
Toxin-antitoxin systems
Hypothetical protein
Holliday junction resolvase RusA
Hypothetical protein
Phage related tail protein
Hypothetical protein
Excinuclease ATPase subunit
Stringent response modulating ppGpp metabolism protein
Transposase
Transposase
Transposase
Transposase
Transposase
Transcriptional regulator
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
DNA/RNA helicase
Hypothetical protein
3-methyl-2-oxobutanoate hydroxymethyltransferase
NADH:flavin oxidoreductase
Transcriptional regulator
Alcohol dehydrogenase, Zinc-dependent
Peptidase S1/S6
UDP-galactose 4-epimerase
Hypothetical protein
Diaminopimelate decarboxylase
Hypothetical protein
Argininosuccinate lyase
Hypothetical protein
Hypothetical protein
N-formylglutamate amidohydrolase
Shikimate 5-dehydrogenase
Dephospho-CoA kinase
DNA polymerase III exonuclease epsilon subunit
Hypothetical protein
Glycosyl transferase
Hypothetical protein
Ribulose-phosphate 3-epimerase
tRNA/rRNA cytosine-C5-methylase Nop2/Sun
Phosphoribosyl glycinamide formyltransferase
Phosphoribosyl formylglycinamidine cyclo-ligase
Chromosomal replication initiator protein DnaA-related protein
Polyphosphate kinase
Exopolyphosphatase
Two component hybrid sensor histidine kinase and regulator
ABC transporter permease protein
ABC transporter ATP-binding protein
ABC transporter substrate-binding periplasmic protein
Hypothetical protein
Hypothetical protein
ATP-sensitive potassium transporter
Fusaric acid resistance protein
Fusaric acid resistance protein
Hypothetical protein
Hypothetical protein
Cytochrome c-type biogenesis protein
Cytochrome c-type biogenesis protein
Cytochrome c biogenesis thiol:disulfide interchange protein
Cytochrome c-type biogenesis protein
Cytochrome c-type biogenesis protein
Hypothetical protein
Heme exporter protein C
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
D-isomer specific 2-hydroxyacid dehydrogenase
tRNA(Leu/Phe)-protein transferase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Glutamate-ammonia-ligase adenylyltransferase
Thioredoxin peroxidase
Hypothetical protein
Major facilitator superfamily Alpha-ketoglutarate/sugar transporter
Hypothetical protein
DNA recombinase
Two component response regulator
Two component sensor histidine kinase
Resistance-nodulation-division superfamily Multidrug efflux pump acriflavin resistance protein
Multidrug efflux pump acriflavin resistance protein
Secretion system type I outer membrane efflux pump lipoprotein NodT
LSU ribosomal protein L11P
LSU ribosomal protein L1P
LSU ribosomal protein L10P
LSU ribosomal protein L12P
DNA-directed RNA polymerase beta subunit
DNA-directed RNA polymerase beta' subunit
SSU ribosomal protein S12P
SSU ribosomal protein S7P
Translation elongation factor Tu (EF-TU)
SSU ribosomal protein S10P
LSU ribosomal protein L3P
LSU ribosomal protein L4P
LSU ribosomal protein L23P
LSU ribosomal protein L2P
SSU ribosomal protein S19P
LSU ribosomal protein L22P
SSU ribosomal protein S3P
LSU ribosomal protein L16P
LSU ribosomal protein L29P
SSU ribosomal protein S17P
LSU ribosomal protein L14P
LSU ribosomal protein L24P
LSU ribosomal protein L5P
SSU ribosomal protein S14P
SSU ribosomal protein S8P
LSU ribosomal protein L6P
LSU ribosomal protein L18P
SSU ribosomal protein S5P
LSU ribosomal protein L30P
LSU ribosomal protein L15P
Protein translocase subunit
Adenylate kinase
SSU ribosomal protein S13P
SSU ribosomal protein S11P
DNA-directed RNA polymerase alpha subunit
LSU ribosomal protein L17P
ABC transporter Nitrate/sulfonate/bicarbonate transporter substrate-binding periplasmic protein
ABC transporter Nitrate/sulfonate/bicarbonate transporter permease protein
ABC transporter Nitrate/sulfonate/bicarbonate transporter ATP-binding protein
Hypothetical protein
Hypothetical protein
Secretion system type I outer membrane efflux pump lipoprotein NodT
Resistance-nodulation-division superfamily Multidrug efflux pump acriflavin resistance protein
Resistance-nodulation-division superfamily Multidrug efflux pump acriflavin resistance protein
Multidrug efflux pump acriflavin resistance protein
Major facilitator superfamily Multidrug resistance translocase
Hypothetical protein
Ribonuclease HII
DNA methyltransferase
Ankyrin repeat protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Transcriptional regulator
Hypothetical protein
Poly(A) polymerase
ABC transporter ATP-binding
Major facilitator superfamily Multidrug resistance transporter HlyD/EmrA/FusE
Major facilitator superfamily Multidrug resistance transporter QacA
Nucleoside polyphosphate hydrolase
Hypothetical protein
Carboxy-terminal processing protease
Metallopeptidase Membrane-bound
Phosphoglycerate mutase
Threonine dehydratase
Transcription elongation factor
Carbamoyl-phosphate synthase large subunit
Carbamoyl-phosphate synthase small subunit
Amidotransferase GatB/YqeY subunit for mischarged Glu-tRNA(Gln)
DNA primase
DNA-directed RNA polymerase sigma 70
Acetyltransferase
SSU ribosomal protein S6P
SSU ribosomal protein S18P
LSU ribosomal protein L9P
Cyclopropane-fatty-acyl-phospholipid synthase
Dimethyladenosine transferase
Peptidyl-prolyl cis-trans isomerase
Organic solvent tolerance protein
Transporter YjgP/YjgQ
Transporter YjgP/YjgQ
Hypothetical protein
ABC transporter Multidrug transporter ATP-binding protein
Transcriptional regulator
Cell division inhibitor
Chromosome partitioning protein ParA/MRP/soj
Cell division inhibitor
Glutathione S-transferase
NAD(FAD)-utilizing dehydrogenase
ABC transporter Amino acid transporter periplasmic protein
Tetrapyrrole/corrin/porphyrin methyltransferase
O-linked N-acetylglucosamine transferase
Transcriptional regulator
Hypothetical protein
S-formylglutathione hydrolase/esterase
Hypothetical protein
Cell division protein
Cell division ATP-binding protein
Hypothetical protein
Hypothetical protein
Two component sensor histidine kinase
Two component hybrid sensor histidine kinase and regulator
Endopeptidase ATP-dependent hsl proteolytic subunit
Endopeptidase ATP-dependent hsl ATP-binding subunit
Iron-sulfur (Fe-S) metabolism associated
Aldehyde dehydrogenase large subunit
Aldehyde dehydrogenase small subunit
Aldehyde dehydrogenase cytochrome c subunit
NADPH-dependent L-sorbose reductase
LSU ribosomal protein L35P
LSU ribosomal protein L20P
Phenylalanyl-tRNA synthetase alpha subunit
Phenylalanyl-tRNA synthetase beta subunit
Phosphate transporter phosphate-binding periplasmic protein
ABC transporter Dipeptide transporter substrate-binding periplasmic protein
Hypothetical protein
Antiporter of Na+/H+
Hypothetical protein
SSU ribosomal protein S4P
Translation peptide chain release factor 3 (RF-3)
Phosphohydrolase
Isocitrate dehydrogenase
Xaa-Pro aminopeptidase
Ribosomal protein L11 methyltransferase
DNA helicase II
DNA repair protein
DNA repair protein
Phosphoribosyl aminoimidazole carboxylase ATPase subunit
Phosphoribosylaminoimidazole carboxylase catalytic subunit
Hypothetical protein
Hypothetical protein
Hypothetical protein
Heat shock protein Hsp20
LSU ribosomal protein L31P
Large-conductance mechanosensitive channel
Hypothetical protein
Protein translocase membrane subunit
Protein translocase membrane subunit
Oxidoreductase
Ribonucleotide-diphosphate reductase alpha subunit
Ribonucleotide-diphosphate reductase beta subunit
Methyltransferase
Decaprenyl diphosphate synthase
Glutamate racemase
Orotate phosphoribosyltransferase
Hypothetical protein
Citrate synthase
Phosphohistidine phosphatas
Chorismate mutase
Phosphatase
Acetyl-CoA hydrolase
Hypothetical protein
Chromosome segregation protein SMC
Thiol:disulfide interchange protein
Hemolysin/magnesium/cobalt transporter HlyC
Hypothetical protein
Phosphate starvation-inducible protein
tRNA 2-methylthioadenosine synthase
1-acyl-sn-glycerol-3-phosphate acyltransferase
Hypothetical protein
Outer membrane protein
Hypothetical protein
Exodeoxyribonuclease III
Dipeptidase
Excinuclease UvrABC subunit C
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
Hypothetical protein
Molybdopterin converting factor small subunit
Molybdopterin converting factor large subunit
Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
8-amino-7-oxononanoate synthase
Hypothetical protein
Biotin synthesis protein
Transcriptional regulator
Molybdopterin biosynthesis protein
LSU ribosomal protein L33P
Septum formation inhibitor
Phosphopyruvate hydratase
Hypothetical protein
Thiamine biosynthesis oxidoreductase
Thiamine biosynthesis protein
Thiazole synthase
Thiamine phosphate pyrophosphorylase
DNA helicase
Hypothetical protein
Transcription-repair coupling factor
Hypothetical protein
Bile acid/Na+ symporter
Aromatic-L-amino-acid decarboxylase
Cobaltochelatase subunit
Cobaltochelatase subunit
Heat shock protein
Stress response and cell division protein
Outer-membrane lipoprotein carrier protein
Lipoate-protein ligase B
UTP--glucose-1-phosphate uridylyltransferase
Phosphomanno mutase
Molybdenum cofactor biosynthesis protein A
Methyltransferase
Competence protein F
Glutaredoxin
Hypothetical protein
Hypothetical protein
3-carboxymuconate cyclase
3-demethylubiquinone-9 3-methyltransferase
Aspartate kinase
Enoyl-[acyl-carrier-protein] reductase
Hypothetical protein
4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
Histidyl-tRNA synthetase
Translation peptide chain release factor 1 (RF-1)
Hypothetical protein
Modification methylase
Hypothetical protein
ABC transporter Toluene transporter substrate-binding periplasmic protein
Undecaprenol kinase
Amino acid transporter
D-alanine--D-alanine ligase
Hypothetical protein
Lytic murein transglycosylase
Rare lipoprotein A
D-alanyl-D-alanine carboxypeptidase
Thymidylate kinase
DNA polymerase III delta prime subunit
Methionyl-tRNA synthetase
Deoxyribonuclease TatD
Metal-dependent hydrolase
Universal stress protein
Pyridoxamine 5'-phosphate oxidase
Oxidoreductase
Chorismate synthase
Osmotically inducible protein
Malate:quinone oxidoreductase
Hypothetical protein
Queuosine biosynthesis protein QueC
Hypothetical protein
Biotin synthase
Hypothetical protein
Phosphoadenosine phosphosulfate reductase
Sulfate adenylyltransferase subunit 2
Bifunctional protein (sulfate adenylyltransferase subunit 1/adenylylsulfate kinase)
Hypothetical protein
Nitrite/sulfite reductase
Hypothetical protein
3-deoxy-D-manno-octulosonic-acid transferase
Tetraacyldisaccharide 4'-kinase
Lipid A biosynthesis lauroyl acyltransferase
Myo-inositol-1(or 4)-monophosphatase
Hypothetical protein
Aminodeoxychorismate lyase
3-oxoacyl-[acyl-carrier-protein] synthase II
Acyl carrier protein
Oxidoreductase
Malonyl-CoA-[acyl-carrier-protein] transacylase
Hypothetical protein
Methyltransferase
ABC transporter Glycine/betaine transporter substrate-binding periplasmic protein
DNA resolvase
Transposase
Hypothetical protein
Hypothetical protein
Transcriptional regulator cold shock protein
Trans-translation helper factor
Dihydrodipicolinate synthase
Prephenate dehydratase
3-deoxy-D-manno-octulosonate cytidylyltransferase
Cytochrome c
Inositol-1-monophosphatase
D-3-phosphoglycerate dehydrogenase
Magnesium chelatase-related protein
Cystathionine beta-lyase
Thiosulfate sulfurtransferase
Transporter
Hypothetical protein
Hypothetical protein
Phospholipase D
Hypothetical protein
Glutaredoxin
BolA-like protein
Phosphoribosyl formylglycinamidine synthase II
Phosphoribosyl formylglycinamidine synthase I
Hypothetical protein
Phosphoribosyl formylglycinamidine synthase
Phosphoribosyl amidoimidazole succinocarboxamide synthase
Adenylosuccinate lyase
Integral membrane protein
Lytic murein transglycosylase
Phosphatidylglycerophosphatase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Lipoyl synthase
Dihydrolipoamide dehydrogenase
Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex
Pyruvate dehydrogenase E1 component beta subunit
Pyruvate dehydrogenase E1 component alpha subunit
Molybdopterin biosynthesis protein
Indole-3-glycerol phosphate synthase
Anthranilate phosphoribosyltransferase
Anthranilate synthase component II
Anthranilate synthase component I
Peptidyl-prolyl cis-trans isomerase
Triosephosphate isomerase
Protein translocase subunit
CTP synthase
3-deoxy-8-phosphooctulonate synthase
DNA gyrase subunit B
DNA replication and repair protein
DNA polymerase III beta subunit
Chromosomal replication initiator protein
SSU ribosomal protein S20P
Formamidopyrimidine-DNA glycosylase
Ubiquinone/menaquinone biosynthesis methyltransferase
Bifunctional protein (phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase)
Deoxyuridine 5'-triphosphate nucleotidohydrolase
ABC transporter Anion transporter permease protein
ABC transporter Nitrate/sulfonate/bicarbonate transporter ATP-binding protein
Methionine sulfoxide reductase A
Valyl-tRNA synthetase
Hypothetical protein
Secretion system type I outer membrane protein
Protein-L-isoaspartate (D-aspartate) O-methyltransferase
Outer membrane protein
Hypothetical protein
Hypothetical protein
Oxidoreductase
Hypothetical protein
Thiamine monophosphate kinase
Transcription antitermination factor
Hypothetical protein
Hypothetical protein
Glycerol kinase
Major facilitator superfamily Glycerol uptake transporter
Glycerol-3-phosphate dehydrogenase
Transcriptional suppressor
DNA helicase
Hypothetical protein
ABC transporter ATP-binding protein
ABC transporter ATP-binding protein
Two component hybrid sensor histidine kinase and regulator
Hypothetical protein
DNA-directed RNA polymerase sigma-E/Sigma-24/FecI
DNA-directed RNA polymerase sigma-E/Sigma-24/FecI
Two component response regulator
ABC transporter ATP-binding protein
Trehalase
Alcohol dehydrogenase, Zinc-dependent
Alkylphosphonate uptake protein
Transporter
2-dehydropantoate 2-reductase
Phenazine biosynthesis PhzC/PhzF protein
Hydroxydechloroatrazine ethylaminohydrolase
ABC transporter Nitrate/sulfonate/bicarbonate transporter substrate-binding periplasmic protein
Hypothetical protein
ABC transporter Nitrate/sulfonate/bicarbonate transporter ATP-binding protein
ABC transporter Nitrate/sulfonate/bicarbonate transporter permease protein
2OG-Fe(II) oxygenase
Hydroxydechloroatrazine ethylaminohydrolase
TonB-dependent receptor
Allantoate amidohydrolase
Serine--pyruvate aminotransferase
Hypothetical protein
Hypothetical protein
Amidase
Xanthine dehydrogenase accessory factor CoxI
Xanthine dehydrogenase
Xanthine dehydrogenase
Transporter of xanthine/uracil
Hypothetical protein
Hypothetical protein
Polysaccharide deacetylase
Oxidoreductase
Transcriptional regulator LysR
Guanine deaminase
Gamma-glutamyl transpeptidase
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbD/TolR
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbD/TolR
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbB/TolQ/MotA
TonB periplasmic protein
Hypothetical protein
ABC transporter Multidrug transporter ATP-binding protein
ABC transporter Multidrug transporter permease protein
Secretion system type I outer membrane efflux pump lipoprotein NodT
Transcriptional regulator LysR
Hypothetical protein
Hypothetical protein
Squalene--hopene cyclase
Transcriptional regulator
Transcriptional regulator
Hypothetical protein
Na+/H+ Antiporter
Aldehyde dehydrogenase
NADH:flavin oxidoreductase
Transcriptional regulator
Catalase
Translation peptide chain release factor Class I
Hypothetical protein
Cyclic beta 1-2 glucan synthetase
Cyclic beta 1-2 glucan synthetase
Amidohydrolase
Acetyltransferase
Phosphomethylpyrimidine kinase
Hypothetical protein
Hypothetical protein
TonB dependent Ferric iron siderophore receptor
TonB dependent Ferric iron siderophore receptor
ABC transporter ATP-binding protein
Hypothetical protein
Hypothetical protein
Heat shock protein Hsp70
Secretion system type I outer membrane efflux pump lipoprotein NodT
Cobalt/zinc/cadmium resistance heavy metal efflux pump protein
Major facilitator superfamily Multidrug resistance transporter EmrA/FusE
Quaternary ammonium compound-resistance protein
Transcriptional regulator
Hypothetical protein
Lipopolysaccharide biogenesis periplasmic protein
Major facilitator superfamily Transporter
Transcriptional regulator
Outer membrane protein
Hypothetical protein
Transcriptional regulator
Hypothetical protein
Major facilitator superfamily Transporter
Transcriptional regulator
TonB-dependent Ferric iron siderophore receptor
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbD/TolR
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbB/TolQ/MotA
Hypothetical protein
Hypothetical protein
Transposase
Transposase
Hypothetical protein
Ferric iron siderophore receptor
Transposase
Ferric iron siderophore receptor
Two component sensor histidine kinase PupR
DNA-directed RNA polymerase sigma-E/Sigma-24/FecI
TonB-dependent Outer membrane siderophore receptor
Two component sensor histidine kinase PupR
Transposase
Transposase
DNA-directed RNA polymerase sigma-E/Sigma-24/FecI
ABC transporter Aliphatic sulphonate transporter substrate-binding periplasmic protein
ABC transporter Aliphatic sulfonates transporter ATP-binding protein
ABC transporter Aliphatic sulfonates transporter permease protein
Hypothetical protein
Alpha-ketoglutarate-dependent taurine dioxygenase
TonB-dependent receptor
Transposase
Transposase
Transposase
TonB-dependent receptor
Major facilitator superfamily Transporter
Hypothetical protein
Transposase
D-galactonate transporter
Transposase
D-galactonate transporter
Transcriptional regulator LysR
Dihydroxy-acid dehydratase
2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
N-acyl-D-glutamate deacylase
Transposase
N-acyl-D-glutamate deacylase
Transcriptional regulator LysR
Alcohol dehydrogenase iron-containing
Major facilitator superfamily Sugar transporter
Aldehyde/methylmalonate-semialdehyde dehydrogenase
ABC transporter Nitrate/sulfonate/bicarbonate transporter substrate-binding periplasmic protein
ABC transporter Nitrate/sulfonate/bicarbonate transporter permease protein
ABC transporter Nitrate/sulfonate/bicarbonate transporter ATP-binding protein
Transcriptional regulator
Hypothetical protein
Hypothetical protein
Urea amidolyase
Amidase
Arylesterase
DNA helicase
Acyl-CoA dehydrogenase
Outer membrane protein
Transposase
Outer membrane protein
Heme oxygenase
Transposase
Transposase
Major facilitator superfamily Sugar transporter
Monooxygenase
TonB-dependent Outer membrane siderophore receptor
Flavin mononucleotide (FMN) reductase
Major facilitator superfamily Sugar transporter
Hypothetical protein
Alkanesulfonate monooxygenase
Monooxygenase
Acyl-CoA dehydrogenase
Acyl-CoA dehydrogenase
Nitroreductase
Transposase
Transposase
Type I restriction-modification system, M subunit
Transposase
Type I restriction-modification system, S subunit
Type I/III endonuclease/restriction R subunit
Transposase
Type I endonuclease/restriction R subunit
Metal-dependent hydrolase
Hypothetical protein
Hypothetical protein
Transposase
Transposase
Transposase
Transposase
Transposase
Excinuclease UvrABC subunit A
C4-dicarboxylate transporter
Thiopurine S-methyltransferase
Glutaredoxin
Major facilitator superfamily Alpha-ketoglutarate transporter
Cobalamin(vitamin B12) biosynthesis protein Cobalt-precorrin-6A biosynthesis protein
Precorrin-4 C11-methyltransferase
Cobalamin(vitamin B12) biosynthesis protein
Cobalamin(vitamin B12) biosynthesis protein Precorrin-6Y C5,15-methyltransferase
Precorrin 6x reductase
Precorrin-3B C17-methyltransferase
Precorrin-2 C20-methyltransferase
Cobalamin(vitamin B12) biosynthesis protein Precorrin-8X methylmutase
Cobalamin(vitamin B12) biosynthesis protein Precorrin-3B biosynthesis protein
Hypothetical protein
Fumarate hydratase class II
Hypothetical protein
Transcriptional regulator
Hypothetical protein
Glucose dehydrogenase
Hypothetical protein
Na+/H+ antiporter
Hypothetical protein
Hypothetical protein
Hypothetical protein
Transporter
Hypothetical protein
Acetate kinase
Phosphate acetyl/butaryl transferase
Dihydroorotate dehydrogenase
Pyruvate ferredoxin/flavodoxin oxidoreductase
Glutamate synthase [NADPH] small subunit
Hypothetical protein
Transcriptional regulator
Hypothetical protein
Glutathione S-transferase
Formate dehydrogenase family accessory protein
Molybdopterin-guanine dinucleotide biosynthesis protein A
Molybdopterin-guanine dinucleotide biosynthesis protein B
Molybdopterin biosynthesis protein
Formate dehydrogenase accessory protein
Formate dehydrogenase gamma subunit
Formate dehydrogenase beta subunit
Formate dehydrogenase alpha subunit
Exopolyphosphatase
Ribosomal RNA large subunit 23S methyltransferase RrmJ
Fructokinase
Two component response regulator
Exodeoxyribonuclease VII small subunit
Geranylgeranyl pyrophosphate synthase
1-deoxy-D-xylulose-5-phosphate synthase
Hemolysin HlyA
Hypothetical protein
Iron-sulfur (Fe-S) cluster redox enzyme
Argininosuccinate synthase
Peptidyl-prolyl cis-trans isomerase
Cytochrome c class I
Tryptophanyl-tRNA synthetase
Hypothetical protein
Two component response regulator
Hypothetical protein
Na+/H+ antiporter
tRNA/rRNA cytosine-C5-methylase Nop2/Sun
Inosine-5'-monophosphate dehydrogenase
ABC transporter Dipeptide transporter substrate-binding periplasmic protein
ABC transporter Oligopeptide transporter permease protein
ABC transporter Oligopeptide transporter permease protein
ABC transporter Oligopeptide transporter ATP-binding protein
ABC transporter Oligopeptide transporter ATP-binding protein
Enoyl-[acyl-carrier-protein] reductase
Acid phosphatase precursor
Ribonuclease I
Purine nucleoside transporter
Phospholipase C
TonB-dependent receptor
Hypothetical protein
Hypothetical protein
Feruloyl esterase
Major facilitator superfamily Multidrug resistance transporter QacA
Siderophore-interacting iron utilization protein
O-methyltransferase
Transcriptional regulator
TonB-dependent receptor
Major facilitator superfamily Multidrug resistance transporter HlyD/EmrA/FusE
Fusaric acid resistance protein
Outer membrane efflux protein
Methyltransferase
Hypothetical protein
TonB-dependent Ferrichrome siderophore receptor
Mechanosensitive ion channel
L-sorbosone dehydrogenase
L-sorbosone dehydrogenase
Hypothetical protein
Cytochrome bd ubiquinol oxidase subunit II
Cytochrome bd ubiquinol oxidase subunit I
ABC transporter ATP-binding protein
ABC transporter ATP-binding
Hypothetical protein
2OG-Fe(II) oxygenase
TonB-dependent Outer membrane siderophore receptor
Hypothetical protein
Transposase
Hypothetical protein
L-asparaginase II
Aspartate aminotransferase
Aspartate:alanine antiporter
Glycosyl transferase
Hypothetical protein
Acyl-CoA dehydrogenase
Transposase
Hypothetical protein
ABC transporter ATP-binding protein
Transcriptional regulator LysR
Hypothetical protein
Transposase
Outer membrane protein
TonB-dependent Outer membrane siderophore receptor
Alcohol dehydrogenase, Zinc-dependent
Transposase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Cation transporter MgtC/SapB
Hypothetical protein
Hypothetical protein
Oxalyl-CoA decarboxylase
Transposase
Acetolactate synthase large subunit
Formyl-CoA transferase
Hypothetical protein
Oxidoreductase
Transcriptional regulator
Oxidoreductase
Hypothetical protein
Hypothetical protein
Major facilitator superfamily Transporter
Phosphogluco mutase
Maltose O-acetyltransferase
Hypothetical protein
Outer membrane protein
Transposase
Transposase
Two component sensor histidine kinase PupR
DNA-directed RNA polymerase sigma-E/Sigma-24/FecI
DNA polymerase III alpha subunit
Nodulin-related integral membrane protein
Two component sensor histidine kinase
Two component response regulator
Resistance-nodulation-division superfamily Multidrug efflux pump acriflavin resistance protein
Major facilitator superfamily Heavy metal/cation efflux pump HlyD
Cobalt/zinc/cadmium resistance heavy metal efflux pump protein
Hypothetical protein
Hypothetical protein
Acyl-CoA synthetase
Acyl carrier protein
Serine palmitoyltransferase
Hypothetical protein
Diacylglycerol kinase
Metallophosphoesterase
Transporter YjgP/YjgQ
Transporter YjgP/YjgQ
Fatty acid hydroxylase
Hypothetical protein
Phosphoglycolate phosphatase
Bifunctional protein (UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase)
Glucosamine--fructose-6-phosphate aminotransferase (isomerising)
Transposase
Transposase
Transposase
Transposase
Transposase
Hypothetical protein
Transcriptional regulator IclR family
Glutathione peroxidase
Lipoprotein releasing system ATP-binding protein
Lipoprotein releasing system transmembrane protein LolC/E
Prolyl-tRNA synthetase
Metal-dependent hydrolase
Transcriptional activator Baf
Biotin--acetyl-CoA-carboxylase ligase
NADH-quinone oxidoreductase chain N
NADH-quinone oxidoreductase chain L
NADH-quinone oxidoreductase chain K
NADH-quinone oxidoreductase chain J
NADH-quinone oxidoreductase chain I
NADH-quinone oxidoreductase chain H
NADH-quinone oxidoreductase chain G
NADH-quinone oxidoreductase chain F
NADH-quinone oxidoreductase chain E
NADH-quinone oxidoreductase chain D
NADH-quinone oxidoreductase chain C
NADH-quinone oxidoreductase chain B
NADH-quinone oxidoreductase chain A
Histone-like bacterial DNA-binding protein HU
Lon protease ATP-dependent
Clp protease ATP-binding subunit
Clp protease proteolytic subunit
Peptidyl-prolyl cis-trans isomerase trigger factor
Sugar kinase
Hypothetical protein
DNA/RNA helicase
Ribosomal RNA large subunit 23S/tRNA (Uracil-5-)methyltransferase
Iron-sulfur (Fe-S) cluster assembly protein YadR/YfhF
Metal-sulfur cluster biosynthetic enzyme
NifU family SUF system FeS assembly protein
Cysteine desulfurase
Iron-sulfur (Fe-S) assembly protein
ABC transporter FeS assembly ATPase
ABC transporter FeS assembly protein
Transcriptional regulator
Hypothetical protein
Phosphoenolpyruvate carboxylase
Esterase/lipase
Translation elongation factor G (EF-G)
LSU ribosomal protein L28P
Hypothetical protein
ABC transporter Multidrug resistance transporter ATP-binding protein MsbA
Thiamin pyrophosphokinase
Uridylyltransferase PII
DNA mismatch repair protein Smr
O-linked N-acetylglucosamine transferase
Carboxypeptidase
Hypothetical protein
Threonine synthase
Processing protease protein M16 family
Zinc-dependent microcin-processing U62/TldD
Mitochondrial import inner membrane translocase subunit
Hypothetical protein
Protoheme IX farnesyltransferase
Cytochrome c oxidase subunit 1
Phosphatidylethanolamine N-methyltransferase
Hypothetical protein
Glutathione synthetase
Glycosyl transferase
Dolichol-phosphate mannosyltransferase
Transcriptional regulator Lrp
Thioredoxin reductase
Transcriptional regulator LysR
Transcriptional regulator Ros/MucR
Integration host factor DNA-binding beta subunit
Phage DNA polymerase-related protein
Integral membrane protein
Transporter
Transcriptional regulator
Integration host factor DNA-binding alpha subunit
3-oxoacyl-[acyl-carrier-protein] synthase III
Fatty acid/phospholipid synthesis protein
LSU ribosomal protein L32P
Hypothetical protein
Lipoprotein OmlA
Two component sensor histidine kinase
Two component response regulator
Transcriptional regulator
Hypothetical protein
Peptide deformylase
SSU ribosomal protein S21P
3-isopropylmalate dehydrogenase
3-isopropylmalate dehydratase small subunit
3-isopropylmalate dehydratase large subunit
LSU ribosomal protein L19P
tRNA (guanine-N(1)-)-methyltransferase
Ribosomal RNA small subunit 16S rRNA processing protein
SSU ribosomal protein S16P
Signal recognition particle GTPase FFH
Hypothetical protein
ATP synthase F1 mitochondrial assembly chaperone
Lipopolysaccharide biogenesis periplasmic protein
Ribosomal RNA large subunit 23S rRNA pseudouridine synthase C
AAA ATPase
Outer-membrane lipoprotein carrier protein
4-hydroxybenzoate polyprenyltransferase
Hypothetical protein
Glutamate--cysteine ligase
Major facilitator superfamily Transporter
Hypothetical protein
GTP-binding protein
Dehydrogenase
Hypothetical protein
Hypothetical protein
Lipopolysaccharide (LPS) heptosyltransferase
Glycosyl transferase
Asparagine synthetase
Aminomethyltransferase
Phosphoribosyl-AMP cyclohydrolase
Lipid-A-disaccharide synthase
Transporter of sulfate
Hypothetical protein
3-hydroxyisobutyrate dehydrogenase
Phytoene/squalene synthase
Superoxide dismutase
Clp protease ATP-binding subunit
Phosphohydrolase
GTP-binding GTPase
RNA-binding protein
Two component response regulator
Two component sensor histidine kinase
Two component response regulator
Two component sensor histidine kinase
tRNA-dihydrouridine synthase
Bifunctional enzyme IspD/IspF
Glycosyl transferase
Glycosyl transferase
Hypothetical protein
Hypothetical protein
UDP-galactopyranose mutase
Glycosyl transferase
Oxidoreductase
Xanthine-guanine phosphoribosyltransferase
Glycosyl transferase
Uracil phosphoribosyltransferase
Hypothetical protein
Hypothetical protein
UDP-glucose 6-dehydrogenase
Transposase
Nitrogen regulatory protein PII
Serine O-acetyltransferase
Ubiquinone biosynthesis hydroxylase UbiH/UbiF/VisC/COQ6
Hypothetical protein
Hypothetical protein
Tyrosine phosphatase
Hypothetical protein
Transposase
Transposase
Translation elongation factor P (EF-P)
Myo-inositol-1(or 4)-monophosphatase
DNA helicase C2
Transcriptional regulator cold shock protein DNA-binding protein
Carboxymethylenebutenolidase
Heat shock protein
Heat shock protein
Phosphatase IIIC
Transposase
Transposase
Transposase
Transposase
Hypothetical protein
Transposase
Transposase
Transposase
Transposase
dTDP-glucose pyrophosphorylase
Capsular polysaccharide biosynthesis protein
Phosphatase IIIC
Transposase
Transposase
Transposase
Hypothetical protein
Transposase
Hypothetical protein
Glucose-1-phosphate thymidylyltransferase
dTDP-glucose 4,6-dehydratase
Transposase
Transposase
Transposase
Transposase
Transposase
Transposase
Transposase
Transposase
Transposase
Hypothetical protein
Transposase
Transposase
Transposase
Transposase
Transposase
Transposase
Transposase
Hypothetical protein
N-acetylglucosaminyltransferase
Transporter of Ammonium
Hypothetical protein
Hypothetical protein
Proline iminopeptidase
Phage DNA site-specific tyrosinerecombinase RipX
Primosomal protein N'
Protein translocase subunit
Hypothetical protein
Ring-hydroxylating dioxygenase ferredoxin subunit
Acetyltransferase
Mannose-1-phosphate guanylyltransferase
O-succinylhomoserine sulfhydrylase
Unknown functionprotein
GTP cyclohydrolase I
Peptidase C56
Molybdenum cofactor biosynthesis protein B
Porin B carbohydrate-selective OprB
GTP-binding protein
DNA repair exonuclease
Fusaric acid resistance protein
Hypothetical protein
Major facilitator superfamily Multidrug resistance transporter HlyD/EmrA/FusE
Hypothetical protein
Hypothetical protein
Oxidoreductase
Hypothetical protein
Hypothetical protein
6,7-dimethyl-8-ribityllumazine synthase
Bifunctional protein (3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II)
Riboflavin synthase alpha subunit
Riboflavin biosynthesis protein
Ubiquinol-cytochrome c reductase cytochrome b
Ubiquinol-cytochrome c reductase cytochrome c1
Ubiquinol-cytochrome c reductase iron-sulfur subunit
Flavodoxin/nitric oxide synthase
Hypothetical protein
Hypothetical protein
Xanthine/uracil/vitamin C transporter
Hypothetical protein
Hypothetical protein
Arylesterase
Outer membrane protein
Phage integrase
DNA helicase restriction enzyme Type III R subunit
Transposase
Hypothetical protein
DNA helicase restriction enzyme Type III R subunit
DNA helicase restriction enzyme Type III R subunit
hypothetical protein
Hypothetical protein
Transposase
Transposase
Hypothetical protein
LSU ribosomal protein L21P
LSU ribosomal protein L27P
GTP-binding protein CgtA
Glutamate 5-kinase
Hypothetical protein
Hypothetical protein
Glucose-6-phosphate 1-dehydrogenase
Hypothetical protein
Arylesterase
Cell division protein
Methytransferase
Hypothetical protein
Cell division transpeptidase protein
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
Phospho-N-acetylmuramoyl-pentapeptide-transferase
UDP-N-acetylmuramoylalanine--D-glutamate ligase
Cell division protein
N-acetylglucosaminyl transferase
UDP-N-acetylmuramate--L-alanine ligase
UDP-N-acetylenolpyruvoylglucosamine reductase
D-alanine--D-alanine ligase
Cell division protein
Cell division protein
Cell division protein
UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
Hypothetical protein
DNA repair protein
DNA ligase
Pyruvate phosphate dikinase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
2-dehydro-3-deoxyphosphoheptonate aldolase
Nicotinic acid phosphoribosyltransferase
Hypothetical protein
Glutamyl-tRNA synthetase
Nicotinamidase
Lipoprotein pyruvate-formate lyase
Cation/heavy metal transporter
Hypothetical protein
Multicopper oxidase/copper resistance protein
Copper resistance protein
Ketol-acid reductoisomerase
Acetolactate synthase small subunit
Acetolactate synthase large subunit
tRNA delta(2)-isopentenylpyrophosphate transferase
Phosphoserine phosphatase
Hypothetical protein
Hypothetical protein
DNA/RNA helicase
Glycosyl transferase
Glycosyl transferase
Hypothetical protein
Serine hydroxymethyl transferase
Amino acid transporter
Delta-aminolevulinic acid dehydratase
Arginyl-tRNA--protein arginylyl transferase
DNA topoisomerase IV subunit A
DNA repair protein
Translation elongation factor Ts (EF-Ts)
SSU ribosomal protein S2P
Ring-hydroxylating dioxygenase ferredoxin subunit
Hypothetical protein
Aminotransferase
Para-aminobenzoate synthase component I
Pantoate--beta-alanine ligase
DNA polymerase III alpha subunit
Translation initiation inhibitor
ABC transporter Nitrate/sulfonate/bicarbonate transporter substrate-binding periplasmic protein
Aminotransferase
Aminotransferase
Glutamyl-tRNA synthetase
Endonuclease
Hypothetical protein
Cation/copper resistance transporter ATPase
Hypothetical protein
Cobalamin(vitamin B12) binding protein
Nucleoside diphosphate kinase
ABC transporter ATP-binding protein
Transporter
Two component response regulator
Two component sensor histidine kinase
Hypothetical protein
Translation initiation Factor 3 (IF-3)
Threonyl-tRNA synthetase
Lipopolysaccharide (LPS) heptosyltransferase
Tetratricopeptide repeat family protein
Glycosyl transferase
ATP-NAD kinase
Hypothetical protein
Hypothetical protein
Ribonuclease H
Homoserine kinase
Terpenoid biosynthesis protein
Hypothetical protein
ABC transporter ATP-binding protein
Oligoendopeptidase F
Glutamate synthase [NADPH] large chain
Glutamate synthase [NADPH] small subunit
3-beta-hydroxy-delta(5)-steroid dehydrogenase
Drug/metabolite transporter integral membrane protein
N-acetylmuramoyl-L-alanine amidase
Ribonuclease E
ATP phosphoribosyltransferase
Histidinol dehydrogenase
Translation initiation factor 1 (IF-1)
Septum formation inhibitor nucleotide-binding protein
Hypothetical protein
hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Phage related lysozyme
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Phage-related minor tail protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Phage minor tail protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Phage associated protein
Phage major capsid protein HK97
Phage head maturation protease
Phage major capsid protein HK97
Phage terminase large subunit
Prophage terminase small subunit
Endonuclease
Hypothetical protein
Phage DNA recombinase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Prophage antirepressor
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Phage transcriptional regulator and peptidase
DNA polymerase III exonuclease epsilon subunit like protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Transcriptional regulator
Hypothetical protein
Phage DNA recombinase
Cytochrome c class I
Hypothetical protein
Oxidoreductase
Aldehyde dehydrogenase
D-Lactate dehydrogenase NAD dependent
Hypothetical protein
Transglutaminase-like protein
Hypothetical protein
Hypothetical protein
Nicotinate-nucleotide pyrophosphorylase
Quinolinate synthetase complex A subunit
Hypothetical protein
Transcriptional regulator
NADH dehydrogenase
Aldehyde dehydrogenase
Major facilitator superfamily Arabinose transmembrane efflux protein
Hypothetical protein
Chromate reductase
Pirin domain protein
Transcriptional regulator LysR
Hypothetical protein
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbD/TolR
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbD/TolR
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbB/TolQ/MotA
TonB periplasmic protein
TonB-dependent Outer membrane siderophore receptor
Major facilitator superfamily Glucarate/galactarate transporter
Drug/metabolite transporter integral membrane protein
Hypothetical protein
Allophanate hydrolase subunit 2
Allophanate hydrolase subunit 1
Oxidoreductase
Acetyl-CoA carboxylase biotin carboxyl carrier protein
Acetyl-CoA carboxylase biotin carboxylase subunit
Acetyl-CoA carboxylase biotin carboxyl carrier protein
Aminotransferase
Transcriptional regulator LysR
Amidase
Oxidoreductase
1,4-alpha-D-glucan 1-alpha-D-glucosylmutase
Malto-oligosyltrehalose trehalohydrolase
Glycogen branching enzyme
Glycogen/starch synthase
Glycogen debranching enzyme
Hypothetical protein
Oxidoreductase
Acetolactate synthase large subunit
Monooxygenase FAD-binding
Transposase
Transposase
Monooxygenase FAD-binding
Electron transport transmembrane protein SenC/PrrC
TonB-dependent receptor
Hypothetical protein
Outer membrane protein
Transposase
Transposase
Phosphohydrolase
Transcriptional regulator LysR
Fusaric acid resistance protein
Hypothetical protein
Lysophospholipase
Hypothetical protein
Cytochrome c biogenesis thiol:disulfide interchange protein
Quaternary ammonium compound-resistance protein
Seryl-tRNA synthetase
Sec-independent protein translocase
Sec-independent protein translocase
Chromosome segregation and condensation protein
Chromosome segregation and condensation protein
Hypothetical protein
Arginyl-tRNA synthetase
Deoxyguanosinetriphosphate triphosphohydrolase
Iron-sulfur (Fe-S) cluster assembly protein YadR/YfhF
Exodeoxyribonuclease III
Glycosyl transferase
Nucleoside-diphosphate-sugar epimerase
Hypothetical protein
Coenzyme Pyrrolo-quinoline quinone (PQQ) synthesis protein A
Coenzyme Pyrrolo-quinoline quinone (PQQ) synthesis protein B
Coenzyme Pyrrolo-quinoline quinone (PQQ) synthesis protein C
Coenzyme Pyrrolo-quinoline quinone (PQQ) synthesis protein D
Coenzyme Pyrrolo-quinoline quinone (PQQ) synthesis protein E
Hypothetical protein
Clp protease proteolytic subunit
Hypothetical protein
Aminotransferase
Homoserine dehydrogenase
Fructose 1,6-bisphosphatase
Single-stranded-DNA-specific exonuclease
DNA-directed RNA polymerase Heat shock sigma 32
Ribosomal RNA large subunit 23S rRNA pseudouridine synthase D
ABC transporter Ferrichrome Fe3+-siderophore transporter permease protein
ABC transporter Iron(III) dicitrate transporter ATP-binding protein
Hypothetical protein
Branched-chain amino acid aminotransferase
DNA polymerase I
Electron transport transmembrane protein SenC/PrrC
1-acyl-sn-glycerol-3-phosphate acyltransferase
Major facilitator superfamily Alpha-ketoglutarate/sugar transporter
Transposase
Hypothetical protein
Cytochrome bd ubiquinol oxidase subunit II
Cytochrome bd ubiquinol oxidase subunit I
Iron-dependent peroxidase
Linocin M18 bacteriocin protein
L-asparagine permease
Hypothetical protein
Glucose dehydrogenase
Outer membrane protein
4-oxalocrotonate tautomerase
Adenosylmethionine-8-amino-8-oxononanoate aminotransferase
Transcriptional regulator
Allantoate amidohydrolase
Dihydropyrimidine dehydrogenase
Pyridine nucleotide-disulphide oxidoreductase
Transposase
Transposase
Transposase
TonB-dependent receptor
Hypothetical protein
Dihydropyrimidinase
APC transporter
APC transporter
Transcriptional regulator
Phosphoribosyl anthranilate isomerase
Orotidine 5'-phosphate decarboxylase
Hypothetical protein
Protein translocase subunit SecB
Glycosyl transferase
Pyridoxal phosphate biosynthetic protein
Pyridoxal phosphate biosynthetic protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Na+/solute symporter
Toxin-antitoxin systems
DNA repair protein for alkylated DNA
Beta-lactamase
Transcriptional regulator
Flavohemoprotein/Globin
ABC transporter D-methionine transporter permease protein
ABC transporter D-methionine transporter ATP-binding protein
ABC transporter D-methionine transporter substrate-binding periplasmic protein
D-Lactate dehydrogenase
Uroporphyrin-III C-methyltransferase
Arylesterase
Transcriptional regulator
Amidase
Flavin mononucleotide (FMN) reductase
Ribulose-5-phosphate 4-epimerase
2-dehydropantoate 3-reductase
Vanillate O-demethylase oxidoreductase subunit
Oxidoreductase
Aromatic-ring-hydroxylating dioxygenase beta subunit
Ring hydroxylating dioxygenase
Hypothetical protein
Acyl-CoA dehydrogenase
Porin B carbohydrate-selective
Aldehyde dehydrogenase
Alcohol dehydrogenase large subunit
Major facilitator superfamily General substrate transporter
Hypothetical protein
Transcriptional regulator LysR
ABC transporter Transporter substrate-binding periplasmic protein
Transporter permease protein
Transposase
Transposase
Transporter permease protein
ABC transporter Transporter substrate-binding periplasmic protein
ABC transporter ATP-binding protein
Aldehyde dehydrogenase
Amino acid transporter
Amino acid transporter
Hypothetical protein
2OG-Fe(II) oxygenase
Hypothetical protein
Hypothetical protein
TonB-dependent Outer membrane siderophore receptor
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbB/TolQ/MotA
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbD/TolR
TonB periplasmic protein
Transcriptional regulator LysR
Vanillate O-demethylase oxygenase subunit
Sodium:dicarboxylate symporter
Porin B carbohydrate-selective OprB
Hypothetical protein
Sorbitol dehydrogenase small subunit
Sorbitol dehydrogenase large subunit
Sorbitol dehydrogenase cytochrome c subunit
Aldehyde dehydrogenase
Major facilitator superfamily Sugar transporter
Adenosylcobalamin biosynthesis bifunctional
Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
Cobalamin (5'-phosphate) synthase
Cobalamin(vitamin B12) biosynthesis protein CbiB
L-threonine-O-3-phosphate decarboxylase
Cob(II)yrinic acid a,c-diamide reductase
Cobyric acid synthase
Cob(I) alamin adenosyltransferase
Phosphoglycerate mutase
Cobyrinic acid a,c-diamide synthase
Cobaltochelatase subunit
Cobalamin synthesis protein
Hypothetical protein
Hypothetical protein
Transcriptional regulator
Fusaric acid resistance protein
Acetate transporter
3-hydroxyisobutyryl-CoA hydrolase
Flavin mononucleotide (FMN) reductase
ABC transporter Mn2+/Zn2+ transporterer permease protein
ABC transporter Mn2+/Zn2+ transporter ATP-binding protein
ABC transporter Mn2+/Zn2+ transporter substrate-binding periplasmic protein
Transcriptional regulator
Hypothetical protein
Hypothetical protein
Translation initiation factor (IF-2B) alpha subunit
Hypothetical protein
Hypothetical protein
Cysteine synthase A (O-acetylserine sulfhydrylase A) protein
Bifunctional protein (GMP synthase/glutamine amidotransferase)
Hypothetical protein
DNA resolvase
DNA helicase inner membrane protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Transposase
Transposase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Transposase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Phage DNA recombinase
Major facilitator superfamily Transporter of sugar
Murein transglycosylase
L-lactate permease
Antibiotic biosynthesis monooxygenase
ADP-L-glycero-D-manno-heptose-6-epimerase
Prolipoprotein diacylglyceryl transferase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Murein transglycosylase
ABC transporter Polysaccharide/O-antigene exporter permease protein
ABC transporter Polysaccharide/O-antigene exporter ATP-binding protein
Hypothetical protein
Magnesium/cobalt transporter
Hypothetical protein
Aminotransferase
Ankyrin-like protein
Transketolase
Bifunctional protein (transaldolase and glucose-6-phosphate isomerase)
6-phosphogluconate dehydrogenase
Hydrolase
6-phosphogluconolactonase
Ribose 5-phosphate isomerase A
Gluconokinase
Hypothetical protein
Hypothetical protein
ABC transporter Fe3+ transporter Ferrichrome-binding periplasmic protein
Chloride channel protein
Alcohol dehydrogenase, Zinc-dependent
Hypothetical protein
Potassium transporter Kup system
Coproporphyrinogen III oxidase
Hypothetical protein
Hypothetical protein
ABC transporter Urea short-chain amide or branched-chain amino acid transporter ATP-binding protein
ABC transporter Urea short-chain amide or branched-chain amino acid transporter ATP-binding protein
ABC transporter Urea short-chain amide or branched-chain amino acid transporter permease protein
ABC transporter Urea short-chain amide or branched-chain amino acid transporter permease protein
ABC transporter Urea short-chain amide or branched-chain amino acid transporter periplasmic substrate-binding protein
Two component hybrid sensor histidine kinase and regulator
Two component response regulator
Hypothetical protein
Hypothetical protein
Transposase
Transposase
Hypothetical protein
Urease accessory protein
Urease accessory protein
Urease accessory protein
Urease alpha subunit
Urease beta subunit
Urease gamma subunit
Urease accessory protein
Transporter with high-affinity to nickel
Pyruvate decarboxylase
Phosphoglycerate/bisphosphoglycerate mutase
Hypothetical protein
Hypothetical protein
Bacterioferritin
Hypothetical protein
Hypothetical protein
DNA-3-methyladenine glycosylase I
Transcriptional regulator
Peroxiredoxin
Metallo-beta-lactamase
Hypothetical protein
Transporter of sulfate
Arsenate reductase
Transposase
Pirin domain protein
Secretion system type I outer membrane efflux pump lipoprotein NodT
Major facilitator superfamily Multidrug resistance transporter HlyD/EmrA/FusE
Major facilitator superfamily Transporter
Transcriptional regulator LysR
Transposase
Porin B carbohydrate-selective OprB
Major facilitator superfamily Transporter
Transposase
Asp/Glu racemase
Esterase/lipase
Isochorismatase hydrolase
Hypothetical protein
Aldehyde dehydrogenase cytochrome c subunit
Oxidoreductase
Salicylate 1-monooxygenase
Transcriptional regulator
Transposase
Hypothetical protein
Cell division AAA ATPase
Conjugal transfer protein
Transposase
Transposase
Conjugal transfer protein
Conjugal transfer protein
Conjugal transfer protein
Transposase
DNA resolvase
Transcriptional regulator helix turn helix domain
Hypothetical protein
Hypothetical protein
Transposase
Transposase
Transposase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Plasmid replication initiator
Transposase
Transposase
Transposase
DNA resolvase
UDP-N-acetylglucosamine 4-epimerase
Hypothetical protein
Metallo-beta-lactamase
Hypothetical protein
Xanthine dehydrogenase accessory factor CoxI
Hypothetical protein
Translation initiation inhibitor
Hypothetical protein
Glycine dehydrogenase
Glycine cleavage system H protein
Glycine cleavage system T protein
Spermidine synthase
S-adenosylmethionine (SAM) decarboxylase proenzyme
Hypothetical protein
Transcriptional regulator LysR
Peptidyl-prolyl cis-trans isomerase
Pantetheine-phosphate adenylyltransferase
DNA gyrase subunit A
Hypothetical protein
2-nitropropane dioxygenase
Polyribonucleotide nucleotidyltransferase RNA binding S1
SSU ribosomal protein S15P
tRNA pseudouridine synthase B
ABC transporter permease protein
ABC transporter ATP-binding protein
Paraquat-inducible protein B
Outer membrane lipoprotein
Glycosyl transferase
Hypothetical protein
Glycosyl transferase
Tetratricopeptide repeat family protein
Major facilitator superfamily Multidrug resistance transporter EmrA/FusE
ABC transporter ATP-binding protein
Hypothetical protein
Methionine synthase
Phosphoribosyl ATP pyrophosphatase
Bacteriocin/colicin V production
Amido phosphoribosyl transferase
Hypothetical protein
Paraquat-inducible protein B
Paraquat-inducible protein A
Glycosyl transferase
Glycosyl transferase
ATP synthase F0 B' chain
ATP synthase F0 B' chain
ATP synthase F0 C chain
ATP synthase F0 A chain
ATP synthase protein I
Cell division protein
tRNA 2-methylthioadenosine synthase
Diaminopimelate epimerase
Lactoylglutathione lyase
Hypothetical protein
DNA/RNA helicase
Hypothetical protein
Peptidase S10 serine carboxypeptidase
SSU ribosomal protein S9P
LSU ribosomal protein L13P
Hypothetical protein
NADH-ubiquinone oxidoreductase 39-40 kDa subunit
Transcriptional regulator for phosphate uptake
ABC transporter Phosphate transporter ATP-binding protein
ABC transporter Phosphate transporter permease protein
ABC transporter Phosphate transporter permease protein
Dihydroxy-acid dehydratase
Hypothetical protein
Alcohol dehydrogenase, Zinc-dependent
Hypothetical protein
Hypothetical protein
Endopeptidase DegP/Do
Lipolytic enzyme
Hypothetical protein
Iron-sulfur cluster assembly/repair protein
Hypothetical protein
Hypothetical protein
Thymidylate synthase (FAD)
Hypothetical protein
Fumarate hydratase class I
Lactoylglutathione lyase
Hypothetical protein
Hypothetical protein
D-amino acid dehydrogenase small subunit
Alanine racemase
Transcriptional regulator Lrp
Ribosome-binding factor A
Translation initiation Factor 2 (IF-2)
Hypothetical protein
Transcription termination/elongation factor
Hypothetical protein
Hypothetical protein
Clp protease ATP-binding subunit
Hypothetical protein
Transcriptional regulator LysR
ABC transporter Amino acid transport permease protein
ABC transporter Amino acid transporter ATP-binding protein
Aconitate hydratase
ABC transporter Heme exporter ATP-binding protein
Heme exporter protein B
Hypothetical protein
Ornithine decarboxylase
t-RNA-processing ribonuclease BN
Rare lipoprotein A
3-dehydroquinate dehydratase
Acetyl-CoA carboxylase biotin carboxyl carrier protein
Acetyl-CoA carboxylase
Major facilitator superfamily Sugar transporter
Thiamine biosynthesis protein
Hypothetical protein
Hypothetical protein
Iron transporter
Fe2+ high-affinity transporter
Porin B carbohydrate-selective
Hypothetical protein
Hypothetical protein
Porin B carbohydrate-selective
Transcriptional regulator LysR
4-aminobutyrate aminotransferase
Hypothetical protein
Holliday junction resolvase
Glutamyl-tRNA(Gln) amidotransferase subunit C
Amidase
Glutamyl-tRNA(Gln) amidotransferase subunit B
ABC transporter ATP-binding
Endonuclease III
Ferrochelatase
DNA glycosylase A/G-specific
Hypothetical protein
Hypothetical protein
Murein transglycosylase
Hypothetical protein
Leucyl-tRNA synthetase
Hypothetical protein
DNA polymerase III delta subunit
Secretion system type I outer membrane efflux pump lipoprotein NodT
Transcriptional regulator
Electron transfer flavoprotein alpha subunit
Electron transfer flavoprotein beta subunit
Electron transfer flavoprotein-ubiquinone oxidoreductase
Hypothetical protein
Coproporphyrinogen III oxidase
Outer membrane protein
Transcriptional regulator cAMP-binding
Endopeptidase DegP/Do
CMP/dCMP deaminase
Hypothetical protein
Glutamine amidotransferases-like
tRNA/rRNA pseudouridine synthase
N6-adenine-specific methylase
Single-strand DNA binding protein Ssb
Hypothetical protein
Transcriptional regulator
Phage DNA recombinase
Hypothetical protein
DNA resolvase
Hypothetical protein
Transposase
Hypothetical protein
Transposase
Transposase
Glycosyl transferase
Hypothetical protein
Tyrosyl-tRNA synthetase
DNA gyrase modulator
Phosphoglycerate/bisphosphoglycerate mutase
Hypothetical protein
dTDP-glucose 4,6-dehydratase
Glucose-1-phosphate thymidylyltransferase
dTDP-4-dehydrorhamnose 3,5-epimerase
dTDP-4-dehydrorhamnose reductase
Alpha-L-Rha alpha-1,3-L-rhamnosyltransferase
Cell division protein
Ribosomal RNA large subunit 23S rRNA pseudouridine synthase A
Glycosyl transferase
Glutathione S-transferase
tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
Ferredoxin 2Fe-2S
Cysteine desulfurase II
Cysteine desulfurase I
Alpha/beta hydrolase
Ribosomal large subunit 23S rRNA methyltransferase
Cysteinyl-tRNA synthetase
Bifunctional protein (folylpolyglutamate synthase/dihydrofolate synthase)
Acetyl-CoA carboxylase carboxyl transferase beta subunit
Thioredoxin
DNA helicase II
Nuclease
ATP/GTP hydrolase
Two component response regulator
Phosphoglucosamine mutase
Dihydropteroate synthase
Cell division ATP-dependent metalloprotease
Ile-tRNA lysidine synthase
Hypothetical protein
Peptidoglycan-associated lipoprotein
Secretion system type I outer membrane protein
TonB periplasmic protein
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbD/TolR
TonB dependent biopolymer transporter integral cytoplasmic membrane subunit ExbB/TolQ/MotA
4-hydroxybenzoyl-CoA thioesterase
Holliday junction DNA helicase
Holliday junction resolvase RusA
Holliday junction resolvase
Hypothetical protein
Protein translocase subunit
Peptidyl-prolyl cis-trans isomerase
Arginine biosynthesis bifunctional protein
Hypothetical protein
Mechanosensitive ion channel Small-conductance
Hypothetical protein
Hypothetical protein
Hypothetical protein
Heat shock protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Pyrroline-5-carboxylate reductase
Transcriptional regulator
Major facilitator superfamily Transporter
Histone-like bacterial DNA-binding protein HU
Glycosyl transferase
Glycosyl transferase
Outer membrane protein
Glycosyl transferase
NAD(+) synthetase
Imidazoleglycerol-phosphate dehydratase
Amido transferase HisH
1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
Imidazoleglycerol phosphate synthase cyclase subunit
Phosphoribosyl ATP pyrophosphatase
Adenosine 5'-monophosphoramidase
Oxidoreductase
Monooxygenase
Hypothetical protein
Hypothetical protein
Glutathione S-transferase
Chromosome partitioning nuclease protein
Chromosome partitioning protein ParA/MRP/soj
Glucose inhibited division protein B
Glucose inhibited division protein A
tRNA modification GTPase ThdF
O6-methylguanine-DNA methyltransferase
Hypothetical protein
Transposase
Hypothetical protein
Lysine decarboxylase family
Major facilitator superfamily Transporter
ADP-ribose pyrophosphatase
Hypothetical protein
Phosphatase/phosphohexomutase
Uroporphyrinogen decarboxylase
Septum formation inhibitor nucleotide-binding protein
Phage related protein
Hypothetical protein
Phage related protein
Hypothetical protein
Hypothetical protein
DNA resolvase
Phage/plasmid primase P4
DNA recombinase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Transposase
DNA helicase II UvrD/Rep
Transposase
Transposase
DNA resolvase
Transposase
Mannitol dehydrogenase
Phosphatase/phosphohexomutase
Hypothetical protein
Hypothetical protein
DNA helicase superfamily I
Transposase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Transposase
Hypothetical protein
Transposase
Transposase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Thiol:disulfide interchange protein
Conjugal exonuclease V alpha subunit
Transposase
Phage integrase
Plasmid replication initiator
Chromosome partitioning protein ParA/MRP/soj
Chromosome partitioning nuclease protein
Hypothetical protein
DNA methylase/helicase
Transposase
Histone-like bacterial DNA-binding protein HU
Hypothetical protein
Conjugal exonuclease V alpha subunit
Transposase
Transposase
Transposase
Transposase
Transcriptional regulator
alcohol dehydrogenase NADH-dependent iron-containing
Aldehyde dehydrogenase
Transposase
Transposase
Transposase
Hypothetical protein
Hypothetical protein
Potassium transporter ATPase A chain
Potassium transporter ATPase B chain
Potassium transporter ATPase C chain
Two component sensor histidine kinase
Two component response regulator
Antiporter of Na+/H+ NhaA/NhaP
Hypothetical protein
Transposase
Sulfotransferase
Transcriptional regulator
Acyltransferase
Hypothetical protein
Cell filamentation cAMP-inducing protein Fic
Hypothetical protein
Replication protein C
Hypothetical protein
Transposase
TonB-dependent receptor
Glycerophosphoryl diester phosphodiesterase
Drug/metabolite transporter integral membrane protein
Transcriptional regulator
Integral membrane protein
Transposase
Transposase
Hypothetical protein
Hypothetical protein
Transposase
Transposase
Transcriptional regulator
Hypothetical protein
Hypothetical protein
Transposase
Transposase
Transposase
Transporter of manganese
ABC transporter ATP-binding protein
Transcriptional regulator
Porin B carbohydrate-selective
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Ring-hydroxylating dioxygenase ferredoxin subunit
Transposase
Transposase
Transposase
Transposase
Transposase
Transposase
Arylesterase
Hypothetical protein
Transposase
Hypothetical protein
CRISPR-associated helicase
Hypothetical protein
Hypothetical protein
CRISPR-associated protein
CRISPR-associated protein
CRISPR-associated protein
CRISPR-associated protein
CRISPR-associated protein
Hypothetical protein
Transposase
Hypothetical protein
Hypothetical protein
Transposase
Transposase
Hypothetical protein
Transposase
Transposase
Sec-independent protein translocase
Hypothetical protein
Transposase
Transposase
Transposase
Hypothetical protein
Translation repressor RelE/RelB/StbE
Translation repressor RelE/RelB/StbE
Abortive infection bacteriophage resistance protein
Hypothetical protein
Hypothetical protein
Transposase
Transposase
Transposase
Porin O and P phosphate-selective
Transposase
TonB-dependent IMP dehydrogenase/GMP reductase
Hypothetical protein
Hypothetical protein
TonB periplasmic protein
Transposase
Transposase
Histone-like bacterial DNA-binding protein HU
Transposase
Transposase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Endoribonuclease
Transcriptional regulator
Transcriptional regulator PilT
Nitrogen regulatory protein
Transposase
Transposase
DNA resolvase
Hypothetical protein
Transposase
Transposase
Oxidoreductase
Acetyl-CoA synthetase
Flavin-containing monooxygenase
Glycosyl transferase
Selenophosphate synthetase
Acetyltransferase
Iron-molybdenum cofactorbiosynthesis nitrogenase
Nitrilase
Hypothetical protein
Transcriptional regulator
Hypothetical protein
Transcriptional regulator LysR
Major facilitator superfamily Multidrug resistance transporter QacA
Transposase
Transposase
Transposase
DNA helicase II
DNA helicase TraA
Phage integrase
Transposase
Hypothetical protein
Transposase
Transposase
Type I endonuclease restriction R subunit
Type I DNA specificity S subunit
Transposase
Transposase
Type I DNA specificity S subunit
DNA polymerase beta subunit like nucleotidyltransferase
Nucleotidyltransferase
Type I DNA methyltransferase M subunit
NADH:flavin oxidoreductase
Transposase
Hypothetical protein
Transposase
Hypothetical protein
Transcriptional regulator LysR
Acetylornithine deacetylase
Alcohol dehydrogenase
Cytosine/purines/uracil/thiamine/allantoin transporter
Endoribonuclease
Aldehyde dehydrogenase
Flavin-containing monooxygenase
Hypothetical protein
Transposase
Transposase
ABC transporter Nitrate/nitrite transporter ATP-binding protein
Two component response regulator
Molybdopterin oxidoreductase
Transposase
Transposase
Molybdopterin oxidoreductase
Nitrite reductase [NAD(P)H] large subunit
Nitrite reductase (NAD(P)H) large subunit
Hypothetical protein
Nitrate transporter
Nitrate transporter
Nodulin-related Integral membrane protein
Two component sensor histidine kinase
Two component response regulator
Resistance-nodulation-division superfamily Multidrug efflux pump acriflavin resistance protein
Major facilitator superfamily Heavy metal/cation efflux pump HlyD
Cobalt/zinc/cadmium resistance heavy metal efflux pump protein
Hypothetical protein
DNA resolvase
Transposase
Hypothetical protein
Hypothetical protein
5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase
Transcriptional regulator LysR
Transposase
Transposase
Transcriptional regulator
Translation repressor RelE/RelB/StbE
Flavin-containing monooxygenase
Arsenical resistance protein
Arsenical membrane pump protein
Arsenate reductase
Metal-dependent hydrolase
Type I/III endonuclease restriction R subunit
Type I DNA specificity S subunit
Type I DNA methyltransferase M subunit
Hypothetical protein
Transposase
Transposase
Nodulin-related protein
Arsenate reductase
Arsenical membrane pump protein
Transposase
Transposase
Transposase
Transcriptional regulator LysR
Major facilitator superfamily Multidrug resistance transporter
Transposase
Transposase
Hypothetical protein
Transcriptional regulator PilT
Transposase
Transposase
Transposase
Transposase
Potassium transporter Kup system
Transposase
Transposase
Potassium transporter Kup system
Transposase
Transposase
Hypothetical protein
Transposase
Conjugal exonuclease V alpha subunit
Transposase
Transposase
Conjugal transfer protein TraG/DotL/TrbC/IcmO
Hypothetical protein
Hypothetical protein
Conjugal muramidase TrbN/BfpH
Hypothetical protein
Secretion system type II protein TraJ
Conjugal transfer protein TraI
Secretion system type IV protein
Translation repressor RelE/RelB/StbE
Translation repressor RelE/RelB/StbE
Secretion system type IV protein IcmB
Transposase
Transposase
Hypothetical protein
Hypothetical protein
Hypothetical protein
Transposase
Oxidoreductase
Transposase
Transposase
Transposase
Outer membrane protein
Transposase
Transposase
Hypothetical protein
Hypothetical protein
Pilus retraction motor protein
Transposase
Transposase
Pilus retraction motor protein
Hypothetical protein
Phage integrase
Resistance-nodulation-division superfamily Multidrug efflux pump acriflavin resistance protein
Multidrug efflux membrane pump
Secretion system type I outer membrane efflux pump lipoprotein
Cation efflux system protein
Transcriptional regulator
Hypothetical protein
Hypothetical protein
Potassium transporter ATPase A chain
Potassium transporter ATPase B chain
Potassium transporter ATPase C chain
Two component sensor histidine kinase
Two component response regulator
Transcriptional regulator
Oxidoreductase
Protease/amidase
Type I/III endonuclease restriction R subunit
Type I/III endonuclease restriction R subunit
Type I DNA specificity S subunit
Type I DNA methyltransferase M subunit
Hypothetical protein
Phage DNA recombinase
Hypothetical protein
Hypothetical protein
Plasmid maintenance protein
Transcriptional regulator PilT
Transposase
Transposase
Hypothetical protein
CcdB-like toxin protein
Phage integrase (truncated middle)
Transposase
Transposase
Major facilitator superfamily Sugar transporter
Transposase
Transposase
Hypothetical protein
Hypothetical protein
Chromosome partitioning nuclease protein
DNA methylase/helicase
Transposase
Transposase
Plasmid replication initiator
Phage DNA recombinase
Transposase
Hypothetical protein
Hypothetical protein
Transposase
Transposase
Transposase
Transposase
DNA resolvase
Hypothetical protein
Hypothetical protein
Conjugal transfer protein TraG/DotL/TrbC/IcmO
Transposase
Transposase
Hypothetical protein
Outer membrane protein
Hypothetical protein
Transposase
Transposase
DNA resolvase
Transposase
Transposase
DNA resolvase
DNA resolvase
Transposase
ATP-binding protein
DNA resolvase
Plasmid partitioning family protein MinD
Hypothetical protein
Plasmid replication initiator
Hypothetical protein
Transcriptional regulator
Death-on-curing protein
Prevent-host-death protein Phd
Pilus retraction motor protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Conjugal transfer protein TraG/DotL/TrbC/IcmO
Hypothetical protein
Conjugal transfer protein
Plasmid stabilization protein
Plasmid stabilization protein
Hypothetical protein
Transposase
DNA resolvase
Plasmid partitioning family protein MinD
Transcriptional regulator
Translation repressor RelE/RelB/StbE
Hypothetical protein
Esterase/lipase
Transposase
Transposase
Hypothetical protein
Hypothetical protein
DNA methylase
Cell filamentation cAMP-inducing protein Fic
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
DNA resolvase
Transposase
Hypothetical protein
Outer membrane protein
Transposase
Transposase
Translation repressor RelE/RelB/StbE
Transcriptional regulator
Plasmid partitioning family protein MinD
Hypothetical protein
Mobilization protein MobA/MobL
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
Hypothetical protein
te-binding protein

				
DOCUMENT INFO
Shared By:
Categories:
Tags:
Stats:
views:12
posted:12/19/2011
language:
pages:154